Suchergebnisse

Issue 65.3 of the Review for Religious, 2006. ; Bei~ Religiofis ~QUARTERLY 65~3 2006 Review for Religious fosters dialogue with Godi .dialogue with ourselves, and dialog4~e with one another about the holiness we tryto live according to gts~ari~s o.f Catholic religious life. As Pope Paul VI said, our way Of being dsurcb is today tlse~, way of dialogue. Review for Religious (ISSN 0034-639X) is published quarterly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindel] Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-633-4610 ¯ Fax: 314-633-4611 E-Mail: review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ Pontifical College Josephinmn 7625 North High Street ° Columbus, Ohio 43235 POSTMASTER Send address changes to Review for Rdigious ¯ P.O. Box 6070 ¯ Duluth, NIN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2006 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library, clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. ~gournalof Catholic ~piri~uality view for religious Editor Associate Editor Canonical Counsel Scripture Scope Editorial Staff Webmaster Advisory Board David L. Fleming SJ Philip C. Fischer SJ Elizabeth McDonough OP Eugene Hensell OSB Mary Ann Foppe Tracy Gramm Judy Sharp Clare Boehmer ASC Stephen Erspamer OSB "Kathleen Hughes R$CJ Louis ~nd Angela Menard Bishop Terry Steib SVD Miriam D. Ukeritis CSJ QUARTERLY 65.3 2006 contents prisms 228 Prisms 230 coming together The 2004 Consecrated-Life Congress: A Restrospective Karen M. Kennelly CSJ summarizes the thinking and the participants' interaction at the 2004 Consecrated-Life Congress held in Rome and proposes that some themes should impact local chapters and congregational meetings. ¯ Reflection and Discussion Questions 244 A New Way of Meeting . Rachael M. Harrington SNDdeN describes one carefully planned attempt to capture new life and meaning that might be incorporated into the usual chapter or congregational meeting. 226 255 meeting God Aspiratory Prayer, a Welcome Addition to Contemplative Prayer Ernest E. Larkin OCarm describes the prayer of aspiration, reviews its hisory in spirituality, identifies a few of its main proponents, and suggests ways that we might make it part of our lives. Reflection Questions Review for Religious 272 "Repose Days" during the Ignatian Exercises Philip Shano SJ reflects upon the purpose and use of repose days within the Ignatian thirty-day retreat and raises questions for retreat directors. 283 Gerard Manley Hopkins's "Lantern out of Doors": A Contemplative Response to Loss Charles P. Farrar praises the spiritual theology of Hopkins's sonnet which describes the experience of personal loss with the metaphor of a lantern passing in the night. What first seems subjective and formulaic proves to be psychologically and theologically insightful. 293 3O4 being religious Today's Candidates: Who Are They, What Do They Expect? Raymond R. Ryan OSA allows younger members within the religious congregation to present a snapshot picture of their hopes and desires for community life and mission. These Strawberries Are Divine! Sisters and a Spirituality of Living on Earth Colleen Carpenter Cullinan provides a glimpse of the contributions of Catholic religious congregations of women in founding farms and Earth centers as places to raise organic food and educate people about the deep human connection to God's creation. Prayer / Reflection and Discussion Questions departments 319 Scripture Scope: Reading the Gospel of John 323 Canonical Counsel: Archives of Religious Communities 328 Book Reviews 65.3 2006 prisms Tintroduce the Gospel story of the Annunciation, St. Ignatius Loyola would have us picture the three divine Persons of the Trinity in dialogue about how better to accom-plish the salvation of humankind. We might describe it as the first communal discernment. The meetings that people hold when things are to be decided--meetings sometimes so contentious that they seem "eternally" long--can be seen as human strivings to imitate the wise personal planning of the Blessed Trinity. As our journal's mission statement declares, Pope Paul VI identified dialogue as a way of being church, especially in our time. Our world, with its instant communication by radio, television, Internet, and cell phone, has often taken away from us our black-and-white, simplistic judgments about who is the enemy, about who is being saved, about what other religions believe, about under-standing sexual orientations and various complex life issues, and about the cultural values of a world society. In the Old Testament's Book of Genesis, Cain's question, "Am I my brother's keeper?" has been answered definitively by our Christian faith. Jesus in giving us his one commandment allows for no wiggle room: we are to love God with all our mind, soul, and strength and our neighbor as our-selves. And loving, as all marriages and deep friendships know, takes a lot of dialoguing. We all are aware that our love of God devel-ops through a dialogue called prayer. Mthough there are many books describing some classic Re~iew for Religious forms of praying, usually drawn from the practice and example of the holy men and women preceding us, we still must make our conversation with God our own. We are not on stage, reciting lines written by some playwright. God and we share from our hearts. That is why prayer, even in its quiet moments, is always a dialogue. As in every deep human relationship, the dialogue of sharing never has an end. In fact, this signifies the promise of eternal life with God. For many of us today, meetings seem a way of life. We see it in world diplomacy, we know it in business, we par-ticipate in it in our parishes, in our religious communities, and in our neighborhood associations. Most of us desire fewer meetings, more efficiently run meetings, meetings with clearer outcomes, and meetings which bring about something better for everyone involved. For we are aware of many frustrations in communal dialogue. We have exam-ples on the international scale, on the church level, and in religious-life interworkings where dialogue breaks down or perhaps is never entered into. Just as personal dialogue with God (prayer) portends our relational life with God forever, so group dialogue in meetings, conferences, and religious chapters needs to be valued as our way of enter-ing more closely into the dialogical life of God. "Dialogue is our way of being church." We are the church. Our identity is not just in our prayer; it is lived out in the necessary human interactions of today's com-plex world. In our meetings, conferences, and religious chapters, let us work to discover how God is entering us more deeply into God's own life--a life of shared dialogue. If the incarnation is the result of our trinitarian God's meet-ing, in what ways are God and divine grace present to the world in our human meetings? David L. Fleming SJ 65.3 2006 KAREN M. KENNELLY The 2004 Consecrated-Life Congress: A Retrospective coming together 230] A myriad of thoughts and images come to mind as I look back at the Congress on Consecrated Life held in Rome in November 2004: hundreds of faces, a babble of languages, colorful multinational garb, and icons of the Woman at the Well and the Good Samaritan focusing us on the congress theme, "Passion for Christ, Passion for Humanity." The mixed composition of the congress made it unique. For the first time, leadership from both women's and men's congregations met in an international con-vocation to address a common agenda. Repre-sentatives of the national and international conferences of religious, groups of young religious and theologians, and editors of religious journals joined religious superiors as full participants. Karen M. Kennelly CSJ, a member of her congregation's leadership team, may be addressed at Sisters of St. Joseph of Carondelet; 2311 S. Lindbergh Boulevard; St. Louis, Missouri 63131. Review for Religious A further note of uniqueness lay in the process used to prepare for, carry out, and follow up on the meeting. Preparation spanned a four-year period involving "envisioning" and "theological summary" groups. The first group sought to achieve consensus on the actual reality of religious life today by eliciting facts and testimonials from around the world. The second analyzed the collected information from a theological perspective and summarized it in a working paper sent in advance to all congress participants. We all had an opportunity to express our preferences for small-group discussions on topics drawn from the working paper. Theologians responsible for composing the paper came from Norway, Spain, France, Italy, the United States, the Philippines, and Burkina Faso. Others, from Mexico, Germany, and Peru, collaborated via the Internet. During the congress a third or "Listeners" group gathered impressions and ideas as they were expressed in papers presented by the major speakers, in written reports from groups, and in comments from the floor. This group's work culminated in a synthesis presented to the congress on the last day. My experience as a member of the Listeners group made me aware of the congress planners' painstaking efforts to be as pluralistic and inclusive as possible, achieving active participation by those present to the extent that numbers, languages, and ~ime permitted. As with the other groups, our membership comprised about equal numbers of women and men, drawn from every continent. From day to day our dialogue grew in intensity as we listened, exchanged impressions and observations, and began identifying common threads among the multiplicity of ideas brought to the floor. The principal speakers brought unique perspectives to the assessment of contemporary religious life, beginning 6~.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress 232 ] with a joint paper by two Italians, Bruno Secondin and Diana Papa, a Carmelite and a Poor Clare. They invited the 847 participants, gathered at some ninety round tables and aided by simultaneous translations into six languages, to begin the adventure of immersing themselves in the themes articulated in the working paper. Dolores Aleixandre, of Spain, a Religious of the Sacred Heart of Jesus and a theologian, brought scriptural exegesis to the congress's theme, religious life as passion for Christ and for humanity. She saw in the icons of the Samaritan Woman and the Good Samaritan "a call to center ourselves on the essential, to a different way of relating to each other, of supporting each other intercongregationally, of making room for the laity" (cited from her paper as published in Passion for Christ, Passion for Humanity, Pauline Books and Media, 2005, pp. 91-125)--insights that were to be echoed frequently by congress participants in the days to come The Brazilian Jesuit Jo~o Batista Lib~nio brought a sociological and liberation-theology perspective to religious life at the beginning of the third millennium. He spoke of the vows of poverty, chastity, and obedience as having significance today only in relation to three elements: an experience of God, community life, and mission. He challenged us to rethink consecrated life from the bottom up in the light of contemporary reality with all its "ambiguity, perplexity, and paradox" (PCPH, pp. 127-171). The British Dominican Timothy Radcliffe asked "what signs religious life offers" in the wake of the World Trade Towers' destruction on 11 September 2001, an event he views as symbolic of the world in which religious life exists today, paradoxically bound ever more tightly together by instant communication and ever more deeply divided by violence (PCPH, pp. 173-189). How, he asked, Review for Religious can religious be a "sign of humanity's common home in God" in a world suffering a crisis of homelessness? What future awaits religious life in a world seemingly offering only a future of violence? What has religious life to offer as the culture of control and the struggle for hegemony intensify? A North American voice was heard in the person of an Immaculate Heart of Mary sister, Sandra M. Schneiders. She picked up on a topic Radcliffe had noted as fundamental but had not explored, namely, the culture of consumerism and our -:~ witness to poverty. Her reflections involved a discussion of how religious incarnate renunciation of the "world" and go about creating "the alternate world generated by the profession of the vows" (PCPH, pp. ' i '~ " ~ ' ' 191-218). Characterizing the . ~ . "' -' ~ . . religious lifestyle as one rooted in the "public, lifelong commitment of the members, as individuals and as communities, to a characteristic approach to material goods, power, and sexuality," she caught the assembly's imagination early in her talk with her arresting statement that she would discuss, not "the future Of religious life," but rather "religious life of the future." Schneiders's imaginative and theologically profound exploration of evangelical poverty as the "economy of the reign of God," and of prophetic obedience as the "politics of the reign of God," gave us much to think about as Vincentian Franc Rod6, prefect of the Congregation for Institutes of Consecrated Life and Societies of Apostolic Life (CICLSAL), brought the series of formal presentations to a close with a recapitulation of major .¢":t~lig!oU~ life,'in a world ~seemingly offering only ~a~tu~e ff v~ole~ce? 65.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress 234 themes in recent papal documents such as Hta consecrata and Novo millennio ineunte (PCPH, pp. 219-2 3 6). Participants next divided into continental groups to look at sociological factors touching upon consecrated life in their own continents, noting both positive and negative effects these factors were thought to have on the capacity of religious to be passionate for Christ and for humanity. Some of the most acute observations expressed in the congress--whether from the floor during open-microphone time or in the hastily written reports-- flowed from these gatherings. As Listeners striving to perceive the essence of group contributions, we constandy had to make allowances for the great diversity within the somewhat artificial continental categories. The Europeans prefaced their report by describing it as a "communion of intentions" and "truly an exercise in European communion," given the different languages and situations in which Europe finds itself. Asians noted the vastness of their continent and its diversity of languages, cultures, religions, and political and economic systems before commenting on their many shared concerns. The Africans' preface included this in bold type: "Note: in Africa it is not possible to generalize. There is great diversity in the situations." Those from Oceania, the smallest segment of the congress, nevertheless noted the extremes they represented: countries with predominantly Western European lifestyles and countries where the lifestyles are indigenous to Melanesia and the Pacific. Only the North American and Latin American groups dispensed with such cautions and addressed directly their shared task of identifying the impact of sociological factors on religious life as they experienced it. Themes from the continental groups that seem worthy of special attention, whether for their singularity Review for Religious or their commonality, include gender issues; war, violence, and disease; globalization; aging, institution-alization, and rigid structures; and clear signs of new life among religious. Religious from every continent saw gender issues as adversely affecting contemporary religious life. Europeans referred to "the open question of gender" and felt that, "because of the sexual abuse and the impact on the mass media, consecrated life is reduced in energy and its ability to witness: a sense of desolation pervades and passion is suppressed." Asians underscored "male North Americans were succinct in ~their assertion that "the ~ ~,!sociology' within the church is-an obstacle to the passion for Christ and for humanity." domination in society and church" and "machismo and male domination" as sociological factors adversely affecting them. The African report alluded to the problem in rather oblique fashion by noting that "the idea of relations between men and women continues to be very much determined by the culture." North Americans were succinct in their assertion that "the sociology within the church is an obstacle to the passion for Christ and for humanity. The lack of inclusivity . . . results in feelings of displacement in the church, a sense of being marginalized by many, particularly in women's communities." Those from the Latin American (and Caribbean) continental group cited as important values "awareness of the processes of exclusion and the greater involvement of women." They felt they were being called to "generate a feminine 65.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress religious life with more involvement and responsibility for the building of a new history and a feminine consciousness-raising that challenges the machismo in society and in the church." The Oceania report minced no words in seeing as a problem the "public face of the church: powerful, antiwomen, and hypocritical." It came as no surprise that Europeans were the most forceful in pointing out the "aging of the population, the generation gap in religious life," and "rigidity in structures, even of consecrated life" as sociological factors with negative effects on religious life. In other words, they asserted that the passion of religious for humanity is blocked by the "way in which our structures are closed and in which we are closed towards the world of the laity." Less predictable was the echoing of this view by other groups. The Asians, for example, felt that institutionalization in their region had created a gap between them and the people, "especially the poor, who identify us with the rich," and that "religious structures have stifled the spirit and dynamism of religious life. The young feel restricted and their freedom hindered by structures the old always lean on." A similar concern shows up in the African report; it lists as negative aspects "the weight of tradition" and "a way of seeing authority at the level of leaders, a traditional conception which still dominates both society and religious life." This report speaks urgently of a need for reflection on consecrated life that is distinctly African, a need to find an African way of following Christ. Such thoughts question the worth of structures inherited from a colonial past. These concerns surfaced also in the Asian group, which considered it deplorable that "Asian religious have been uprooted from their rich culture." The report from Oceania, too, alluded to rigid structures when it asserted that "restorationism" in the church, Review for Religious while attracting people looking for security, has caused consecrated life to lose credibility as a radical commit-ment to justice. The Latin Americans saw sociological factors to be causes or occasions of religious being "tamed by the institution [of religious life], tired, with little hope, disenchanted, adapting, living in indifference, [possessing] little consciousness of [consecrated life's] own identity, of its own ability to search, [experiencing] great difficulty in having deep interpersonal relationships with others and with God." They offered the intriguing possibility of countering this loss of the prophetic and mystic elements of religious life by working with the "small utopias which act in favor of humanity and in collaboration with other ecclesial, intercongregational, and extraecclesial groups that search for the same reality/values/things." The impact had on contemporary religious life by war, other forms of violence, and disease was noted by every group but particularly by the Africans, who noted the prevalence of AIDS, malaria, and other diseases and the instability resulting from wars and ethnic and religious conflicts in that continent. "Violence is growing: it questions us," said the Europeans. Asians expressed serious concern over effects of war and violence, especially in the Middle East, and over the "rise of religious fundamentalism, resulting in communal violence." North Americans deplored the "normalization of violence" and what they perceived as its causes. All groups saw globalization as exerting a great influence on society and on consecrated life today. The Africans saw it--along with urbanization, unem-ployment, and migration--as contributing to poverty at various levels. They blamed it for "hindering a deep form 237 ,i 65.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress 238 of communication" and for contributing to a lack of reflection specifically on African consecrated life. Asians saw "elitist globalization" as having destructive effects on the poor and marginalized, on families, and especially on youth. Latin Americans described "neoliberal globalization" as destroying "what is particular to/in our countries," as especially damaging to young people, and as a spur to migration, with its multiple social dislocations. Oceania observed globalization as affecting the entire region-- countries indigenous in character and countries predominantly Western European--by widening the gap between rich and poor and "elevating greed to the status of a virtue." This summary of.the continental group reports, brief though it is, suggests a major accomplishment and a major flaw of the congress. Those present heard the voices of religious from every corner of the world with a wonderful immediacy and force. On the other hand, we simply did not have time for much dialogue of a more personal kind. Each of the continental reports, however, concluded with a very provocative section on signs of hope and of new life. Groups cited a growing sense of communion among congregations and between laypersons and religious, of the importance of personal relationships, of commitment, of community and of belonging, of greater interiority along with a lessened grip of institutionalism. Europeans made the arresting statement that secularization, despite its negative consequences, is also "causing us to love the world as it is with hope." Asians remarked that our times are ripe with opportunity: "As Asians in Asia, we have our own experience of God. By this, perhaps, we can contribute to the vitality, of religious life. It is time for rebirthing our institutes with our Asian Revie~ for Religious identity." Africans saw themselves as bringing to religious life the gifts of a deep sense of God and of the family which leads to sharing and attentiveness to one another. One young African, during the all-too-brief open microphone time in a plenary session, good-naturedly scolded his European elders for perceiving death for religious life in the future, whereas their "children" from other parts of the world, hoisted on the shoulders of their European parents, can see farther ahead to future life! North Americans ventured the opinion that aging could be looked upon as "saging," an opportunity to draw new life from the wisdom of the elderly. Diminishment, they thought, provides "a freedom to reshape religious life." Participants barely had the continental group reports in hand before moving on to topical discussions in groups ranging in size from six to over a hundred, depending on people's interests: ¯ Justice, peace, and the suffering of humanity. ¯ Inculturation--the embodiment of consecrated life in a culturally pluralistic world. ¯ Interreligious dialogue. ¯ The arts: imaging and expressing a new song. ¯ Mass media and the communication of values. ¯ Liberating the prophetic: solidarity in a world of exclusion. ¯ Liberating the prophetic: celibacy and life-giving relationships. ¯ Tilling the soil of Sacred Scripture. ¯ Thirst for God and the search for meaning. ¯ Ongoing formation for personal conversion and corporate transformation. ¯ Congregational culture. ¯ Community as mission. ¯ Partnership with the laity. ¯ Leadership and authority. ¯ The ecclesial dimensions of consecrated life. Although the time allocated for these discussions was brief, each topic was based on material in the working paper 65.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress 24:0 distributed well in advance of the meeting. Participants came prepared and were assigned their first choice among the three topics in which they had indicated interest before coming. As a result, they shared many thoughtful insights with one another; a summary appears in Passion for Christ, Passion for Humanity (pp. 237-241). Those of us present for the congress received the somewhat longer reports composed by group reporters on site. Some Conclusions For me, the challenge posed by the congress was at the time and remains today one of assimilation and communication. The rich papers presented by speakers, along with participants' voices as reflected in reports by the continental and topical groups, left our table of Listeners with the nearly impossible task of assimilating content and shaping it into a synthesis at the final session. Our summary, "What the Spirit Says Today to Consecrated Life," compressed into an hour's oral delivery the reflection and discernment that had absorbed us during the entire congress. Rather than repeat that synthesis (see PCPH, pp. 243- 255), I want to share what stand out for me a year later as the two most significant messages conveyed by this unique gathering. The first is that the Spirit is at work among us today, regardless of how old or young we are as religious, no matter how old or young our congregations, and no matter whether we come from north, south, east, or west. The second is that a contemplative approach is required of the members of our congregations if we are to discern what the Spirit is saying to us at this critical moment of our history, some forty years since Vatican Council II invited religious to renew their lives in the light of the gospel, their foundational charisms, and the signs of the times. Review for Religious The Spirit calls us to revive the enchantment, the passion, we had when we first responded, as congregations and as individuals, to Jesus' call to love God and our neighbor with all our heart. The Spirit calls us to personal and institutional renewal, to inculturation and to interreligious dialogue. The Spirit calls us to an inclusive attitude toward the laity, .and this, in turn, calls for new structures and a new language expressive of the inner reality Of our consecrated life. The Spirit calls us to esteem personal relations over structure, and to develop ourselves as religious capable of loving human relationships. We are called by Jesus to be passionate and to exercise ",~ and alfenation,of any kind. compassion toward others, particularly toward all who suffer the indignities of poverty, discrimination, and alienation of any kind. The congress experience brought home to me anew that we are living through, a period of vast and deep change in consecrated life--a sort of gestation period heavy with the promise of new birth. The seeds have been planted in good ground and are being warmed and watered by the life-bearing winds of the Spirit. We have only to tend the garden and pay attention with a discerning eye to the sprouts of new life lest we uproot them as noxious weeds.before they have a chance to flower and bear fruit. 6Y.3 2006 Kennelly ¯ The 2004 Consecrated-Life Congress Our congregations are being called to collaborate with the Spirit in bringing to birth the consecrated life of the future. It was apparent at the congress---its participants a cross section of more than six hundred congregations of women and men from all over the world--that the vision, the hopes, and the sense of urgency are widely shared. The modes of discernment and dialogue will necessarily differ from country to country, depending on culture and opportunity, but the desire for intra- and inter-congregational reflection and collaboration is present among religious in every continent. As a practical matter, I would urge congregations to take advantage of their forthcoming chapters to follow up on major themes explored at the congress. Chapters are periodically convened by every congregation; agendas and processes can readily be shaped to facilitate the kind of individual and corporate reflection we need and desire. Although successful use of this option is not without difficulties, it would seem to offer .the best chance for congregations to address the congress message in a timely way, and to seek the implications of that message for themselves. Clearly there are a few obstacles to surmount if we are to facilitate contemplative chapters that make good use of the theological and sociological perspectives offered at the congress. International congregations, whose members often constitute a microcosm of the multicultural 2004 gathering in Rome, in many cases still experience subtle Western attitudes that prevent the kind of dialogue modeled by the congress. Smaller local congregations may need to push beyond parochial concerns to help members achieve a broader vision and seek greater goals. But all must beware of a tendency toward activism, the preoccupation with doing rather than being that marks our contemporary world. Review for Religious Whether we come from large or small congregations, from apostolic, monastic, or contemplative "families" of religious; whether we can trace our history back for centuries or only a few years; and whether we are Americans, Europeans, Asians, Africans, or Oceanians, we are all called by the Spirit to use the congress and our own experience as a springboard to dive into the deep pool of Holy Mystery in which we religious live and move and have our being. It is for us at this crucial point in our history to delve deeper, to listen, to reflect, to dialogue, and to discern the spiritual realities of the life and mission we share as religious, to ask ourselves how we need to be if we are to do the works of persons passionate for Christ and passionate for humanity. Suggested Reading Passion for Christ, Passion for Humanity, Pauline Books and Media, 2005. Reflection/Discussion Questions 1. As I/we read the responses from the different continental groups regarding the future of religious life, which response gave me/us new insight and which response would I/we want to discuss further? 2. How can we take advantage of the "aging" of religious life members in our country to draw upon their wisdom ("saging') for our apostolic life and direction? 3. What practical steps do I/we need to take in order to adopt a more contemplative approach to listen to and follow the movements of the Spirit within our religious life context? 6Y.3 2006 RACHEL M. HARRINGTON A New Way of Meeting 244 Dissatisfaction with the timeworn chapter for-mula for the meetings of our congregation, the Sisters of Notre Dame de Namur, as an international congregation of pontifical right resulted in a mandate from the 2002 chapter for us, the newly elected congre-gational leadership team, to explore new ways of assem-bling that took account of our multicultural identity. The dissatisfaction focused on the number and variety of pro-posals submitted for chapter discussion, the abundance of paper generated before, during, and after each chapter, and the dominance of the Western cultural model for meeting and discussion. Canon law offers little help. In accordance with the principle of subsidiarity, it provides for each institute the right to establish its own legislation for chapters pro-vided this falls within certain norms. Our constitutions, approved in 1989, contain several articles and directives for conducting chapters, no more restrictive, we think, Rachel M. Harrington SNDdeN is a member of the generalate lead-ership team of the Sisters of Notre Dame de Namur. Their address is Via Raffaello Sardiello, 20; 00165 Roma, Italy. Review for Religio~s than many, and certainly tried and tested and not lightly to be discarded. One suggestion, superficially attractive, was to separate the chapter of affairs from the chapter of elections. Our general treasurer pointed out a major flaw in this proposal: chapters are expensive meetings. So we continued to talk and dream. Our directives, or rather the traditional interpretation of them, provide for a "midchapter" meeting,, an inter-national gathering at the midpoint between chapters. Beyond prescribifig that at this time the congregational leadership and the provinces evaluate their implemen-tation of the constitutions, there are no further direc-tives. So, with some trepidation, we determined on this midchapter meeting as our chance to experiment. We decided to offer two sisters from each province the opportunity to experience a different type of gathering. We hoped to stimulate creative thinking to improve the next chapter in 2008. We began in May 2003 by writing a letter to each sister in the congregation, inviting her to respond to three questions. We based the questions on one of the constitutions from the section on chas.tity: Our celibacy, deepened and enriched by God's love and that of our sisters, bears fruit in a love which reaches beyond the limits of family, tribe, or nation. It enables us to be free to go wherever we may be called in the ser-vice of God's kingdom of justice, peacei and love. We asked each sister how she felt that this constitu-tion had been realized in her life and what helps or hin-drances our community had ,given her in reaching "beyond the limits of family, tribe, or nation." We encouraged sisters to respond alone or after group dis-cussion. To avoid burdening province leadership, we sug-gested that all responses be posted uncollated to the congregational leadership in Rome. We assembled an 65.3 2006 Harrington ¯ A New Way of Meeting We wondered how many sisters would take, the troublet~, respond to our lettel~/ and we were overwhelmed by the number Who dld).~ 246 international planning group to help us review the responses. Membership of such groups is often pre-dictable, so we made a point of inviting sisters without previous experience of working on international groups, and, instead of looking for organizational skills, we looked rather for a different order of talents. To our delight, all of the sisters whom we approached accepted our invitation. In October 2004 we met in Rome: an economist teaching in a Kenyan university, a patristic theologian from a British univer-sity, a psychologist from Peru, a theolo-gian from Congo, an artist-liturgist from Britain, a photogra-pher with poetic writ-ing skills from the United States, and a musical-artist-liturgist from Zimbabwe. On our own team we had two cultural anthropologists, from the U.S.A. and Congo, a biblical theologian from the U.S.A., an educationist from the U.S.A., and a canon lawyer from Britain. We needed to give very little thought to the selection of facilitators; we knew whom we wanted. Sister Gabrielle Stuart RSM and Sister Mary Harrington SUSC had run facilitation workshops for leadership in Rome, and we had benefited from their expertise. That they were free and willing to be with us in this experiment was a huge encouragement.1 Traditionally our chapters are held in the U.S.A. or Europe and our midchapters in Africa or Latin America. In 1998 the midchapter took place in Peru, and so we Review for Religious selected Kenya for 31 July to August 2005. We invited a British sister serving there to be the on-site coordina-tor and to attend the Rome planning meeting. We wondered how many sisters would take the trou-ble to respond to our letter, and we were overwhelmed by the number who did, almost half the congregation. Considering the many who were too old or sick, this was way beyond our expectations. We spent the first day of the meeting reading these responses, with a checHist of questions: How do I feel? What do I think? What sur-prised me? What delighted me? What became clearer? What shocked me? What insights did I gain? What ques-tions remain? Reading the responses moved us all deeply. Our sis-ters had responded sincerely, from the depths of their experiences as celibate women working for the poor in a variety of situations. Most acknowledged a deepening of their understanding of the call to religious life as they took risks and endured suffering, separations, rejections, and misunderstanding. All expressed gratitude for the years spent in the congregation and for the richness of life offered by membership in an international group. We compiled our reactions and, after much discus-sion guided by the facilitators, agreed upon a goal for the midchapter meeting: to enable participants to explore, express, celebrate, and live the goodness of God in a love which reaches beyond the limits of family, tribe, or nation. Our foundress, St. Julie Billiart, bequeathed to us the charism of striving to discover and become the very goodness of God in the world, and, as we read the responses of our sisters, we realized how much this was integrated into their lives. A statement made about Julie by a contemporary cardinal in Belgium, "A spark from out the heart of Christ fell upon the heart of a woman who knew how to believe and how to love," somehow 65.3 2006 Harrington ¯ A New Way of Meeting 248!I captivated our thoughts as we read, and we decided to use "Sparks from the Heart of Christ" as the theme of the midchapter meeting. With the facilitators' help, we sorted ourselves into four groups: theologians, social scientists, the "fire department" (the liturgists), and the planners. We drew up questions which, as a result of our reading, we felt needed to be answered, and then we allocated tasks to each group. Everyone with a relevarit area of expertise agreed to present a paper in Nairobi on that topic to stimulate discussion. From April 2003 we spent some time at leadership meetings--held once a year on the Continent and twice a year in the U.S.A.--talking about our hopes for the meeting and encouraging the provincial leaders to choose as representatives one sister from each province who had no previous international experience and was willing to "go with the process." We also wanted one member of each leadership team to attend, so that any implementa-tion or follow-up would proceed smoothly. Although we never used the word '~delegate," and although we stressed repeatedly that this was not a chapter and not a deci-sion- making meeting, not everyone heard this. Shortly after our October 2004 planning meeting, the congress "Passioh for Christ, Passion for Humanity" took place in Rome within walking distance of our gen-eralate. As well as welcoming many of the participants to our home, we were able to access the papers on the Internet in four languages and encouraged our sisters to do likewise. Unfortunately, Internet access across the globe varies considerably, and so not all were able to take advantage of this resource. Attempting to compen-sate for this, we excerpted a couple of passages from the working paper and suggested that sisters meet in groups to discuss how they experienced the charism of our con- Review for Religious gregation in the light of their reflections on these pas-sages. We encouraged those chosen as representatives to bring the fruits of these discussions to the meeting in Nairobi. We hoped that this task would keep interest alive in the proposed meeting and enable the represen-tatives to feel that they were coming prepared. The planning group assembled in Nairobi with the facilitators on 30 July 2005, the day before the others were due to arrive. By this time we had added our gen-eral secretary and the director of our mission office to the group. We held the meeting in the Dimesse Sisters' Centre in Karen-Nairobi. Contrary to our hopes, we were unable to move in until after noon on the day we had hoped to begin. One of our biggest problems, shared by all interna-tional congregations, is that of language. We had arranged local translators for . French and Spanish, but Flemish, Italian, Portuguese, and Japanese are more difficult to provide for, especially as only relatively few sisters speak only these lan-guages. People skilled in simul-taneous translation are expensive, and we also need others who can provide necessary written trans-lations fairly rapidly. We are con-stantly learning in this area and are extremely grateful to those sisters who, proficient in two languages, generously help in translating. We mar-vel at the patient endurance of those who spend days on end listening through earphones. In social situations, as well as during the sessions, many struggled heroically to communicate across the language barriers using gestures and the few words they could manage. We provided play- 65.3 2006 Harrington ¯ ~l New ~Va~ of Meeting ing cards, jigsaw puzzles, and games without words to encourage this interaction. We had invited sisters from Japan, Nigeria, the U.S.A., and Congo to help with translation and secre-tarial tasks, so altogether we numbered sixty. Every day a brief account of the meeting, composed by one of these, was sent out on our congregational Intranet in English, French, and Spanish. Access to computers was limited, but whenever they could most participants sent home enthusiastic accounts of their experiences. As we began the meeting, each province brought some "report" on their reflections about our charism; several of these were poetic or beautifully presented in visual form. During our sixteen days together we had an enormous variety of experiences, most of which involved sharing our thoughts and feelings about specific ques-tions with a sister from another culture. The facilitators guided us into these moments, which were often deep and moving, with rituals involving simple gestures, gen-tle dances, and repetitive chants celebrated around ever-changing focal points in the meeting room. As the days went on, art work created in the course of the meeting was displayed on the walls of our meeting room--pic-tures, words, designs, charts--all reflecting our moods, our perceptions of our province realities, problems we faced, questions that we raised. Over the course of the two weeks, one of our cul-tural anthropologists gave us an illuminating presentation on "unpacking culture"; the other spoke of how African myths speak of God's goodness. The theologians pre-sented talks on the goodness of God from their varied perspectives, as revealed in the Bible, in African forma-tion programs, in living religious life in Congo, and as expressed in community life in the 4th-century church. The psychologist talked on "Chastity: A Love Which Review for Religious Goes beyond the Limits." All were translated later and made available to the whole congregation. Our economist assembled three university lecturers who made brief presentations on Kenya's progress (or lack of it) towards the United Nations' millennium devel-opment goals in regard to health, education, and the environment. A fourth panelist, representing an organi-zation that works with nongovernmental organizations, spoke about the frustrations he faces in his work, where the ideal partnership between aid organizations and gov-ernments falls far short of being realized. The four stayed on for the whole morning to lead group discussions and answer questions. The sisters from each province also spoke about their ministries and tried to communicate the realities of their daily lives. Most moving were the testimonies from the war-torn Democratic Republic of Congo and from Zimbabwe. When we had afternoons off, those who wished were taken in small groups to visit various pro-jects in housing and employment, schools (including the famous Starehe boys' school and its newborn sister school for girls), and the homes of people from Saint Mary and Joseph's, the parish where some of our sisters live and work. Other optional outings were to a safari park or to see Karen Blixen's (Isak Dinesen's) home, famous from the film Out of Africa. Two of the most memorable excursions were for Mass. On the first Sunday we went to Saint Mary and Joseph's, where we were welcomed in truly memorable fashion by the parish priest and by the "mother of the parish," who told us we were all their daughters. The dancing was led by small girls all attired in snowy white tee shirts advertising U.S. baseball teams. The choir was amazing and untiring, and the packed church sang along and swayed and clapped throughout the three-hour cel- 6Y.3 2006 Harrington * A New Way of Meeting ebration. The ladies of the parish had prepared dinner, so we moved the benches around to form tables and sat down to a lavish feast of beef stew, rice, and beans. On the second occasion we were hostesses to those who came to celebrate with us the opening of our novi-tiate in Langata, Nairobi, our fourth in Africa, and a real benchmark in the history of the province. We sat outside under awnings during the Mass celebrated by the bishop; afterwards the house was blessed and a flame tree planted. The meal, prepared outside in huge pots over open fires, was enjoyed by all. In the last days of our meetings, we focused on ques-tions that had arisen during our sharings, and we brain-stormed about how to prepare for the next chapter. During the closing In the. last~ days,(~our'tneet.in~s;~rz-~ we focused on"questio~.~ ~ . h.'afl:~[ ["~ arisen duringour shariftgs, ' and we brainstormed about how, to prepare for the°ne~.t:chapt~e~(.i~ to women after any meeting. We reverently and ceremoniously placed these artifacts on the floor around the centerpiece a mock fire, built around a candle, with sparkles scattered about. Then we were all invited to collect a prayer card and some sparkles and to light a candle from the cen-tral flame. To do this we had to walk toward the center and then away, through the spread-out paintings, pic-tures, charts, designs, and pre.sentations~a sort of sym-bolic acceptance of all that had taken place and been ritual we thanked all planners and participants. We removed the vari-ous artifacts we had displayed on the walls, per-forming the clear-ing- up ritual that is traditionally left Review for Religious shared over the previous two weeks and a commitment to carry the experience home. At the beginning of the meeting we had been reminded that in this meeting no decisions would be taken: we were there to experience what it means to belong to an international, multicultural, multilingual congregation. Nonetheless, some few in their evalua-tions expressed wonderings about the apparent lack of an agenda. We knew this was a risk. There was general dissatisfaction with the three celebrations of Mass which we had together during the meeting days--not the Sundays. Bringing in clergy, out of touch with what we were experiencing together, was felt to be artificial and awkward. Communion services led by ourselves might have proved more meaningful. Some found the days long and tiring. Most wrote that this had been a life-changing experience, creating bonds across cultures and languages, inspiring hope, and providing memories to last a life-time. The deep exchanges about cultural differences gave all of us new perspectives. Throughout we had been dependent on our two facil-itators, whose style pleased all but three of those pre-sent. Every day began with a review of the purpose of the meeting, of our hopes and concerns, and of the val-ues and behaviors we intended to live by during the meeting. After the morning ritual, there was a report on the questions raised, the previous day. At day's end we gathered in our "home groups" (the same multicultural group for the entire meeting), shared our day's experi-ences, and arrived at issues or questions for the coordi-nating committee to resolve. This committee, five members of the original planning group, met with the facilitators each day for forty-five minutes after the evening ritual, discussed the matters arising from the home groups, and planned the next day. When we eval- 65.3 2006 Harrington ¯ A New Way of Meeting uated our work, we realized thatthere were things we could have done differently and better. We had learned from our experience and from the feedback---another purpose of the meeting realized. The big anxiety of all present was how to communi-cate the fruits of the meeting to the sisters at home. We had papers and photographs, but these were two-dimen-sional, having meaning mainly for the participants. Carrying home fragile "sparks from the heart of Christ" challenges each of us to a new way of being, of believing, and of loving so that the sparks will ignite others and kindle new flames to spread the awareness of God's good-ness in all the events and circumstances of our lives. Note ' They can be contacted at GLOIR; 27 Catherine Street; Newry, Co. Down; BT35 6JG, Northern Ireland. E-mail: gloirinstitute@btopenworld.com Glass It's as if Benedict's single ray of light is scattered across the tables like loose jewels or a broken mirror. We sweep and pick through trays of glass, sharp bits of orange and yellow with a blue that's almost black until I hold it to the light, and I am full of a temporary completeness. Even the thunder seems gentle. Alicia Kleiman OSB Review for Religious ERNEST E. LARKIN Aspiratory Prayer, a Welcome Addition to Contemplative Prayer Aspirations (aspiratory prayer) were a treasure in' European Christianity in the late Middle Ages and one of the great legacies of the Touraine Reform in 17th-century France. This reform took place in "les Grands Carmes," the popu-lar name in France for the Carmelites of the Ancient Observance (OCarm). The style of prayer that goes by the name of aspirative or aspiratory prayer, or simply aspiration, is almost unknown in contemporary spirituality. The pre-sent article is a move to fill this lacuna and to suggest how the prayer of aspirations can con-tribute to the contemplative renewal of our times. I will first give an overview of the prayer in tradition and highlight its three outstanding proponents: the 13th-century Carthusian Hugh of Balma, the Franciscan Henry Herp (+1477), and the Carmelite John of St. Samson (1571- Ernest E. Larkin OCarm last wrote in our 64.4 issue (2005). His address remains St. Agnes Catholic Church; 1954 North 24th Street; Phoenix, Arizona 85008. 65.3 2006 Larkin ¯ Aspirator)/Prayer 1636). Finally I shall make some suggestions on how to revive the practice. What Is Aspiratory Prayer? Aspiratory prayer is a warm, human approach to God that is inexorably affective. It proceeds by way of fer-vent desires of the heart. It was considered a shortcut, a direct route, to intimacy and oneness with God. Its struc-ture is simple: frequent and intense desires breathed out to God. It has only one goal, union with God, so it ceases to have a role when mystical union is achieved. Aspirations are not the same as ejaculations, though they are like each other. E aculatory prayer.describes any to this prayer? ,.:Those and all brief prayers sent like darts to heaven for help, thanksgiving, adora-tion, or any other good motive. "My Jesus, mercy" is an ejaculation. Aspira-tions are only and always passionate desires or fer-vent acts of love of God. They are expressed in words or sighs or silence. "My God, I love you" is an aspiration. To aspire means to breathe out, with the con-notation of breathing hard after something. In aspira-tory prayer one breathes out heartfelt desires for God. It is yearning for God, like gasping for God. Aspiratory prayer is simple and focused, though in the beginning it may cover a wide sweep of emotions and feelings. Practice simplifies and unifies the faculties to give them a single thrust, much as the prayer of sim-plicity consolidates the multiple affections of affective prayer into a single attitude of loving presence. Aspiratory prayer sets the heart on one goal, divine Review for Reli~io~ union, and is a positive step in that direction. Not every-body can use it. It is not for beginners, but for those who have come to know God and themselves through Bible reading, reflection, and loving conversations with God. When a person has put her house in order and has come to love God in truth, she is ready for this prayer. For those who love God, it will become as natural as breathing. Catholic teachers in the past were sticklers in assign-ing different prayer forms to different stages of growth. The prayer of beginners was discursive meditation and affective prayer, that is, first much thinking and ~hen many affections. The next stage was contemplative, and it featured forms like simply looking at the tabernacle as in the Cur6 d'Ars' "I look at him and he looks at me," or today's resting in God in centering prayer, or saying the mantra as in Christian Meditation. Today we prob-ably pay less attention to the degrees of prayer, though we still honor them. Centering prayer and Christian Meditation have democratized contemplative prayer. Certainly some knowledge and love of the Lord is pre-supposed for contemplative prayer, but a little knowl-edge and love go a long way. Those who are comfortable with centering prayer and Christian Meditation will be at home with aspirations. Who, then, are called, to this prayer? Those who are fervent and serious about their relationship with God and have a great desire for intimacy with God. They are look-ing for the "more." The classical teaching placed the prayer in the illuminative way as part of the contempla-tive life. Two categories are involved here, and both are second stages: the illuminative comes between the purga-tive and the unitive way, and the contemplative life between the active and the mystical life. The three divi-sions correspond to beginners, the proficient, and the 65.3 2006 Larkin ¯ Aspiratory Prayer perfect. Active life has to do with external behavior, con-templative with inner prayer, and the mystical life with high sanctity. The purgative way is concerned with con-version and purification, the illuminative way with enlightenment, and the unitive with union with God. The three ways and their content are criticized today for being too dependent on Neoplatonic philosophy, the system that canonized the immaterial and denigrated the bodily.' Aspirative prayer rises above this controversy and in fact is a corrective against exaggerated spiritual-ism and minimizing the physical and bodily in the spir-itual life. Aspirations welcome and embrace the emotional and the sensible; these human qualities lead to the highest realms of the spirit. They move the experi-ence of God away from the intellectual and into the realm of affection and love.2 Aspiratory prayer comes out of the same tradition as centering prayer and Christian Meditation. The latter two are contemporary constructions from that contem-plative tradition, a development that aspiratory prayer has yet to find. But all three systems appeal to the same sources, the same authors, and even the same texts for their grounding and justification.3 This fact and their constant location in the middle stage of spiritual devel-opment argue to their commonality. Centering prayer and Christian Meditation seek silent presence and quiet resting in God. At the same time they are active prayer, rightly called meditation of a nondiscursive or contemplative type. They are not clas-sical contemplation in the sense of infused prayer, but are products of human effort and ordinary grace. Aspiratory prayer is obviously active in the same sense. It uses the language of intense, passionate love and expresses the yearning of the heart and delights to rest in the Lord. Review for Religious Aspiratory prayer is more than loving conversation with God. It expresses a strong act of the will that desires to experience God. So it is more than a t&e-a-t&e, even in the loving language of affective colloquy. The differ-ence is intensity. Affective prayer engages the feelings but in a diffuse way, whereas a strong will and urgent longings for intimacy dominate aspiratory prayer. Aspirations fit nicely into the perspectives and prac-tice of "love mysticism," which is a form of relating to God in spousal love. The language of spousal love is very human, amorous, and passionate. Its biblical source is the Song of Songs or St. John's Gospel, and it is a fre-quent feature in medieval women mystics and also in writers like St. Bernard or St. John of the Cross. Janet K. Ruffing has written a guide for the spiritual direction of those called to this way. She gives many examples of its language, one of which is the following conversation in Mechthild of Magdeburg, who says to God: "God, you are my lover, / my longing, / my flowing stream, / my sun, / and I am your reflection." And God replies: "It is my nature that makes me love you often, / for I am love itself. / It is my longing that makes me love you intensely, / for I yearn to be loved from the heart. / It is my eter-nity that makes me love you long, / for I have no end.''4 Aspirative prayer is not limited to spousal love. It is at home with a nonspousal love of God, which Janet Ruffing calls simply apophatic. The mysticism of the more matter-of-fact Cloud of Unknowing features whole-hearted love, often without obvious passion. In this lat-ter case the love is sublimated into disinterested love in a style of relationship that is reserved and controlled. Mystics in this pattern will practice their own brand of aspirations. Aspiratory prayer is thus a technical term, but it is not "one size fits all." Its normal form is sensible-spiri- 6~ .3 2006 Larkin ¯ Aspiratorg/Prayer 260[ tual love. For Henry Herp only this love qualifies as aspi-ration. For him its follow-up, which is pure spiritual love, is not aspiration, but unitive love. John of St. Samson, however, treats pure spiritual love as a form of aspiration, and for him this higher aspiration leads one into the furnace of God's love in transforming union. For both authors the will is the driving force for aspira-tions and for unitive love. In sensible-spiritual love the sensibility is the carrier, but the momentum comes from the will, which makes the love truly spiritual. Do not think that the practitioner lives on a perpet-ual high. The expression Of loving desires for God con-tinues in down days and dryness as much as in times of sweetness and sensible consolation. The feeling element is still there. It must be genuine, not faked or pretended or forced. Th~r~se of Lisieux is a perfect example of the expression of passionate desires of love for God in the darkest moments of life.5 There are degrees of the practice corresponding to the person's habitual love of God and the grace of the moment. John of St. Samson sees it as leading directly into a mystical expression, in which the Holy Spirit breathes out enflamed desires for God. His conditions for practicing this prayer are demanding. Persons who take up the practice must be mortified, humble, and self-effac-ing as well as robust in health. In his view aspirations go beyond the enthusiasm of a newly baptized Pentecostal or charismatic and belong to persons advanced in the love of God and on fire for the summit. The History and Theology of Aspiratory Prayer Aspiratory prayer flourished in the late Middle Ages in northern Europe, especially the Rhineland and France, from the 13th to the 17th century. At the time of the Touraine Reform, the practice was common in popular Review for Religious religious culture. Aspirative prayer appealed to the archi-tects of Touraine because they saw the practice as dove-tailing with their view of the goal of the Carmelite order, which was to live continuously in the loving presence of God.6 Intimations of aspiratory prayer are found in the New Testament, in St. Augustine and John Cassian, who were contemporaries, in St. Benedict and Guigo II, and in other early authors. The first to give aspirative prayer a central place in the spiritual life was Hugh of Balma, whose Tbeologia Mystica exerted wide influence, partly because it was thought to be the work of St. Bonaventure. Hugh of Balina taught the way of the heart, and aspira-tory prayer was its chief expression. First one must know one's weak self and the goodness of God, since anyone filled with self is unable to yearn for God. This knowl-edge prepares one to rise up to God in "anagogic con-templation." Anagogic contemplation means moving from crea-ture to Creator, from the text of Scripture to the living God, enflamed with desire and love. Such is aspiratory prayer. The love is both natural-spiritual and purely spir-itual, and God is the direct object. The love increases with the simplification and unification of the faculties until ultimately there is mystical union with the Trinity in the high point of the soul called the apex mentis. Henry Herp and John of St. Samson will pick up on these per-spectives and expand them with the help of Jan van Ruusbroec's theology (1293-1381). Hugh had many imitators, especially among the Carthusians, who promoted and developed this teach-ing so effectively that Everard Mercurian, an early gen-eral of the Jesuits, warned the Society about "the Carthusian method of prayer" for fear that its popular-ity would marginalize Ignatian prayer in Spain.7 The 6Y.3 2006 Larkin * Aspiratory Prayer 14th-century anonymous English text The Cloud of Unknowing is likely a Carthusian document, both because it can easily be interpreted as a full exposition of aspira-tory prayer and because its anonymous author may well be .a Carthusian.8 A number of familiar quotations from the book are obviously formulas of aspiratory prayer. Henry Herp OFM (+1447) Henry Herp wrote the first synthesis of the whole spiritual journey around the topic of aspirative prayer. His map is the structure of the soul as delineated by the great Flemish mystical writer Henry Herp wrote the first synthesis'of the~ around the topici of ~aspirativ~ prayer. : ~ o o Jan van Ruusbroec. The soul is three concentric circles, each of them representing a different level of human activity. Herp offers a detailed plan for moving through the outer two levels and arriving at the inner circle of highest union with the Holy Trinity. He lays down instructions for each of the phases of the journey, but his chief contri-bution is to show how aspirative prayer moves one through the middle circle. Ruusbroec calls the three circles "spheres" or "uni-ties," whereas Herp names them mansions or dwelling places like Teresa of Avila. The first is the region of the senses, the second that of the spirit, and the third the "fond" or ground, the dwelling place of the Holy Trinity. One must traverse each level to get to the center, and the way is introversion, a concept that goes back to St. Augustine. Herp calls it "ascension." Persons "ascend," that is, they are lifted up by a sweeping action that carries them through the given circle and toward Review for Religious the center; the searcher for God leaves behind the lesser level or part of it in favor of the higher one. This process of introversion means making the powers on each level converge toward the center. The activity of each level is collapsed into the next step. In this imagery the outer circle of exterior behavior is introverted into the mid-dle circle, and in the middle the lower faculties of the irascible and concupiscible appetites, and of reason and free will, are introverted into the spiritual faculties of intellect, memory, and will. These latter will finish the task and bring the soul into mystical union in the center. The introversion or ascension starts with the outer or exterior circle, which represents the active life. The means set down by Herp for this first introversion are "truth and compassion." Truth means understanding the goodness of God and the bankruptcy of the human, and compas-sion is appreciating God's love and attractiveness. The middle level is the field for aspiratory prayer and unitive love. Aspirations address the "interior infe-rior powers," especially the concupiscible appetite, which in Herp's view has a spiritual quality about it. Unitive love is exercised by the spiritual faculties. Understanding guides the process: hence the importance of regular med-itation and of the use of prepared ejaculations that recall the supreme attraction of God and serve to inflame the soul with love. The awakened will moves the sensory faculties to yearn for God, progressively spiritualizing the person for the work of unitive love, For Herp, uni-tive love takes over the task begun in the lower interior faculties. The acts of pure, unitive love finish the task of the introversion of the spirit level and open the way to the center. In the center the love is fruitive love. The contemplative way is left behind, and the soul now lives the "super-essential life" of oneness with the Trinity, a union that is not ontological but psychological. ¯ ,263 65.3 2006 Larkin ¯ Aspiratory Prayer Herp offers some good pastoral advice. The stages are to be addressed in order and none can be skipped. Basic conversion is presupposed for undertaking aspira-tory prayer, and that means an adult knowledge of God and one's self and the acquisition of the moral virtues. Aspiratory prayer begins with rote expressions of love and fervor. According to Herp, these feelings crescendo into what he calls an explosion of love, which has its own danger of entrapping the person in the delightful, sen-sible sweetness. The love is gradually purified and becomes the unitive love that will lead the soul into the center. Unitive love too undergoes its own purifications, and the follow-up experiences may be as dark and dry as the initial entry was exalted. The challenge at this point, as at every point in the spiritual life, is marginal-izing the self, that is, letting go of everything that is not God. The holy soul practicing spiritual love will con-tinue to work at the total gift of self to God, and its tasks are listed by Herp as self-offering, searching for God's will, letting God's love destroy all defects, and being united with God. John of St. Samson (1571-1636) John of St. Samson is an immensely important figure in the Carmel of the Ancient Observance. He was a mys-tic of profound experience, and, in spite of the blindness that afflicted him from the age of three, he was well edu-cated and well read, keeping in touch with currents of spirituality in the very rich 17th century. He has been called the French John of the Cross and is highly esteemed by religious historians like Henri Bremond and Louis Cognet. John of St. Samson lived a century and a half after Herp, but Herp's work was well known to him in the numerous Latin and French translations and in the Review for Religious plethora of spiritual writings that popularized aspiratory prayer. John of St. Samson became expert in the teach-ing of this way, building on Herp but adding his own points of view. There had been a lot of writing, but lit-tle development since Herp. After a careful comparison of the two authors, Canisius Janssen concludes that John's doctrine is Herp in a new packaging. "Certain things have been left out," he writes, "others developed; in short the whole has acquired a new face.''9 John belongs to the same Dutch school of mys-ticism as Herp, both of them appropriating the worldview of Ruusbroec. We come from God as created images in the Uncreated Word, and our life goal is to return to our place in the Word in full consciousness of our unity in God. The goal is put I ," bY engaging oi r feetings t " : and iemo.tions. I as well as'our spiriL rather abstractly as "the state of consummation of the subject in the Object" in a "union without difference or distinction." Such is the transforming union, in which the soul is caught up in the fire of the divine life. The way to the goal is introversion according to the same divisions as in Henry Herp, but with the adaptations in nomenclature. John is particularly eloquent is explaining how spir-itual love guides the whole process of introversion once aspirations become the way. Spiritual love is at the heart of sensible-spiritual aspirations, and it constitutes the spiritual aspirations that lead one into the center itself. Aspirations have the genius of putting our full humanity to work by engaging our feelings and emotions as well as 6~.3 2006 Larkin ¯ Aspirator)/Prayer 266 our spirit. Sensible love is the starter, and it houses the spiritual love in sensible-spiritual aspirations. When the aspirations become "more vigorous, more on fire, and more detached from sense," they are pure spiritual love. This spiritual love, with or without a sensible compo-nent, is the engine that drives the introversion process into the furnace that is God. Aspiration thus has a mystical quality in John, as is clear from the following quotation: Aspiration is not only an affectionate colloquy. ; that is what aspiration is born of and comes forth from. Aspiration, then, is an outpouring of the whole heart and spirit on fire with love. By it the soul quickly tran-scends itself and all of creation, becoming intimately united with God in the intensity of its loving expres-sion. Expressing itself quintessentially in this way, the soul transcends all tender, sensible, cerebral, and com-prehensible love, reaching by the vehemence of God's spirit and its own effort, not just any divine union, but a sudden transformation of its spirit into God. In the abounding and ineffable sweemess of God him-self lovingly embracing one's spirit, it transcends, I say, all familiar and intelligible love. This is the essence of aspiration, in itself, in its cause, and in its effect.1° Heart (that is, the sensibility) and spirit (that is, the loving will) are the framers of aspirations, and heart even-tually recedes in favor of pure spirit. In the beginning there will be multiplicity of thought and feelings, but with growth this richness will give way to ever increas-ing simplicity and a state of pure elevation in God. Intensity is of the essence, since only strong love can break the attachments of the faculties to their natural objects. Frequency is a necessary quality, since the goal is to make aspirations like second nature, as natural as breathing. Humility too is the essential underpinning of all true love. But in all these efforts balance and moder-for Religious ation must prevent any violence or excessive force. John of St. Samson, experienced spiritual director, has good advice on how to begin and how to grow in this beauti-ful practice, and his reflections will help us put our topic in perspective. Who are candidates for this prayer? The prayer is not for everybody. It is not for intellectuals or for shal-low people who live on the surface of things and whose fire burns up quickly like straw. It is for generous souls of strong will who are concerned about their interior life. When to begin? Brother John sees aspirations as a higher form of prayer; hence he is hesitant to promote it indiscriminately. Aware of the dangers of too much emo-tionality as well as its necessary predispositions, he coun-sels against beginning the prayer prematurely. Strain and force must be resisted lest there be physical or psycho-logical harm. It is necessary to guard against a too san-guine assessment of one's love of God. The apostle Peter felt a great love for Jesus that led to presumption and his denial of Jesus in the courtyard. John's basic condition for the practice is a mortified life. He fears the unguarded attraction of the sweetness of this love. So he writes: "To begin this exercise it is absolutely necessary to die to ourselves, to humble ourselves, and to be self-effacing (mepriser)."llJohn is probably thinking of his own novices and their year of novitiate whenhe writes that candi-dates for this prayer should have spent "a good year" in discursive meditation and affective prayer before taking up aspirations. He also warns newcomers that begin-nings will be troublesome, even painful, but practice makes perfect and easy. The process of introversion follows Herp detail for detail. Like Herp, John of St. Samson is lyrical in his descriptions of the outcome of introversion, which is 65.3 2006 Larkin ¯ Aspiratory Prayer entrance into "the marvelous effects and the spiritual inebriation" of touching the fond or ground of one's being, where the Holy Trinity dwells and the essential union with God takes place. This mystical state is trans-formation in the fire that is God. Aspiratory Prayer in Contemplative Life Today It remains to suggest ways in which this body of teaching can be put into practice in today's contempla-tive setting. A first step, and one that is often presented in the literature, is to connect aspirations with the practice of the presence of God. This means to murmur aspirations frequently during the course of the day to remind one-self of the presence of God and to offer up the present task. This is one application in The Carmelite Directory of the Spiritual Life by John Breninger OCarm and in the works of his student Kilian J. Healy OCarm.~2 A second application is to introduce aspirations into one's daily meditation in whatever form that takes. This will be an affective addition in the nondiscursive medi-tation of Christian Meditation, which features the mantra "Maranatha." The mantra itself could be the vehicle expressing love and desire. Bringing aspiration into cen-tering prayer may be a bit more difficult, since this prayer eschews thinking and emoting. Aspirative prayer may be disruptive of the silence of centering prayer. Perhaps aspirations that are expressed without words and in silence can be a friendly addition and add warmth and fervor to centering prayer. A third way to practice aspirations in one's daily prayer is to structure it much like the two disciplines of contemplative prayer. Periods of aspiratory prayer could be cultivated each day, twenty minutes to a half hour in length, with the whole time given over to aspirations. Review for Religious The aspiration could be a mantra, one phrase repeated over and over again, or it could be spontaneous expres-sions of love and desire. The single mantra may be more compatible with the contemplative nature of the prayer than multiple expressions. Whatever the exact structure aspiratory prayer will take, it will usually be prefabricated and perfunctory in the beginning. But it soon becomes part of one's approach to God in mental prayer. Hopefully it will bring the rich rewards promised by the tradition. Notes ~ Philip Sheldrake, Spirituality and History (New York: Orbis Books, 1995), pp.186-189. 2 Aspiratory prayer is more at home with the language of love than with the Greek categories of contemplation. The literature of the Touraine Reform seems to prefer the evangelical language. One of my esteemed Carmelite teachers and mentors over a lifetime, whose life and studies were dominated by Touraine, frequently showed annoyance at the ambiguities of the vocabulary of contemplation. He preferred to speak of "love" and "loving" as the true measure of prayer rather than dif-ferent forms of "contemplation" or "contemplative." Instead of describ-ing Carmelite life as "contemplative," he preferred the simple word ,prayerful." I interpreted his attitude as a reflection of the viewpoint of Touraine. 3 Canisius Janssen OCarm surveys the sources of aspiratory prayer in the first of two excellent articles on the history and theology of aspira-tory prayer, "Oraison aspirative chez Herp et chez ses pr~d~cesseurs," Carmelus 3 (1956): 19-48. It lists the sources of this prayer in earlier times before its first major exponent, Henry Herp. These sources turn out to be the same texts cited in studies on the roots of centering prayer and Christian Meditation. An example of the latter is Robert W. Ginn's defense against critics, "Centering Prayer: Reviving the Ancient Christian Tradition in Modern Times," a manuscript dated 5/26/05 and circulated by Contemplative Outreach. Janssen's second article is titled "L'oraison aspirative chez Jean de Saint Samson," Carmelus 3 (1956): 185-216. I wish to express my gratitude for these two studies and my indebtedness to them in the formation of the present paper. 4 Spiritual Direction: Beyond the Beginnings (New York: Paulist, 2000), pp. 9-10. Christian mystics from Origen on applied the imagery of the Song of Songs to their relationship with God. St. Th~r~se of Lisieux 65.3 2006 Larkin ¯ Aspiratory Prayer belongs to this group, and a dominant feature of her prayer was aspira-tion. See Romero de Lima Gouvea OCarm, "Vivre d'amour: la pri~re aspirative chez Th~r~se de l'Enfant Jesus (1873-1897)," Carmelus 47 (2000): 19-40. s See Ernest E. Larkin OCarm, "The Little Way of St. Th~r~se of Lisieux," Review for Religious 59 (September-October 2000): 507-517, at 514-515. 6 The Touraine Reform is not as well known as its counterpart, the Discalced Reform begun by St. Teresa of Avila and St. John of the Cross in 16th-century Spain. Touraine began in Brittany in northwest France in the next century. Like the Discalced Reform, it was a radical return to the primitive spirit of the order. Unlike the Discalced Reform, Touraine did not become juridically separated from the old order, but remained in the trunk and spread to every province as the "strictior observantia." See Kilian J. Healy OCarm, Methods of Prayer in the Directory of the Carmelite Reform of Touraine (Rome: Institutum Carmelitanum, 1956), pp. 15-2 i. 7Janssen, Carmelus 3, p. 27. s This is the conclusion of James Walsh SJ in his introduction to the Classics of Western Spirituality edition of Tbe Cloud of Unknowing (New York: Paulist, 1981). 9 Janssen, Carmelus 3, p. 210. ~°Jean de St. Samson, L'dguillon, les flammes, les fl~cbes, et le miroir de l'amour de Dieu, in Oeuvres completes I, edition critique par Hein Blommestijn (Rome: Institutum Carmelitanum, 1992), p. 98. Aspiration donc n'est pas seulement un colloque affectueux. ; c'est d'icelui que nait et procede l'aspiration. Aspiration donc est un poussement amoureux, enflamm~ de tout le coeur et l'esprit; par lequel l'ame surpasse pronte-ment elle mesme et toute chose cre~e, s'unissant ~troitement ~ Dieu en la vivacit~ de son expression amoureuse; laquelle ainsi .Essentiellement exprim6e, surpasse tout amour sensible, raisonnable, intellectuel et con-prehensible; arrivant par l'impetuosit6 de l'esprit de Dieu et de son effort, ~ l'union de Dieu, non tellement quellement, mais par une soudaine transformation de l'esprit en Dieu. L'esprit, dis-ie, surpasse en lui m~me tout l'amour connessable et intelligible en l'abondante et ineffable suavitd de Dieu mesme, auquel il est amoureusement englouti. Voila que c'est que l'aspiration Essentielle en elle m~me, sa cause et son effet. (The passage is cited by Janssen in the article on John of St. Samson, p. 195. The translation has been made from the text in the c.ritical edition cited above.) li Janssen, Carmelus 3, p. 204. 12 The translation of the Directorium Carmelitanum was made from the Latin by Leo J. Walter OCarm (Chicago: Carmelite Press, 1951). See Review for Religious also Kilian J. Healy, Walking with God (New York: Declan X. McMullen, 1948), reprinted as Awakening Your Soul to the Presence of God (Manchester, New Hampshire: Sophia Institute Press, 1999); see also his chapter in Methods of Prayer, pp. 60-75. Reflection Questions 1. What have I learned about aspiratory prayer as I have read Larkin's article? 2. How might I begin to make aspiratory prayer a daily part of my prayer life? Growing Old The new hearing aid magnifies sounds I've not heard for years and discover I haven't missed. It is not my ears that hear the call to live the soul's desire. I can see tiny print with trifocals but not the messages in everything. I can no longer storm heaven's gates, have lost the need to do so. I am learning to wait gracefully with gratitude for them to open from inside. I am preparing to accept the invitation to eternity. "Growing old" begins with growing. Bonnie Thurston 6~.3 2006 PHILIP SHAN0 "Repose Days" during the Ignatian Exercises A few words by St. Ignatius Loyola in the Contemplation of the Kingdom of Jesus Christ (§§91-98) have been .understood to refer to "repose days." 1 Ignatius says, "This exercise [the kingdom] should be gone through twice during the day, that is, in the morning on rising and an hour before dinner, or before supper" (§99).2 George E. Ganss SJ describes this day as "a transitional day of relative repose with only two peri-ods prescribed." 3 It is Ignatius's introduction to the rest of the retreat. In a note Louis Puhl SJ says Ignatius's words show that the "kingdom" day is a "day intervening between the First and Second Weeks.''4 In this study we will look at the historical roots of the contemporary notion of repose days in the hope of raising some ques-tions for spiritual directors to discuss in their planning of Twentieth Annotation (thirty-day) versions of the Spiritual Exercises. Philip Shano SJ is novice director and superior at the Jesuit Novitiate of the North American Martyrs; 1035 Summit Avenue; St. Paul, Minnesota 55105. Review for Religious An early historical reference to a repose day comes from the directory of Father Juan Alfonso de Polanco, Ignatius's secretary. Polanco's directory, completed years after Ignatius's death, is generally considered the finest of those which preceded the official Directory in 1599, pre-sumably because of his closeness to Ignatius. Polanco says of this day during the retreat: "When it is time for the exercitant to move on, he should be allowed to catch his breath by giving him the meditation on the kingdom of Christ to be made twice, once in the morning and once in the evening. On that day nothing else should be given. Then, toward evening, he should be given the exercise on the incarnation to be made the next day at daybreak.''5 Note, the retreatant "should be allowed to catch his breath." Similar words are used in later directories--"as he catches his breath for a bit.''6 An anonymous direc-tory dating from the 1580s speaks of the retreatant tak-ing "a rest from his exertions until evening.''7 The directory of Father Gil Gonzfilez Dfivila, from about 1587, says the retreatant "should rest., without being given the usual load of exercises. He may, however, occupy himself with some easy meditation suited to'this time.''8 Finally, the "Official Directory of 1599" brings together some of the earlier directories: "After their gen-eral confession and Communion, those planning to con-tinue the Exercises beyond the First Week should take at least a day's rest from the intense labor of meditation. However, in the meantime they can think over and apply to themselves the parable of the Prodigal Son or some-thing similar. Moreover, they should be given a prepa-ration for their Communion so that they will approach it with reverence, faith, and spiritual relish. They should be given some suitable meditation for this.''9 A present-day handbook for directors of the Spiritual Exercises suggests that, in order to deepen the grace of 65.3 2006 Sbano ¯ "Repose Days" during the Ignatian Exercises the First Week, it is important to have a day of easier presence to the Lord. "The desirable thing is simply to enjoy the day with the Lord, rejoicing in his love and praising him. This time precedes the meditation on the Call of the King, and it is not a break day. Some directors refer to the day that separates any two major sections of the Exercises as a ¯ - break day. Others call it a day of repose. Whatever the words used, this day provides time for transition from one empha-sis to another. It usually includes . some relaxation ~ ~- from the intensity of the retreat . Relaxing after the First Week and preparing to enter the Second Week, the retreatant con-siders the material in one prayer period before taking the break and another at its conclusion.''1° It is clear from early directories that the idea was to give the exercitant a pause and then, later that same day, to resume the usual rhythms of the retreat. Considering that Ignatius is known for attentiveness to every detail of a retreatant's life, it is my assumption that he did not see any problem with having repose days. Considering that the Exercises were generally given to individuals, it is furthermore my assumption that repose days were dis-cerned together by the director and the retreatant with a view to the retreatant's particular needs at that juncture. That is, director and reteatant were not ruled by a cal-endar date set for the convenience of someone or some Repose days becom important intensity relievers during anyone's Twentieth Annotation experie de of the Spiritual Exercises. group. Review for Religious Repose days become important intensity relievers dur-ing anyone's Twentieth Annotation experience of the Spiritual Exercises, an experience where "the exercitant withdraws from all friends and acquaintances, and from all worldly cares" (~20). These days fit into the Exercises as helpful pauses. They are not a move away from the retreat, but an approach to it from a different angle. In his look at the kingdom, William Peters sJ observes a number of stylistic differences (this "strangely structured exercise") from the other exercises. He sees "Ignatius's rather exceptional way of proceeding" here as a part of Ignatius's intention that "the retreatant is given a day of rest, of repose, a day to recuperate after the strenuous efforts of the First Week." 11 Peters's view on the place of the "rather gentle consideration" of the kingdom exercise within the entire retreat downplays the kingdom.12 He sees the "transition" day as revealing Ignatius's real pur-pose, namely, "the relationship between the unfaithful courtier and his king." 13 For Peters, the exercise is a low-key consideration, destined for a day of repose. Most directors of the Spiritual Exercises include one, two, or three repose days in the structure of the retreat. Days of repose are an integral part of the Twentieth Annotation retreat. On these days, being with the Lord interiorly and yet dealing with some ordinary aspects of life has an intensity that affects retreatants. The repose "day" is a period of the retreat (several hours ideally) when one steps back from the four or five periods of prayer that are normally recommended to retreatants. On a day of repose, individuals take a break or a "pause" from their normal retreat activity. When the retreat involves a group, the day might involve a common out-ing, a picnic or something similar. It does not mean that retreatants do not pray that day. The repose day is a break from the intense prayer of the retreat mode--noth- 65.3 2006 Sbano * "Repose Days" during the Ignatian Exercises 276 ing more. That break from intensity is important. The retreatant may not feel the need for a break, but spiritual directors can perceive from their vantage point that a break is essential for the person, especially if they have prayed with matters of great importance in their lives. In a few cases, individuals make the Spiritual Exercises on their own, meeting daily with their spiritual director. More commonly, individuals make their indi-vidual retreats in a group (at a spirituality center, as a class of Jesuit novices, and so on). Exercitants experi-ence repose days differently when they are alone or in a group. Those making their retreat on their own take a break from the usual prayer pattern, but they may or may not interact with others (such as the host commu-nity, their family, or their religious community). What is crucial is the pause from the intensity of the retreat. On the other hand, those making individual retreats within a group are ipso facto doing more than taking a pause. They are interacting with other retreatants, per-sons who are experiencing diverse spiritual movements. Whether intended or not, such repose days contribute to the good of community-building. Before the repose day, savvy directors ask retreatants not to compare retreat experiences during the repose day, but to restrict their communal conversation to "safe" topics: comical moments they had together, favorite or least favorite meals, the weather, and so forth. Inevitably, however, many make comparisons during that day. "Why is that young man so enthused and gung ho about his experi-ence? Why is that woman so serious and intense about hers? What's wrong with that man who seems so dour and sad? Why does that older man seem so self-assured and so clearly ahead of me?" Regardless of how many times the directors point out that there is no "ahead" or "behind" in the spiritual life (it operates on God's time!), Review for Religious retreatants, especially those in the midst of many interior movements, tend to quantify and measure their spiritual life. Competition in life is not always explicit; often it is beneath the surface. Hardly realizing it, retreatants may ask themselves, "Why am I so blas~ compared with that person's energy and zeal? Why am I so slow compared with that person's apparent pace? Thank God I'm not as disengaged as that person seems to be!" Competition readily occurs whether we recognize it, acknowledge it, give words to it, or not. A common date for a repose day for an entire group of retreatants results from the pace and structure of life today: the calendars of all the spirituality-center workers, all the directors, and all the retreatants and the desire to "make sure it all works out neatly." Whether the directors feel that their retreatants are ready for the repose day or not, the general pattern 6 n n[date or la repqye daY for an entire group of retre tants i r"esuits f orn pace ¯and stru tureoflife today. is to give them all a repose day together and then to work around the movements it causes or interferes with. For Ignatius, the spiritual life was marked by spiritual movements. Whether consolation or desolation or ambi-guity, there is movement. That movement requires dis-cernment. That is why he included so many rules for the discernment of spirits in his text, so many details that seem obsessive to the casual reader. Retreatants in a state of serious prayer are already shaped by movements and stirrings. On a repose day with other retreatants, they will inevitably "breathe in" other persons' movements, regard-less of their director's instructions. They have a way of being almost "allergic" to the movements of others. 65.3 2006 Stsano ¯ "Repose Days" during the I~natian Exercises 278i In twenty years of directing the Spiritual Exercises, I have rarely encountered an aware and prayerful per-son who returned from a repose day without being moved interiorly in some way. How do retreatants and their directors discern these movements? Many retreatants can acknowledge the movements and get back to the business of the retreat. Others get "hooked," whether on consolation or desolation. It may be a momentary enthusiasm or aggravation or, on the other hand, a movement that goes to the very heart of who the person is. A wise director needs to be attentive to this and find ways to deal with it head-on. One wants to ensure that the movement does not interfere with the significant movements that Ignatius is seeking in the discernment of the Second Week. Sometimes it is movement that is important to the per-son's prayer, for instance, an insight into a way of pro-ceeding in relationships. Sometimes it is an unhelpful distraction, taking the person "off course" with a con-versation about church or state politics. Many directors fail to ask enough questions about the repose day and its movements in people. They may say to themselves, "Well, both of us have had a good break and now we can move on to the Second Week," and fail to find any deeper meanings in it. Ignatius would want some probing, as he implies in the Sixth Annotation .when he urges directors to ask about the supposedly peripheral aspects of the day (§6). The day of r.epose may easily have caused the retreatant to go into a tailspin, one that could last for several days. Directors who are unsavvy may assume all kinds of reasons for the discouragement, tepidity, or lethargy. The reasons could be much closer to home. The movement could, indeed, reveal important aspects of how God is working with the person. It could also be a move-ment that distracts the person from the ways of God. Review for Religious Communal interaction is good, but, like any "good," it needs to be discerned. One can easily be deceived by its seeming goodness, but sometimes the movement on a repose day can be advantageous to a retreatant. The woman who was apathetic or tepid up till then may com-pare herself with others and realize that she has to get more serious about the spiritual life and her patterns of prayer. The man who was too intense and racing may real-ize that he needs to be more discreet, deliberate, and paced about his prayer. I refer to these movements as "the grace of the repose day." It can spur a tepid person or slow down a fast-paced person. But there can also be serious disad-vantages. What if the movement is artificial? What if the movement from the repose day interferes with movements that were already going on in a person's prayer? What, then, are some of the things that wise and cun-ning spiritual directors need to be aware of when they direct individuals of a group making a retreat, one that includes repose days that may come along at times that are inconvenient to their retreatants' natural movements? First and most essential is the need for discernment. Directors should not think that they are wasting their time, but that they are helping.the exercitant to appro-priate the repose day's meaning for their prayer. Many directors recommend, or even guide retreatants through, an examen of consciousness to discern exactly what the repose time included: life-giving or life-draining con-versations, feelings of gratitude or impatience, of hope or ennui. Quite often the fifth rule (§3 3 3) of the Rules for the Discernment of Spirits for the Second Week is men-tioned. There Ignatius has the retreatant look at the whole course of events pertaining to a spiritual move-ment-- the beginning, middle, and end. Perhaps the exercitant can be asked to read other Rules for Discernment as well. 65.3 2006 Sbano * "Repose Days" during the Ignatian Exercises A second thing regarding a scheduled day of repose for the individuals of a group is that some individuals are ready for that repose day and some are not. If all make it, comparisons will be made regardless of directors' urging not to make them. Directors should ask them-selves, "Should this particular retreatant do the repose day or not? Considering where the person is, will a repose day help or hinder the movements he or she is experiencing?" We can easily be caught by "groupthink" and assume that a ~ o. ~ :' .~.'~ person should havea ,question ~ repose day simply " ~ because the calendar lists it for the conve-nient operation of the retreat center. The truly discerning question is whether or not the individual is ready for a breather. For the per-son who takes part in the repose day (or does not), what instructions should be given? I would recommend not giving the retreatant a repose day just because everyone else is doing it. Directors should ask, "Will this retreatant benefit from the repose day?" The Spiritual Exercises are for the retreatant. Retreatants should not have to bend to accommodate themselves to the schedule of the spirituality center or the team of directors. Third is the structure and length of the repose day. The early directories do not give the impression that there Was a full day of repose. Yet the increasingly common practice is to lengthen the day and perhaps forgo the daily direction period. Teams of directors need to ask carefully what they will suggest for the day. One retreat center's Web site says that a repose day is a good day for an out-ing to a local mall. The cynical mind would see this activ- The truly disce?nihg is whether ,or not the individual is ready for.a breather. 280 Review for Religious ity as giving the retreatant suitable prayer material for the Two Standards meditation coming in just a few days, as if retreatants do not have enough data already. Another director might wonder what a trip to a mall could offer someone who is praying for poverty and the Third Degree of Humility. The length of the day also requires team dis-cussion and discernment. What is the right length--for time to breathe but not go into a tailspin. The practice of repose days is often taken for granted. Directors and teams do not ask enough questions about it. The aim of this article has been to encourage ques-tioning. Notes ~ This note on "repose days" was inspired by three Jesuit novices whose retreat I directed. By their experiences, openness, and questions, Vincent Strand nSJ, Brian Rademacher nSJ, and Christopher Krall nSJ never stopped quietly calling me to move forward in faith. I offer them these words in gratitude. 2 Spiritual Exercises, §99. Unless noted, all quotations to the Exercises are from the translation by Louis J. Puhl SJ, The Spiritual Exercises of St. Ignatius (Chicago: Loyola University Press, 1951). 3 George E. Ganss SJ, The Spiritual Exercises of Saint Ignatius: A Translation and Commentary (St. Louis: Institute of Jesuit Sources, 1992), p. 159. 4 Puhl, p. 177. s Number 62 in "Directory of Juan.Alfonso de Polanco," in Martin E. Palmer SJ, On Giving the Spiritual Exercises: The Early Jesuit Manuscript Directories and the Official Directory of I Y99 (St. Louis: Institute of Jesuit Sources, 1996), p. 131. The Latin text is: "Peracta confessione generali, cum ulterius progrediendum est, ut respiret qui exercetur, meditatio de regno Christi ei proponetur, quae bis fiet, mane scilicet et vesperi; et pro illo die alia non proponantur; deinde sub vesperam Exercitium incar-nationis proponetur, postridie faciendum in aurora." 6 Number 81 in "Directory of Father Antonio Cordeses," in Palmer, p. 275. 7 Number 60 in "A Short Directory for Giving the Society's Exercises Effectively," in Palmer, p. 212. ~ Number 87 in "The Directory of Father Gil Gonz~ilez Dgvila," in Palmer, p. 250. 65.3 2OO6 Sbano * "Repose Days" during the Ignatian Exercises 9 Number 140 in "The Official Directory of 1599," in Palmer, p. 318. 10 Marian Cowan CSJ and John Carroll Futrell SJ, The Spiritual Exercises of St. Ignatius of Loyola: A Handbook for Directors (Denver, Ministry Training Services, 1981), p. 69. 11 William A.M. Peters SJ, "The Kingdom: The Text of the Exercise," Way Supplement 18 (Spring 1973): 9. ~2 Peters, pp. 16 and 11. ~3 Peters, p. 13. 282] Tinsel in August Scraps of it, in the evening grass, Left over from last Christmas's tree Dragged by its stump to its shreddedness, Casting garlands and crowns on its path, Still catch moon-sparks - like the cat With tinsel eyes, going forth into night With glitter afoot from May's prom-party Dress, and June's wedding gown, that drifted Crystal and spangles over the family pets, Over carpeting, over dancers and through cracks In the house. Overhead now, the tinsel Of summer stars slowly shreds with the sullen Advance of thunder and sheet-tinsel garlanding Horizons far to the West. Cat-tag tinseling, Lucifur comes home wet from his tryst. Nancy G. Westerfield Review for Religious CHARLES P. FARRAR Gerard Manley Hopkins's "Lantern out of Doors": A Contemplative Response to Loss Seometimes the clearest way to describe an experi-nce is metaphorically. When an experience is unique and mysterious, we link it to something more common to make it more understandable. According to its Greek roots, metaphor means "to carry across." A well-conceived metaphor carries meaning across from one plane to another, thereby elevating the reader's con-sciousness. Metaphors have always been effective in the deft hands of writers of good spiritual theology: they suggest insights about God. The English Jesuit Gerard Manley Hopkins (1844-1889) was a master of the spiritual metaphor. His poems' everyday images elevate readers' minds to fresh spiritual understandings. In the follow-ing sonnet a lantern conveys the experience of loss. Charles P. Farrar works as a hospital chaplain in Detroit. His address is 1930 Piper Drive, apt. 204; Rochester Hills, Michigan 48307. 65.3 2006 Farrar ¯ Lantern out of Doors 284, The Lantern out of Doors Sometimes a lantern moves along the night. That interests our eyes. And who goes there? I think; where from and bound, I wonder, where, With, all down darkness wide, his wading light? Men go by me whom either beauty bright In mould or mind or what not else makes rare: They rain against our much-thick and marsh air Rich beams, till death or distance buys them quite. Death or distance soon consumes them: wind V~at most I may eye after, be in at the end I cannot, and out of sight is out of mind. Christ minds: Christ's interest, what to avow or amend There, dyes them, heart wfnts, care hfunts, foot f611ows kfnd, Their rfnsom, their rescue, find first, ffst, last frMnd.1 The metaphor here, developing gradually through the two quatrains and the first tercet, is wonderfully subversive. What we think is a lyrical reflection about an ordinary event surprisingly turns out to be much more. The speaker leads us from a concrete observation (a nighttime lantern moving through the speaker's vision), to a more abstract observation about how the lives of beautiful people "go by" him until they disappear from view. What Hopkins is "carrying across" is the striking similarity between the way nighttime travelers pass by on the road and the way peo-ple come and go in our lives. But that is not all. In the last tercet he carries us to another plane of meaning, making a beautiful Christological statement: that Christ can do something which we cannot. He can keep up loving friendships with all those people whose departure from our lives had sad-dened us. This metaphor has carried us contemplatively from an everyday observation to--presto!--the healing of that sadness of ours. Review for Rdigious The first line and a half moves smoothly enough. Then we are jarred by "who goes there?" Suddenly the speaker becomes aware that the moving lantern implies a person. In lines 3 and 4 he drifts into a reverie about the whence and whither of the person "wading" like a lantern through a sea of darkness. All he knows of the person are the few moments of light present amid o.bscurity. The second stanza reflects on the beauty of certain people in the speaker's life, whether physical or internal beauty ("in mould or mind"). Such people are "bright" and "rare," like lanterns in the dark, like "rich beams" that "rain" against the "marsh air" of our mundane life. Notice how subjective this is. He is not primarily describ-ing the beauty in these people or the brightness in the lanterns. Rather he describes how these qualities affect him. (In this way Hopkins follows the tradition of Romantic poets like Wordsworth, Keats, and Rilke.) Consequently, when in line 8 these people leave the speaker's ken by "death or distance," they, for all intents and purposes, cease to exist. The word "quite" in line 8 seems to mean "completely." They disappear com-pletelyJhow tragic! The next tercet (lines 9-11) is a bit twisty to under-stand. And appropriately enough, for the action is the speaker's vain effort to keep these people in view as they go down a winding, twisting road. The Hopkins scholar Peter Milward says: "How eagerly soever he follows the winding steps of such men as they recede into the dark-ness, he cannot 'be in at the end'--that is, follow their subsequent history to its end.''2 The speaker concludes this thought with the clich6"out of sight is out of mind"--as though he is too numb emotionally to come up with a fresh phrase. We cannot help being struck by the loneliness of all this. The poem tells us nothing about these beautiful 65.3 2006 Farrar ¯ Lantern out of Doors The poem tells us nothi 2,861 lantern-like people. It does not reveal any empathy toward them; there is no relationship here. All that mat-ters is how the speaker feels: he sees them as "interesting," "beautiful," "bright," and "rare," and his seeing falls short. It seems he is psychologically trapped inside his own emotions. Notice how, for emphasis, Hopkins chimes the "I" sound three times in: "I about" thkse behut l may eye after, be in at the ¯ "~"~v~,~ia'tern*liv°'~a'i~ ~,,, end / I cannot." To find any happiness, he must be rescued from this solipsistic sighing. The rescue comes quickly in the last three lines. Simply by the sound of them, the reader senses that the speaker's mood has picked up. Thanks to Hopkins's "sprung rhythm," it all bursts to life sis-boom-bah. After lamenting that the beautiful persons disappear from his own mind, the speaker quickly adds that in Christ's mind they live on. Christ, too, is "interested" in those beauti-ful people, but his interest is objective, not subjective. He is interested, not in his feelings about them, but in their welfare. He never fails to "avow" all that is good in them, and he works to "amend" whatever they fail in. The words "~yes them, heart wfints, care hfiunts, foot f611ows kind" run together breathlessly,3 demonstrating an urgency of concern. This urgency, however, comes, not from last-ditch hopes groping in the darkness, but rather from the desire of Christ's heart. It comes from Christ's unconditional interest in them, not because of some particular beauty in them, but simply because of God's unfailing love for them. Christ can succeed where the speaker of the poem fails. His omniscient vision "eyes" all people without Review for Religious interruption. The speaker gladly acknowledges that from heaven our Lord gazes on them perpetually. And his "foot" can "follow" them without interference. This phrase "foot follows kind," incidentally, is a remarkable terse statement of the mystery of the incarnation. Thanks to the Son's taking on a human nature, he can "follow" us, as of one "kind" with him.4 As Hebrews puts it, "since the one who saves and those who are being saved have a common origin, Jesus does not hesitate to treat them as a family.''5 Being divine, Christ can follow us; with a human nature, he cannot help following us. From this, the sonnet's last line flows smoothly, both in its music and its logic. Being our "rescue" (the Messiah saves us from death) and our "ransom" (his sacrifice itself saves us), he has proven himself to be our "first, fast, last friend." Friendship is what the lantern-seeker yearns for but is denied. Abiding friendship, however, is precisely the promise which Christ fulfills.6 From the speaker's existential, self-absorbed lament about his unfulfilled affection for certain beautiful people, he arrives at a place of peace. His conviction that Christ's love for these peo-ple is complete, unlike his own, consoles him. One apparent weakness in the argument of this poem is that the conclusion seems to have been reached too facilely. It seems superficial or unreal that the speaker could assuage his sadness simply by calling Christ to mind. A study of Hopkins's life, however, suggests that the bur-den of this poem was likely learned and earned through a real personal struggle. One episode in his life shows how this sonnet may be somewhat autobiographical. In the winter of 1865, when he was a twenty-year-old Oxford student, he met a young man several years his junior named Digby Dolben. Dolben's cousin Robert Bridges appears to have asked Hopkins the favor of help-ing the younger man gain admission into Oxford. Dolben 65.3 2006 Farrar ¯ Lantern out of Doors was unforgettably vivacious and artistic. The two young men shared a passion for religion and poetry composi-tion. According to Hopkins's celebrated biographer Robert Bernard Martin, Dolben must have made a pow-erful impression on Hopkins's soul.7 His feelings, how-ever, were ambivalent: he relished this friendship, but also struggled with his desire to deepen it. When cir-cumstances required that Dolben move away later that same year, Hopkins was left feeling empty. When he learned of his friend's tragic drowning two years after-wards, he was devastated. Although Hopkins did not elaborate on these feel-ings in his letters or journals, there is a laconic journal entry from 1873: "I received as I think a great mercy about Dolben." This line was written immediately after a ten day spiritual retreat. It is remarkable that this per-son, with whom he had enjoyed communication only for a number of months, would be on his mind all these years later. It is more remarkable that the memory would surface as a consolation after a time of intense prayer. What had been going on in Hopkins's mind all this time? I believe the "Lantern out of Doors" provides a key. The connection between this episode and the sonnet-- albeit speculative--is compelling. Dolben's passing through Hopkins's life was much like the poem's lantern. In Hopkins's quiet and introverted life, Dolben's effer-vescent personality and artistic sensibilities must have been "rich beams" glinting in Hopkins's "marsh air." Moreover, Dolben's departure, first by "distance," then by "death," probably left him feeling much as the poem's first eleven lines leave us readers feeling. We can speculate that Hopkins tried to cope with this predicament psychologically. At this time he was embarking upon an earnest spiritual journey, one which would lead him first to become Catholic and then to join Review for Religious the Society of Jesus. It was a fertile time for him, spiri-tually and artistically. His journals and letters give ample evidence of a soul immersed in wonder and contempla-tion. Hopkins's Ignatian spiritual formation inspired him to seek God's presence in all things. Doubtless, his sad-ness about Digby Dolben entered into his contem-plative exercises. That journal entry referring to the mercy he received about Dolben was most likely a fruit of these devotions. The inspiration of the last three lines of the sonnet might, then, have flowed quite naturally. In a moment of contemplating Christ, the consolation mer-cifully came to him concerning Christ's invincible friend-ship with Dolben. If we could indulge in further conjecture about this sort of contemplation, it is reasonable to suppose that a key might be found in St. Ignatius's Spiritual Exercises. For Hopkins as a Jesuit, this text could have been foun-dational; any experience of consolation could well have been understood in its light. One teaching in the Exercises stands out. The fourth point of the Contemplation to Attain Divine Love instructs the exercitant "to consider how all blessings and gifts descend from above. My lim-ited power, for example, comes from the supreme and infinite power from above. In like manner, justice, good-ness, pity, mercy, etc., descend from above just as the rays from the sun, the waters from the spring, etc.''8 Here one is being directed from a consciousness of blessings and gifts toward a contemplation of the God from whom they descend. It is plausible to imagine the 65.3 2006 Farrar * Lantern out of Doors 290 young Hopkins--still staggered by the radiant gifts that Dolben had brought into his life--in an effort to come to terms with his loss, contemplating the infinite power of Christ, who made these gifts shine through his late friend. And would this not have inspired Hopkins to trust that Christ's light will continue to shine upon and through Dolben for all eternity. Whether Hopkins can see it or not, he can still experience the healing which comes from the conviction that his friend is in very good hands. As Peter Milward elegantly puts it, "the last word 'friend' emphasizes the truth that the 'lantern out of doors' has its end in the love of Christ.''9 Perhaps many of us have had similar struggles and breakthroughs. I, for one, am constantly reminded of feelings of attraction toward the lantern-like people in my life: and also of the helpless sadness of separation. One example comes to mind, which arose out of my work as a hospital chaplain. I responded to a patient's request to visit him. Let us call him John. We enjoyed a rich conversation, about an hour long, about his spiritual his-tory, his family, his hopes for the future, and the mean-ing of life in general. It was the same the next two days. These visits were very fulfilling for me. It was no trou-ble for me to squeeze my schedule to find time for John. On the fourth day, to my surprise, the bed was empty. I discovered he had been discharged just a short time ago. A flood of questions came to mind: What did this mean? Was he feeling better? Why didn't he tell me he was leaving? This last question vexed me most. Like the sonnet's lantern-watcher, my thoughts were more on my letdown than on John's welfare. I felt guilty about that. I also felt guilty about getting so close to a patient. I remembered the hoary old adage of Clinical Pastoral Education: "Be careful about letting the ministry be a satisfaction for your personal needs." Review for Religious But why should I deny the good feelings that these visits with John had given me? They made me feel valu-able as a chaplain, and I wanted more. Like Hopkins contrasting the "much-thick and marsh air" of his mun-dane life with the "rich beams" some people's lives send forth, I wanted to feel that light. It helped me feel com-petent and useful. It gave my ministry an emphatic sense of purpose. I felt connected with this patient and wanted to connect some more. Then, like a lantern in the night, he was gone. I wish I could say that I rebounded immediately and arrived at a profound conviction akin to the insight of the last tercet in Hopkins's sonnet. But to this day I still feel some emptiness about John. As I later spoke with a friend about this, I realized how much emptiness there is in my heart about the many interesting people who have passed into and then out of my life. While I may not have "gotten over" the various sorts of grief occasioned by these losses, I often experience moments of consola-tion about them. I will find myself in the Liturgy, in prayer, in a conversation with someone, or reading, for instance, when some kind of assurance mysteriously comes. It is a consoling belief that Christ is watching over all God's children, that somehow they are all safe in his care. My attempts to analyze or describe these moments of consolation invariably, end in futility. What I can say is that they give me peace. I suppose what hap-pens is that my attention graciously moves from my own self-centered emptiness about the loss to a contemplation of where these individuals are in Christ's perspective, that is to say, watched over, loved, cared for by him. They are welcomed into friendship by their "first, fast, last friend." There are manifold ways to deal therapeutically with loss. Books teaching cognitive techniques consistently 65.3 2006 Farrar ¯ Lantern out of Doors find their place on bestseller lists. Granting the effec-tiveness of these techniques, I hope that believers will also consider the simple insight offered by this lovely poem. I hope we will forever keep our hearts open to seeing that those who have journeyed beyond our eye-sight remain within our Savior's. And there is a consol-ing corollary, that Christ watches my lantern too. Notes 1 Norman H. MacKenzie, ed., The Poetical Works of Gerard Manley Hopkins (Oxford: Clarendon Press, 1992), no. 113, p. 40. 2 Peter Milward, A Commentary on the Sonnets of G.M Hopkins (Chicago: Loyola University Press, 1985), p. 62. 3 This effect is aided by the fact, as Milward (p. 63) observes, that the accents are on the verbs. 4 "Kind" has a double meaning here, nature and benevolence. These meanings are especially lovely in contrast to the rhymes (1) "mind" in the phrase "out of mind" and (2) "wind," the speaker's futile visual pursuit of the lanterns' apparent windings. The suggestion in the word "kind" is that the remedy for the speaker's sadness is that Christ is of a kind with us and is kind as well. s Hebrews 2:11, from Eugene H. Peterson, trans., The New Testament in Contemporary Language (Colorado Springs: NavPress, 2002). 6 See John 15:13-15. 7 Robert B. Martin, Gerard Manley Hopkins:/1 Very Private Life (London: Harper, 1991), pp. 80-170. 8 The Spiritual Exercises of St. Ignatius, trans. Anthony Mottola (New York: Doubleday, 1964), p. 104. 9 Milward, Commentary, p. 63. Review for Religious RAYMOND R. RYAN Today's Candidates: Who Are They, What Do They Expect? Occasionally, as I try to explain to interested questioners what is going on in the novitiate, their eyes glaze over and I hear them internal-izing W.C. Fields's famous comment, "There's less here than meets the eye." Actually there is much more here than meets the eye. Formation today is dynamic, not static; not only for "them," but also for "us." Otherwise it is only a game, a series of hoops to be jumped through with blithe disregard for the future. Concern for that future, however, has prompted a great deal of research on the char-acteristics of today's candidates for religious life and priesthood. Perhaps a few findings from that research will help us better understand our new-comers, our novices. The fall 2004 issue of Touchstone, the official publication of the Raymond R. Ryan OSA, a former novice director, writes from the Augustinian Provincialate; 20300 Governors Highway; Olympia Fields, Illinois 60461. being religious 65.3 2006 Ryan * Today's Candidates ConversiOff iS ctnii iuou s through: initia[ a nd formation, and.it n ver s opS.i National Federation of Priests' Councils, features an arti-cle by Dominican Andrew Carl Wisdom: "Why Every Generation Matters in Preaching." He indicates that every congregation is made up of four or five distinct commu-nities: Builders (1901.-1924), Silent Generation (1925- 1942), Baby Boomers (1943-1964), Generation X (1964-1981), and Millennials (1981-present). He chal-lenges preachers to be aware of this intergenerational phe-nomenon and address homilies to each generation. It is not uncommon for a novitiate class or a postnovitiate for-mation community to have three generations represented. One of those younger men puts it this way: "I am not simply in formation, but in a real sense in re-for-mation. I am already someone with a full life, commitments, and deeply held con-victions. I don't know that the order is all that ready for people like me." Another, reflecting on his for-mation experience, remarks: "It is understood that we all have faults and reach various levels of maturity dur-ing different stages of our li~'es. However, it is of par-ticular concern when . . . one who has a reasonable, relatively healthy sense of self is now in formation with others who are considerably younger or much older, or have not yet resolved such pressing identity issues as their own sexuality. A formation team must be equipped to recognize and address such disparities within a for-mation community, rather than treat everyone with a one-size-fits-all approach." These observations make us aware that formation today is quite a venture. The two brothers quoted had Review for Religious good insights. One looks for re-formation. For the other, one-size-fits-all formation can be deformation. Obviously, intergenerational living with various levels of maturity and immaturity not only is a challenge, but can be a heavy cross. We who are supposedly "formed" can attest to how adult immaturity adversely affects our communal life. Before mentioning some formation components as they relate to today's candidates, I quote Msgr. Dennis Sheehan, senior Catholic chaplain at Harvard University, regarding some current candidates: Today's seminarian is older and more experienced . My fear is that at times we will form a priest accord-ing to all the directives and requirements. But, if he has not tracked that with the ongoing conversion of his intellectual, moral, and religious life, we are likely to find a formed priest who is only a partial Christian. ¯ . In this generation, when so many come to us chronologically and psychologically older, it is far more difficult to change basic assumptions. They will learn the Scriptures and theology and pass examina-tions . . . but then what? Often enough they can become a canonical enforcer. The collaborative can-didate becomes a clerical Caesar. (Seminary Journal, fall 2004) While Msgr. Sheehan is concerned with priesthood can-didates, his observation can also apply to candidates for religious life. His concern is that both initial and con-tinuing formation be considered matters of unending conversion, a quite Augustinian outlook. Life is a con-tinuing call to change and grow. Conversion, then, is continuous through initial and continuing formation and it never stops. For this reason, today's formation programs have both a strong programmatic component, which presents the elements of Catholic, Christian, and Augustinian (or Benedictine, Franciscan, and so forth) spirituality, and a 65.3 2006 Ryan ¯ Today's Candidates 296 personal/communal component. The latter has four interconnected goals, asking each candidate to: ¯ know himself and his stow; ¯ commit to building and sustaining healthy intimacy in his life; ¯ learn, or continue to learn, and understand that integration is a lifelong process. The gospel calls us to work at continuing conversion and to invite others into that lifelong and life-giving call from the Lord; ¯ allow himself to live in the tensions encountered, accepting that these are a part of integration. We cannot always reconcile tensions or "fix" things. God's presence is experienced just as surely in darkness as in light. The practice of solitude brings perspective, sometimes peace, but always a centering in Jesus, self, and others in our actual circumstances. These goals are spelled out more concretely in some of the following ways. Candidates have spiritual directors at all levels of initial formation. Directors meet those in formation monthly. The history and continuing stoW of God's call is a part of these discussions. When I was in a peer supervision group while novice director, our facil-itator, a Dominican sister with age, wisdom, and grace asked us, usually at a time of conflict or self-doubt, "And what's going on in you right now as you relate your stow?" I did not like the question, even after four and a half years in the group. Why? Because it forced me to clarify what I did not want to face or did not want to integrate into my life. Indeed, sharing ourselves brings deeper self-knowledge and a deeper realization that, the more personal the problem, the more universal it is. Formation today, along with the previously men-tioned personal elements, encourages the communal dimension, in ways perhaps strange or at least fleetingly uncomfortable to some. The "climate check," which we Review for Religious in our province used, is helpful. It is a simple statement of some truth about ourselves, our families, and our lives; it helps us "tune in" to each other--or perhaps find our-selves "on the same page," discovering a commonality of experiences. When community members suffer from misunderstandings or hurts, they are encouraged to meet together. One-on-ones, especially in conflict situations, can help them work through interpersonal difficulties. Sometimes things do not work out as hoped; that can be helpful too. We can ask what this tells us about each other and ourselves: "What's going on in us right now?" Postnovitiate formation invites all of the community members to attend house chapters and community meet-ings-- our more formal community structures. These can effectively introduce newer members into our time-hon-ored ways of being together. Contemporary Augustinian formation encourages personal and communal sharing. This is done not because psychologists have invaded our mid

Issue 63.2 of the Review for Religious, 2004. ; 2004 Review for Religious helps people respond and be faithful to God's universal call to holiness by making available to them the spiritual legacies that flow from the charisms of Catholic consecrated life. Review for Religious (ISSN 0034-639X) is published quarterly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ° St. Joseph's Provincial House 333 South Seton Avenue ° Emmitsburg, Maryland 21727 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2004 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permissign will only be considered on written application to the Editor, Review for Religigus. view for religious LIVING OUR CATHOLIC LEGACIES Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming SJ Clare Boehmer ASC Philip C. Fischer SJ Elizabeth McDonough OP Mary Ann Foppe Tray Gramn~ Judy Sharp Sr. Raymond Marie Gerard FSP Eugene Hensell OSB Ernest E. Larkin QCarm Louis and Angela Menard Bishop Carlos A. Sevilla sJ Miriam D. Ukeritis csJ QUARTERLY 63.2 2004 contents 118 134 143 spirituaO wisdom Keeping a Balance: Contemplation and Christian Meditation Brian V. Johnstone CSSR proposes that some form of active vocal prayer may well go together with contemplation. Faith Seeking Understanding: Spiritual Direction's Sapiential Function Dennis J. Billy CSSR explains how spiritual direction is a divine (but also human) art that helps us "pray in truth" and come to an intimate personal knowledge of God. Windows of the Soul: Walter Ciszek SJ George Asehenbrenner SJ relates the incident in the life of the Jesuit Walter Ciszek that gave him the faith-filled freedom to survive twenty years of Communist prison. 148 158 men oring Merton and a Spirituality for Millennials Fred Herron proposes Merton's retrieval of the riches of the Benedictine Rule as a spirituality for the millennial generation. Paradox in the Monastery: Lessons from Two Ammas Laura Swan OSB reflects upon the paradox that oft-told stories reveal more about us and our current struggles than about the subject of the story. Review for Religious 169 Viewing Chapters as "Authorizing" Our Congregations' Narratives Patrick Sean Moffett CFC presents various aspects of religious-life chapters that emphasize the storytelling nature of these ecclesial events. 182 ignatian tradition Our Lady's Presence in the Spiritual Exercises J. Thomas Hamel SJ helps us to review the subtle, but penetrating, presence of our Lady to the prayer exercises of the Ignatian Spiritual Exercises. 192 The Spiritual Power of Matter: Teilhard and the Exercises Kathleen Duffy SSJ shows how the Spiritual Exercises of St. Ignatius helped Teilhard de Chardin to synthesize the science of evolution with his Christian knowledge of God. departments 116 Prisms 204 Canonical Counsel: Mergers, Unions, Federations, and Confederations 211 Book Reviews 63.2 2004 Pentecost is the traditional birthday of the Christian church, and its mis-sionary effort began simultaneously with its birth. As we read in the second chapter of the Acts of the Apostles, Peter stood up "with the Eleven, raised his voice, and addressed the devout Jews of every nation staying in Jerusalem at the time. 'Jesus God has raised up, and we are his witnesses. Exalted at God's right hand, he first received the promised Holy Spirit from the Father, then poured this Spirit out on us. This is what you now see and hear'" (Ac 2:32-33). As a result of Peter's preaching on this first Pentecost day, some three thousand were bap-tized. This is the story of the church's birthday. After centuries of identifying mission just as one of the activities of the church, we now are returning to the church beginnings at Pentecost to realize how church and mission are a single reality. We might claim, then, that Christian theology has its beginnings in our reflection on mission. In the U.S. bishops' 1986 pastoral let-ter "To the Ends of the Earth," we read: "To say church is to say mission." Our way of theologizing about our Trinitarian God--Father, Son, and Spirit--is in terms of their active relationships, in terms of their mission. In Genesis, God pours forth the Spirit, and creation and life happen. In the Gospel of St. John, Jesus describes himself as the One who is sent. And, in that same Gospel, Review for Religious Jesus describes anew a sending of the Spirit from the Father and himself. Both creation and redemption can be described as salvific acts because God as "missionary" is always involved in being a saving presence in creation. As the Body of Christ, sharing in divine life, we the church also share in God's mission. The church, then, like our Trinitarian God, is missionary in its very being. The word missionary cannot be restricted only to those sent to evangelize in countries or cultures not their own. In fact, mission cannot be defined by geography, especially in our globalized world. Mission is not driven just by the zeal to expand the boundaries of the church. To be missionary, however, does call us to step out beyond the boundaries of our fears and our traditions and our cultures. If being church is being missionary, what does mis-sion mean for us? We Christians, members of Christ's Body, are missionary in our very baptismal being. Jesus has extended his mission to us all--proclaiming the reign of God (close around us) and so making people aware of the nearness of a saving, loving God. Just as the mis-sion of God is found incarnated in Jesus' life mission, we realize that our mission today must be exercised in the way we live and deal with others. It is the way that God respects and dialogues with us human beings. Only with such dialogue and respect can we make ourselves one with God's mission. As missionaries, like St. Francis of Assisi, we live, and sometimes we have to preach. There is a traditional saying, "You can only convert what you love." In an analogous way, we might need first to be "evangelized" by those that we intend to evangelize. But today we are being called anew to be who we are baptized to be: missionaries, made in the image and like-ness of our Trinitarian God, our Missionary God. David L. Fleming SJ 63.2 2004 spiritua wisdom BRIAN V. JOHNSTONE Keeping a Balance: Contemplation and Christian Meditation Some time ago Ernest E. Larkin OCarm pub-lished an article titled "Today's Contemplative Prayer Forms: Are they Contemplation?" After reviewing the different meanings given to "meditation" and "contemplation," he conclu-ded: "In this frame of reference, we see that centering prayer and Christian Meditation do not fit handily in the category of either meditation or contemplation. They are something new in contemplative practice.''1 The present article offers an account of what is different in these contemporary prayer forms and seeks to show how they are nevertheless related to tradition. The discussion will focus primarily on Christian Meditation. Meditation and Contemplation Contemplation itself, as understood for example by St. John of the Cross, is "pure Oft"; there is no place in it for active collaboration. Brian V. Johnstone CSSR, new to our pages, writes from Accademia Alfonsiana; C.P. 2458; 00100 Roma; Italy. Review for Religious Thus, Larkin concludes, "John's contemplation is not the immediate horizon of contemporary contemplative prayer forms.''2 In his writings, the Benedictine monk John Main, who is recognized as the original exponent of Christian Meditation, does not enter into lengthy, detailed analysis of the higher states of prayer such as we find in St. Teresa or St. John of the Cross. In his account of Christian Meditation, John Main says: "I am using the term meditation as synonymous with contemplation, contemplative prayer, meditative prayer, and so forth.''3 We do not find in his writings a sharp distinction between contemplation in the classic sense and the forms of prayer that entail the active engagement of the person praying. Is there an issue here? Perhaps the most practical question is whether Christian Meditation is to be regarded as a form of contemplation in the classic sense, that is, a type of prayer that is believed to be given freely by God, but usually only after a long process of many steps. In particular, for John of the Cross, contemplation begins with the passive, dark night of the senses. This would mean, at least in a commonly accepted interpretation of contemplation, that it would be a miraculous supernatural event reserved for an elite. Christian Meditation, as described by John Main, is not like this. It is a form of prayer in which, after some simple instruction, beginners can join. He is concerned to impart to interested persons a simple method which, being simple, is available to many. Participants are not encouraged to think of themselves as moving from stage to stage along a precisely delineated path towards a "higher" level of prayer. It is recognized that meditation over a long period, many years in fact, is usually necessary to acquire facility and skill, but experienced meditators are not considered as having attained a level of prayer with different requirements from those that are appropriate and possible for beginners. 63.2 2004 Johnstone ¯ Keeping a Balance A fear of mistaking "doing nothing, with nothing happening" for genuine contemplation has a long history in Christian prayer. This raises an important practical issue. In the traditional theological analysis, it was important that persons engaged in prayer recognize clearly the stage they had attained. A director was to assist discernment in this matter. Since there were particular rules and expectations for each stage, a mistake could have serious spiritual consequences. The issue is mentioned in Larkin's article; he cites James Arraj as warning that without "express contemplation" (which I take to mean contemplation in the sense of "infused" or passive contemplation) the person should continue to make acts of faith and love rather than be "simply idle in the prayer." 4 The practical problem seems to come when people think they have been given the pure gift of contemplation in the proper sense. Then, since this level is essentially passive and excludes the making of acts, they think they should drop such activity. But they may be mistaken. Having stopped making acts of faith and so forth, they may then just "hang out," doing nothing, thinking they are enjoying the gift of passive contemplation when they are merely being passive. They would be doing nothing, and nothing would be happening. This would be unlikely in the case of people following John Main's Christian Meditation. He insists on the continuous, quiet repetition of a short prayer that he calls the mantra; if persons at prayer should momentarily lapse into inactivity and find themselves Review for Religious doing nothing, they should immediately begin repeating the mantra again. A fear of mistaking "doing nothing, with nothing happening" for genuine contemplation has a long history in Christian prayer. On the one hand, it would be a serious mistake to lead people to believe that the hours they are spending in "contemplation" are just a waste of time, mere wool gathering. On the other hand, if a spiritual guide such as John Main strongly recommends that people continue to make acts during meditation, does this imply that in this form of meditation there is no place at all for contemplation in the classic passive sense? In offering an answer to this question, I will examine a prayer form recommended by St. Teresa and accepted also by some who followed her. As I will seek to show, she had a less restrictive notion of contemplation than the previous analysis suggests. This broader notion of contemplation, furthermore, may well have a parallel in Christian Meditation. Active Recollection Larkin takes note of St. Teresa's "active recollection," a form of prayer that she developed from her own experience,s He describes it as a "transitional prayer form that is very similar to modern contemplative prayer.''6 "Transitional" indicates that this way of praying is followed by those who are passing from simple meditation to the "higher" levels of contemplation, but have not yet arrived. St. Alphonsus de Liguori (+1787), in addition to his works on moral theology, wrote extensively on the spiritual life, and in particular on prayer. Following St. Teresa, he gives special mention to "active recollection," which he links closely to "contemplative repose," an expression he takes from "the mystics.''7 Contemplative repose, he explains, is vi.rtually the same as active recollection; it refers to a spiritual condition in which 63.2 2004 ,~obnstone * Keei~ing a Balance "the soul is focused on some spiritual thought and, absorbed in itself, feels gently attracted to God." I will analyze this type of prayer, "active contemplation," and compare it with Christian Meditation. Such a comparison will, I believe, serve to show the continuity of Christian Meditation with tl~e older tradition, and also bring to light those new features which it has to offer. What did St. Teresa mean by "active recollection"? She was familiar with what is called "discursive meditation." This form was promoted in the Dominican Luis de Granada's famous Book of Prayer and Meditation, which St. Teresa actually recommends in her con-stitutions. She herself, however, did not find this way of prayer suitable. About such works she wrote, "There are so many good books written by able persons for those who have methodical minds and for souls that are experienced and can concentrate within themselves that it would be a mistake if you pay attention to what I say about prayer" (19.1). But her own method is for those persons whose minds, like hers, are "wild horses" (19.2). How does St. Teresa deal with this mental rodeo in the context of prayer? She recommends .the Lord's Prayer. One would recite it phrase by phrase, slowly and attentively. In her view, vocal prayer does not exclude contemplation. She calls her method "active recollection." in this kind of prayer, she says, "the soul collects its faculties together and enters within itself to be with God" (28.4). This entails a centering of attention, plus awareness that God is near, fully with us at all times (29.5). We are to be fully present to God and to gaze upon him. Teresa uses the sight metaphor several times. It is not a matter of constructing arguments with concepts. She writes: "I'm not asking you now that you think about Him or that you draw out a lot of concepts or make long and subtle reflections with your intellect. I'm not asking you to do anything more than Review for Religio~ts look at Him" (26.3). She calls this a "method," and the one praying is required to make an "effort." This form of active prayer does not exclude contemplation, but promotes and may include it. From Teresa's experience she can affirm that this method disposes a person to the prayer of quiet (that is, a more passive kind) more readily and quickly than other methods. During this form of prayer, she writes, the soul will at times feel a passive quieting and be drawn gradually to a greater silence (30.7). For Teresa, the experience of passivity, that is, of contemplation in the proper sense, is not reserved to some final stage at the end of a long progression, nor is it reserved for spiritual experts. Is there a conceptual difference between the "prayer of quiet" and contemplation in the classic sense? St. Teresa refers to the former as "the beginning of pure contemplation" (30.7). But it still entails active recollection and may include vocal prayer. She insists that it is a mistake to believe that vocal prayer cannot go together with contemplation. There are no clear psychological gaps between vocal prayer, the prayer of quiet, and the beginning of contemplation. One fades into another as the felt need to initiate new effort yields to the sense of being moved by the impetus of the process one has already begun. This itself, of course, was begun as a response to the stimulus of grace, which in turn, as it emerges into consciousness, yields the awareness of being taken over completely by God. St. Alphonsus dealt specifically with the nature of the "prayer of quiet." According to his view, since in active recollection one's will is dominant, it will bring the imagination under control without any further effort on the part of the soul.8 There is, then, control, but it is the kind of control that follows the momentum of the earlier activity; there is no need for the further effort of making 63.2 2004 Jobnstone * Keeping a Balance new acts. This is a-form of quiet, but it is not completely passive. St. Alphonsus insists on some acts, those to which God is gently attracting us. The impetus of the divine initiative begins to emerge into consciousness, but this is not to say that the same initiative was absent before one's becoming conscious of it. The assumption that active and passive prayer are essentially different levels of prayer begins to appear as abstract theory that does not necessarily correspond to actual experience. For St. Teresa, the reason for active recollection is to become aware of Christ's presence. For example, we can be present to him in joy, being with him as risen. Here Teresa seems to imply reflection on the Gospel accounts. She has a theological support for this conviction: "Although risen, he still influences us through his earthly mysteries, by which he draws close to us in a more tangible way" (26.4,5,8). St. Alphonsus, as has been said, followed St. Teresa closely with respect to "active recollection." He is St. Alphonsus insists on some acts, those to which God is gently attracting us. perhaps more insistent than she is that the person at prayer continue to make acts. There may have been historical reasons for this emphasis, apart from A1- phonsus's own energetic personality. Pope Innocent XI in 1687 condemned the Quietists. This group taught, or is supposed to have taught, that making one intense act of love of God and never withdrawing it would assure union with God, and that no further effort was needed either in prayer or in living. It may be as a reaction against this that St. Alphonsus stresses the need for acts and more acts. Review for Religious However, while he emphasized the need for activity, it was certainly not his intention that the active contemplation become obsessively busy. Consider the following description of active recollection: "Without conscious effort, untroubled by external distractions, and totally absorbed within itself, experiencing at the same time a deep sense of serenity, the soul is able to concentrate on the mystery or the eternal truth in question.''9 These words would, on the whole, not sound alien to one familiar with Christian Meditation. But, to explain the differences between Christian Meditation and the active recollection of the Teresan tradition, a more detailed description of the former is needed. Christian Meditation John Main's account of Christian Meditation begins with an acknowledgment of the inveterate confusion of the human mind. While St. Teresa invoked the image of wild horses, John Main compares this condition of the mind of the would-be meditator to a "tree full on monkeys." Whether described in terms of horses or monkeys, the mental experiences are clearly similar. There is also a similarity in the way these two writers recommend that we deal with the problem. St. Teresa favors the Lord's Prayer; John Main also proposes a form of vocal prayer. The prayer he recommends is an attentive, mindful repetition of a phrase, a mantra. He recommends, in particular, Marana tha, an Aramaic expression which means "Our Lord, come." St. Paul ends his First Letter to the Corinthians with this invocation, and the Book of Revelation ends with the same prayer. The prayer is eminently Christian. For both St. Teresa and John Main, the aim of cultivating attention so as to make space for the experience of the presence of God is essentially the same. Main once wrote: 63.2 2004 Johnstone ¯ Keeping aBalance St. Thomas Aquinas says that "contemplation consists in the simple enjoyment of the truth." Simple enjoyment! Now it is true that thinking, analyzing, comparing, and contrasting all have their place in the various disciplines, including theology. But contemplation, as St. Thomas calls it, meditation as we would call it, is not the time for activity, for the activity of thinking, analyzing, comparing, or contrasting. Meditation is the time for being. Simple enjoyment. And the simplicity that St. Thomas speaks of, its oneness, union.1° Here no clear distinction is made between contemplation in St. Thomas's sense and meditation. The experience of oneness or union, however, seems to belong to contemplation in the classic sense, that is, something beyond active meditation; the soul is completely passive. For John Main, though, these distinctions do not seem to matter. There is a notable difference between the Weresan prayer of "active recollection," at least as understood by St. Alphonsus, and Christian Meditation. The first entails reflection on a "mystery" or "eternal truth," while the latter aims at a sense of union, without passing through the penetration of a "truth." In Christian Meditation, one does not concentrate, for example, on the meaning of the phrase "Lord, come," but repeats it as a way of focusing awareness on the presence of God. As we have seen, St. Teresa, and St. Alphonsus as well, would immediately affirm this goal. The point of difference is that they would include a concentration on a particular mystery or truth within the meditation itself. Truth in a more general sense, however, is intended as an element of Christian Meditation. John Main wrote: "Meditate every morning and every evening, faithfully, simply, and humbly. Contemplation consists in the simple enjoyment of truth.''11 This statement suggest two facets of the one event: the active meditation (that is, the Review for Religious repetition of the mantra) and the simple enjoyment that accompanies it. This is not all that different from St. Teresa's and St. Alphonsus's notion of "active recollection." Christian Meditation should not be misinterpreted. It is not antiintellectual or antitheological. It does not downplay the importance of truths. It merely leaves reflection on such truths outside of meditation itself. Indeed, within the movement there is available to meditators an extensive body of writing that offers ample reflection on the mysteries of faith. Because it is a popular movement, the reflection is generally not presented as systematic theology, but then neither are the reflections of St. Teresa or St. Alphonsus. I have noted above the particular place that St. Teresa gave to the resurrection; the same theme occurs frequently in the writings of John Main.~2 It would be a mistake to think that Christian Meditation plays down doctrine. Rather, we might say, it is presumed that study and reflection lead to a background awareness which, while not consciously evoked in the meditation itself, continues to support spiritual awareness. There can be no doubt that many people, growing numbers of them, have found Christian Meditation a most satisfactory way of prayer. Is there any compelling reason to choose between St. Teresa's more extensive use of words during meditation--in particular, the words of the Lord's Prayer--and the brief word recommended in Christian Meditation? There are many ways of praying, and people may be led by the Spirit along different paths. Some, perhaps because of different cultural backgrounds, have found the older approach rather too insistent on Christian Meditation is not antiintellectual or antitheological. 63.2 2004 Johnstone * Keeping aBalance repeated acts and a good many words. As I have noted previously, however, neither St. Teresa nor St. Alphonsus had in mind a multiplication of acts or a mechanical proliferation of words. For whatever reason, though, in our time the verbal austerity of Christian Meditation seems to appeal to many. The limited use of words, or even the deliberate renunciation of them, in Christian Meditation is connected to its nature as conceived by John Main. Spiritual authors in the past often spoke of "conversation" in their accounts of prayer. This conversation was to be a two-way affair, even if carefully structured. When God speaks, we listen attentively; when God does not speak, we engage actively in the conversation through acts of faith and love.~3 This "traditional" element John Main includes in his own words, although again with a significant modification: "Prayer is not a matter of talking to God, but of listening to him, of being with him. It is this simple understanding of prayer that lies behind John Cassian's advice that, if we want to pray, to listen, we must become quiet and still, reciting a short verse over and over again." ~4 Active Recollection and Contemplation At this point I move to a more theoretical discussion, but one with practical implications as well. The issue is the relationship between active recollection and contemplation. St. Teresa, from her own experience, taught that active recollection disposed to contemplation, but she also anticipated that contemplation itself might well arrive during the time of active recollection. The 4th-century monks of the Egyptian desert also expected that "higher" forms of prayer might suddenly break through more normal forms of meditation. During their periods of praying the psalms together, they were to curb their spitting, coughing, yawning, groaning, and Review for Religious similar noises. The only sound that was accepted was a spontaneous sigh of ecstasy.15 It was anticipated, apparently, that moments of "contemplation" would emerge within more ordinary prayer. St. Teresa seems to have had no difficulty in recognizing when such special moments occurred in her own prayer. For one whose spiritual sensibilities were as finely tuned as hers, there would probably be no reason to have any doubt about the presence of contemplation. What are we to think, then, of the advice of Arraj, mentioned by Larkin, that, until "express contemplation" is present, one should continue to make acts (of faith, love, and so forth)? The practical problem is how to know that such contemplation is present, and how certain we should be about it. To clarify the question, we could accept Karl Rahner's theological explanation, namely, that the experience of God in meditation, in human activity, or in classical spiritual doctrine's "infused contemplation" arises from the one same gift of God at work within us.16 Indeed this must be the case. To speak of "passive" contemplation as a pure gift must not be allowed to suggest that active recollection is not a gift, but somehow a product of our own efforts, before or apart from grace. We may say that recollection "disposes" us to the prayer of quiet, but we may not claim that recollection is the product of our initiative, which somehow, of its own power, engenders or earns the further state. "Pure," as applied to the gift of contemplation, does not imply that prayer such as active recollection is somehow impure, because contaminated with human activity. Nor can it be philosophically accurate to say that in "passive" prayer we are not active in any sense. The pure gift of God's grace cannot but raise us to the highest level of actuation. Our conscious experience may be one of pure passivity, but when God takes over completely our 63.2 2004 Johnstone ¯ Keeping a Balance The more intense the power of grace, the more we are fully active. 1-30J capacities are not simply extinguished. As is always the case with grace, the more intense the power of grace, the more we are fully active. The more God intervenes, the more empowered we become and the more free we are. Similarly, I would have difficulties with an explanation of infused contemplation according to which "the infused light and love go directly to the object without any return to the self.''17 In the "modern" philosophical era (that is, from the 16th century onwards), there has been a dissociation between subject and object)8 This seems to have been reflected in Catholic theo-logy, so that some traditions focus on the subject and others on the object. In these circumstances the interpretation of the spiritual experience involved here may tilt excessively towards the object. Perhaps such thoughts as these are ¯ improper philosophical intrusions on discourse about spirituality, but I would suggest that cutting or leaving the subject completely out of the picture is metaphysically impossible. Further, I would point out that what is interpreted as an absolute certainty of the presence of God, or of the state of "passivity," is a certainty on the part of the subject. When someone says "Whenever I experienced contemplative prayer, there was absolutely no doubt that I was in God's presence,"'9 we would need to add after "doubt" the words "in my mind." Without this qualification the interpretation veers too far towards the subjective. Such a state of consciousness is not a proof that God is present, or that the pure gift of prayer of quiet has in fact been granted. We cannot know definitively whether we have reached this "stage" or not. Review for Religious Such certainty as we have rests ultimately on the certainty of our faith, not on the felt quality of our experiences. This is not to return to a theory in which grace is beyond experience. We may indeed experience grace. But our conscious certainty cannot establish that grace is in fact present. What I am suggesting here is that the traditional language used in speaking of contemplation, meditation, and levels of prayer has problems. At least part of the difficulty with the older formulations is that they presupposed a rigid distinction between "natural" and "supernatural," and hence between "acquired" (or natural) contemplation and "infused" (or supernatural) contemplation. "Natural" meant what we do; "supernatural" meant what God does. Such a sharp distinction is understandable when we recall the theological disputes of the time (especially the controversies about grace), but we would express that difference somewhat more flexibly today. Perhaps we could say that it was and is a mistake to reify the various categories of prayer which the classic authors have named for us. Probably it was not so much these authors themselves, but the theological commentators who interpreted them, who made the mistake. To reify would mean to consider the distinct kinds of prayer as if they were things like quantitative blocks of consciousness that we could, as it were, line up one after another on a conveyor belt and then run the belt through our minds. Following on this thought, we might suggest that saying the petitions of the Lord's Prayer, as St. Teresa did, or repeating.the mantra, as John Main did, can dispose us to quiet and contemplation. But it is not necessary to turn them off, as it were, so that we can really appreciate the quiet. If we do so, the wild horses of our disordered minds are likely to gallop back again, or the screeching monkeys may well return to the 63.2 2004 Johnstone ¯ Keeping a Balance thickets of our consciousness, and quiet would be no more. In these reflections I am suggesting that the classic fixed distinctions between different forms of prayer may not be so important as they .were once thought to be. I suggest that it would not make a great deal of sense to say to oneself, "I have not yet arrived at the experience of passivity and received the pure gift of contemplation, and so I must continue with active prayer." Nor would the reverse be any better, namely, to convince oneself that one has indeed been given this gift and so to drop active prayer. The best solution, I suggest, would be to accept with St. Teresa (and St. Alphonsus) that some form of active, vocal prayer may quite well go together with contemplation. At root this is what John Main believed: the repetition of the mantra may accompany contemplation. We do not need to be scrutinizing our consciousness so as to find whether contemplation has occurred or not. The prayer of quiet, or gift of contemplation, may be given by God at any moment within that active prayer. We need not be surprised if this happens, and we may welcome it if or when it is given to us. To conclude, the form of meditation in which one repeats a short prayer continuously with the expectation that a prayer of quiet (with a sense of oneness and rest) may supervene has strong roots in the Catholic spiritual tradition. This is true not only of the earlier tradition, where we find Cassian commending this practice, but also of the more recent tradition, as expressed in particular by St. Teresa. The description of prayer in the texts on Christian Meditation does not include a description of contemplation in the classic sense, but who are we to say that the latter may not supervene? It is indeed God's gift--and may be given whenever God chooses to do so. Notes t Ernest E. Larkin OCarm, "Today's Contemplative Prayer Forms," Review for Religious 57 (1998): 83. Review for Religious 2 Larkin, p. 84. 3 Cited in Larkin, p. 78. 4 Larkin, p. 87 n. 12. 5 The Way of Perfection, in Vol. 2 of The Collected Works of St. Teresa of Avila, trans. Kieran Kavanaugh OCD and Otilio Rodriguez OCD (Washington, D.C.: ICS Publications, 1980). p. 140. The relevant passages are chaps. 28-29. Hereafter all references to Teresa will be to this work and edition, by chapter and section(s) given in the text thus: (19.1). 6 Larkin, p. 83. 7 Alpbonsus de Liguori: Selected Writings (Mahwah: Paulist Press, 1999), p. 170. The putting together of this "active" recollection with "contemplative repose" may seem perplexing. The essential point is that it still involves acting, as distinct from "infused contemplation," where there is no acting on our part. s Alpbonsus, p. 176, citing St. Teresa. 9 Alpbonsus, p. 170. ~0 John Main, The Inner Christ (London: Darton, Longman, and Todd, 1987), p. 203. " Main, p. 205. ~2 Main, pp. 116, 119, 132. '3illpbonscts, p. 171. ,4 Main, p. 22. ,5 Owen Chadwick, John Cassian (Cambridge: Cambridge University Press, 1950), p. 69. ~6 Larkin, p. 81. ~7 1 refer here to the citation from Max Huot de Longchamp, Saint Jean de la Croix: Pour Lire le Docteur Mystique (Paris: Fac-editions, 1991), p. 164, cited by Larkin, p. 87. ~8 See Charles Taylor, The Sources of the Self: The Making of the Modern Identity (Cambridge: Harva~:d University Press, 1989), p. 188. ,9 Larkin, p. 78. 63.2 2004 DENNIS J. BILLY Faith Seeking Understanding: Spiritual Direction's Sapiential Function ~;l~you are a theologian, you will pray in truth; and you pray in truth, you are a theologian." 1 These words of Nilus of Sinai (+450), a 5th-century monk from Ancyra in Asia Minor who lived in the wilderness of Sinai for more than sixty years, remind us of the inti-mate connection between conversing with and under-standing the mystery of God. A true knowledge of God involves an experience of the divine mystery, not simply knowledge about it. Such experiential knowledge comes, not through rational analysis, but from a living rela-tionship with God nourished by prayer. This under-standing of theology emphasizes knowing God by participating in the intimate community of divine love. It values the living reality of God over theological constructions of that reality. That reality is closer to us than we are to our own selveS. We are invited to be pre-sent to God's pr.esence in us. Spiritual direction can help us become present to this reality. It is a divine (but also human) art that helps us "pray in truth" and come to an intimate personal knowledge of God. ._~,, ~ ~,~4_J 2D45e8n;n iRs oJm. Bai l0ly0 1C0S0S; RIt awlyri.tes again from Accademia Alfonsiana; C.P. Review for Religious Praying in Truth The theologian, in Nilus's eyes, is one who knows how to "pray in truth." To do so, we must strip off the old self and put on the new. Only then, by being renewed in the image of our Creator, will we gradually progress toward true knowledge of the divine (see Col 3:9-10). To pray in truth is to pray in Christ, the way, the truth, and the life (see Jn 14:6). Praying in truth means open-ing our hearts and being present to God as we really are. It means not being afraid to look inside ourselves and confront the various masks and self-deceptions we find there. It means bearing our souls to God so that God may bear his soul to us. Intimacy with God first requires intimacy with oneself. We cannot communicate with God in truth if we are unwilling to know the truth about ourselves. Coming to an intimate knowledge of ourselves, how-ever, is no easy task. Most of us cannot go it alone and are in dire need of help. We find facing our inner wants and insecurities much too threatening. Left to our own resources, many of us would end up rationalizing away our fears and discounting our deepest hopes about who we are and want to become. Spiritual direction helps us confront ourselves and open our hearts to God. It gently points out the voice of the Spirit manifested in the nitty-gritty circumstances of our lives. As the prophet Elijah reminds us, often that voice is found, not in whirlwinds, earthquakes, and fires about us, but in the small whisper that can only be heard in the solitude of our hearts (see 1 Kg 19:11-13). Spiritual direction seeks to settle our hearts so that we can rest in this solitude and become ourselves in our faith? Focusing on our conscious and unconscious inter-action with the divine, it helps us to follow the flow of troublesome and often conflicting personal narratives in our life and then to make responsible iudgments about 63.2 2004 Billy * Faith Seeking Understanding what we are being called to. It pays special heed to our prayer life, helping us to discern authentic prayer from its mean and paltry imitation. The goal of spiritual direction is for us to "pray in truth." We receive help to confront ourselves and thereby to discover our authentic voice. That voice alone will lead us to intimacy with God. We must be patient, how-ever, and ever so silent. We must listen to our heart and not be afraid to hear what it has to say. When we speak from the heart, we soon discover the gentle voice of the Spirit yearning within us. To pray in truth is to pray in the Spirit, the re-creative presence of God that hovers over and revives the primal forces within us. We know we are praying in the Spirit when our lives manifest the Spirit's various gifts and fruits (see Is 11:2-3, Ga 5:22-23). Spiritual direction helps identify these spiritual riches and let them do their quiet work within us, the work of gradual divinization, of greater sharing in the eternal love of the Godhead. Solitude of Heart The primary means by which the Spirit accomplishes its task is by nurturing in us a deep desire for solitude. As we empty our hearts of unnecessary attachments, we make room for the divine indwelling. Solitude of heart is the precondition for our experience of the fullness of life. "The glory of God," says Irenaeus of Lyons, "is a liv-ing human being."3 We who are created in the image and likeness of God become ourselves only by allowing God to be himself in us. Spiritual direction helps us open our hearts to the heart of God. It helps us by fostering a contemplative attitude toward life, enabling us to see all that happens in the light of God's providential plan. By offering their directees the hospitality of a lis-tening heart, directors set the tone for all that happens during the session. By being present in silence and with Review for Religious their full attention, directors affirm the seriousness of what is taking place and often form lasting friendships. These bonds spring from their reflective gaze upon the directees' unfolding experiences, from this sharing in their solitude. Three persons share in this solitude of heart: the director, the directee, and the Holy Spirit. In direction, directors and directees gradually turn their attention to this quiet partner in their midst. They discern the signs of the Spirit in the nar-ratives that directees share with their direc-tors. The Spirit leaves traces of its presence in the threads of people's lives. When we look at our lives prayerfully, these slight vestiges gradually become noticed and fit into conscious awareness. This is the time for directors and directees together to interpret these signs so that the directees can respond appropriately. One of these signs is peace. After his resurrection Jesus comforted his disciples with a message of peace that stemmed from his immediate and unquestioning trust in the Father's love (see Lk 24:36, Jn 20:19, 21). Today this same message comes to us through the yearn-ing of the Spirit in our hearts, who intercedes for us to the Lord with unutterable groaning (see Rm 8:26). Directors help their directees to recognize the factors in their life that contribute to peace. Such peace comes not from the world, but by giving ourselves whole-heartedly to the one thing that ultimately matters--the love of God dwelling in our heart. "The paradise of God," says Alphonsus de Liguori, "is the heart of man.''4 The peace of Christ works its The primary means by which the Spirit accomplishes its task is by nurturing in us a deep desire for solitude. Billy ¯ Faith Seeking Understanding way outward from within. Rooted in the love of the Lord, it eventually finds outward expression in our striv-ing to form right relationships with others on every level of human society (such as family, country, community of nations). Peace, "the tranquillity of order" as Augustine of Hippo refers to it, possesses personal, com-munal, and transcendent dimensions.5 For us to find it in our lives, solitude of heart is necessary. Spiritual direc-tion, in turn, is an important instrument given us by God to help in that discovery. Faith Seeking Understanding If theologians are persons who pray in truth, spiritual direction facilitates such prayer. Theology, we are told, "denotes. far more than the learning about God and religious doctrine acquired through academic study. It signifies active and conscious participation in or percep-tion of the realities of the divine world--in other words, the realization of spiritual knowledge.''6 To be even more specific, theology has to do with our attempt to reflect upon our experience of the indwelling of the Trinity in our hearts. When seen in this light, the classical Western understanding of theology as "faith seeking understand-ing" (tides quaerens intellectum)--which was developed by Anselm of Canterbury under the influence of the Latin Vulgate and Augustine of Hippo--needs to be rescued from the overrationalizing of later centuries and exam-ined in relation to acquiring Christian wisdom.7 When understood as a sapiential (as opposed to a narrowly ratio-nal) enterprise, theology's true task comes to the fore. All of us are called to reflect upon the meaning of our lives in the light of the gospel message. To accom-plish this task well, we must reflect on the experience of God in our hearts and try to ascertain what exactly is being asked of us. When understood sapientially, theol-ogy as "faith seeking understanding" tries to discern the Review for Religious movement of the Spirit in our lives so that we can bet-ter understand how to live out our call to discipleship in mature and responsible ways. Spiritual direction is an important place for acquiring spiritual wisdom. It helps us talk to God, listen to him, and engage in discernment that leads to deeper intimacy with him. Spiritual direction achieves this goal whenever there is an honest, sharing relationship between the two per-sons. This relationship, while complex and manifold, focuses primarily on the relationship of the directee with God. Directors help directees to understand their inter-action with God better and then to draw closer to God. This process is both challenging and consoling. Directors challenge directees to be honest and to identify areas for future growth. They also need to comfort directees in times of discouragement and imminent loss. Knowing when to exercise this dual role of challenge and comfort is one of the primary skills that directors need to have. Faith seeking understanding in spiritual direction calls for directors to have flexibility and strength. They need to adapt to changing times and circumstances and to withstand the adverse challenges that may occur. The fruits of the process become evident. To believe as one searches for meaning in life leads to a deeper under-standing of one's life situation, of one's relationship with oneself, with others, and with God. Spiritual direction, in its many forms, seeks to empower us to affirm our faith and in the process become ourselves more fully. Becoming Holy Becoming ourselves in our faith is but another way of speaking about our desire for holiness. Spiritual direction is not simply a matter of gaining greater insight into our relationship with God. It has very much to do with turn-ing those insights into concrete practices that lead fur-ther along the path of conversion. These practices must 63.2 2004 Billy ¯ Faitb Seeking Understanding Becoming ourselves in our faith is but another way of speaking about our desire for holiness. not be imposed from without; they must arise from within. They must correspond to a true assessment of our needs based on insights that spiritual direction has facilitated. A truly wise person is also a holy person, and vice versa. According to Thomas Aquinas, wisdom is the gift of the Spirit that corresponds to and is guided by and is a perfec-tion of charity.8 The sapi-ential function of spiritual direction leads us beyond simply knowing God to loving and serving him. "Faith seeking understand-ing" through spiritual direction leads not only to insights into divine things, but also to incorporating those insights into the way we live our daily lives. This close relationship between "being" and "action" is important for the sapiential function of spiritual direc-tion. The virtuous actions performed by people striving to be virtuous contribute to making them even more vir-tuous. When directees ask their director what they should do, they are ultimately asking about what kind of person they themselves wish to become. When prop-erly exercised, spiritual direction helps people see this important connection and encourages them to make "communion with God" the motivating force of all of their actions. Living in communion with God is another term for becoming holy. It is a primary concern of the direction process, helping people become themselves in their life of faith. As an element of "faith seeking understanding," spir-itual direction seeks to help us not only to discern but also to act. By far the most important thing any of us can ever do is pray. Prayer is "the great means of salva- Review for Religious tion.''9 Our manner of prayer--its frequency, its form, its content--is and should always remain a vital subject in spiritual direction. During direction we need to ask if our prayer addresses every dimension of our human makeup: the physical, emotional, intellectual, social, and spiritual.~° With the help of our director, we should try to identify what we may be neglecting in prayer and make appropriate changes. How we pray says a great deal about our own self-understanding and our rela-tionship with God. By examining our prayer carefully for ways to improve it, we demonstrate our love for God and our longing for holiness. Spiritual direction helps us to understand and prac-tice true prayer. It accompanies us on the way to self-knowledge and invites us to deeper intimacy with God. Such experiential knowledge transcends the conceptual world of the professional theologian. By it we share consciously in God's love and develop an intuitive aware-ness of the mind of God. By helping us to "pray in truth," spiritual direction assists our understanding and enables us to become ourselves in our faith, to live in the Spirit, to grow in wisdom and in the knowledge of God, to grow in charity throughout our lives. By help-ing us listen to the movement of the Spirit in our hearts and respond wisely and generously, spiritual direction enables us to see the world around us with something of God's zealous compassion, God's .intense longing to dwell in the hearts of us all. Notes 1 Nilus of Sinai, IY3 Texts on Prayer, no. 61 in Early Fathers from the Philokalia, trans. E. Kadloubovsky and G.E.H. Palmer (London: Faber and Faber, 1954), p. 134. 2 See Jean Laplace, The Direction of Conscience, trans. John C. Guinness (New York: Herder and Herder, 1967), p. 26. 3 Irenaeus of Lyons, Against the Heresies 4.20.7, in Vol. 1 of The Ante-Nicene Fathers, ed. Alexander Roberts and James Donaldson (New York: Charles Scribner's Sons, 1925), p. 490. 63.2 2004 Billy * Faith Seeking Understanding 4 Alphonsus de Liguori, The Way to Converse Always and Familiarly with God, in Vol. 2 of The Complete Works of Saint Alphonsus de Liguori, ed. Eugene Grimm (Brooklyn: Redemptorist Fathers, 1926), p. 395. s Augustine of Hippo, The City of God 19.13, in Vol. 2 of The Nicene and Post-Nicene Fathers, ed. Philip Schaff (New York: Charles Scribner's Sons, 1903), pp. 409-410. 6 The Philokalia: The Complete Text, ed. and trans. G.E.H. Palmer, Philip Sherrard, and Kallistos Ware (London: Faber and Faber, 1981), Vol. 2, p. 389. 7 See Anselm of Canterbury, The Proslogion, chap. 1, in Vol. 1 of Anselm of Canterbury, ed. and trans. Jasper Hopkins and Herbert W. Richardson (Toronto and New York: Edwin Mellen Press, 1974), pp. 91-93; Biblia sacra vulgata, ed. Robert Weber (Stuttgart: Wiirttembergische Bibelanstalt, 1969), Vol. 2, p. 1103 (Is 7:9); Augustine of Hippo, On the Trinity 8.5.8, in Vol. 3 of The Nicene and Post-Nicene Fathers, ed. Philip Schaff (New York: Charles Scribner's Sons, 1900), pp. 119-120. ~ See Thomas Aquinas, Summa theologiae, I-II, q.68, a.8; II-II, q.45, in Vol. 20 of Great Books of the Western World, ed. Robert Maynard Hutchins (Chicago: Encyclopaedia Britannica, 1952), pp. 95-96, 598- 606. 9 Alphonsus de Liguori, Prayer, The Great Means of Salvation, in Vol. 3 of Complete Works (1927), p. 23. 10 See Dennis J. Billy, Evangelical Kernels: A Theological Spirituality of the Religious Life (Staten Island: Alba House, 1993), pp. 167-184. Gift I am stunned by the gift you gave me. Not a sun or stars, not the sea or a pebble rounded to perfection. Not even forgiveness, although this was wrapped into the gift. You gave me love. Some day I may regard your gift indifferently, as something I deserve. For now, I know nothing but astonishment. Patricia Chaffee OP Review for Religious GEORGE ASCHENBRENNER Windows of the Soul: Walter Ciszek SJ T e eyes are often windows into the soul. A mother ows this as she gazes quietly into the eyes of her newborn child, dreaming and hoping about its future. Lovers and friends know this too. Gazing into each other's eyes opens a whole world, wide and deep beyond words. Most of us are unaware of how revelatory our eyes are. The grumpiness of discontented people lurks in their eyes for anyone to see. So, too, the limpid kindness of truly guileless people sparkles in their eyes. Yes, in many instances our eyes are windows into the soul. In fact, our eyes convey more and deeper messages as we grow through life. Forty years ago,. on 12 October 1963, BOAC flight #501 from London landed right on time at 6:55 a.m. A man in his late fifties wearing a heavy green overcoat shuffled down the stairway from the plane. A big floppy Russian hat concealed a lot of his face. But, under the brim of that hat, like beacons of a profoundly wise soul, George Aschenbrenner SJ has written for this journal every couple of years since 1966. His current address is Campion Hall; University of Scranton; Scranton, Pennsylvania 18510. r~l!4~a --- ~ 63.2 2004 Ascbenbrenner ¯ Windows of rise Soul two lively grayish-blue eyes greeted sights not seen for twenty-seven years. At least ten years before, his Jesuit brothers in the New York Province had offered for him the customary two Masses for deceased Jesuits. Now Father Walter Ciszek of the Society of Jesus had risen from the dead. Those dancing guileless eyes, those soul-beacons, told a stoW immediately that it would take years to get into words: two books written painstakingly with the gracious competent help of Father Dan Flaherty, a brother Jesuit. But, if you ever had the chance to meet Father Ciszek, you got the whole stoW in those eyes. My experience of Walter was that those lively eyes, those bottomless wells of love, joy, and humble confidence, conveyed more than any hand gestures ever could. Dramatic gesturing was not his way of communicating. Like a diamond those eyes sparkled with a wisdom, a peace, a humble confidence, but first and foremost a startling freedom. On that October day at New York's Idlewild airport, Father Walter was free, free from KGB surveillance, free from restriction on his priestly min-istry, free from the brittle cold, free from his starvation diet, free from the threat of death at almost any moment. But freedom was something he had known truly and profoundly for the last twenty-one years--ever since that time in the dreaded Lubianka prison, a time that marked his soul for the rest of his life, a time that he would never forget. (It was a soul-changing experience, too, for oth-ers when they met him: something smiled in and leapt out of those eyes to greet you.) Early in his captivity, solitary confinement and intense interrogations night and day were wearing him down. Knowing he was not guilty of the espionage charges, he thought that all he had to do was explain this clearly and definitely to his questioners. But a combination of forces--first the repeated questionings like a pile driver hammering into Review for Religious his head and heart and then the cold deaf ear to his labored and elaborately explicit defense--became too much for him. He gave up. He quit. He signed an admis-sion of his guilt--just to get it over with. Back in his cell, however, and all by himself again, it hit him. He had given in to free himself of this harass-ment of his soul. His motive had been selfish, filled with ego, and had lost much awareness of God's love and care. He felt ashamed and confounded. In that disheartened state of mind, though, he felt relief that, during the fif-teen years of hard labor in Siberia to which he had been sentenced, at least the solitary confinement and the mad-dening questions would stop. This relief was short-lived. Soon he was told that there would be four more years at Lubianka to "clarify" some of the issues to which he had confessed. The deaf-ening, soul-splitting interrogation began again. It seemed more than he could handle. What he had hoped to get out of by signing the paper was beginning all over again. An overwhelming despair descended upon him, a loss of hope and faith. He felt absolutely helpless. He was at rock bottom. You and I have sometimes felt helpless; we know that even brief moments of helplessness are fear-some. But most of us have never plumbed the depths to which he fell at that moment, all alone, in Lubianka. But, at this moment of feeling bankruptcy of soul, at this lowest point in his whole life, something happened. He stepped across a boundary line. No, to be more exact, he did not step across: he was lifted across. In that moment of despair, he remembered an olive grove some two thousand years ago. Jesus, Son of Mary and Son of God, having chosen to be faithful to his identity and mis-sion in the face of looming certain death, had collapsed in helplessness, had hit rock bottom (Mk 14:32-42). Through his surrender, through his self-abandon-ment, Jesus was rescued, he was freed. The impending 63.2 20O4 Aschenbrenner * Windows of the Soul Walter Ciszek's contemplation of Jesus" agony in the garden gave new meaning to his own despairing helplessness. horrific suffering and death were not taken away, but something shifted deep inside. A freedom, a humble con-fidence, lifted his soul because the eyes of a dearly loving, caring Father were still gazing on him, even in his utter helplessness. In fact, now he knew it in some new way: no depth of helplessness could ever be beyond the loving, life-giving gaze of those eyes. Those eyes, there in Gethsemane, both looked deep into his soul and also revealed a bottomless love and care deeper than any doubt or frustration. Walter Ciszek's contemplation of Jesus' agony in the garden--a prayer that just came upon him, he did not reach out for it--gave new meaning to his own despair-ing helplessness. As in the case of Jesus, Father Ciszek's fear was transformed into freedom, and his feelings of danger and despair became confidence and happiness. Now nothing seemed to worry or trouble him anymore. At an apparent depth of no return, he had learned that God would never leave him, but would take care of him even if he were killed. Astonishing, simply amazingm talk about a new heart and a new freedom! He could say with St. Paul: "I am ready for anything through the strength of the One who lives within me" (Ph 4:13). That prayer along with Jesus in the garden marked Walter Ciszek for life right into eternity. He would never forget that prayer. Yes, Walter Ciszek became profoundly free in Lubianka twenty-one years before he stepped off a plane in the United States. The Word of God had leapt off the page anew in the person, the presence, the eyes of the Review for Religious risen Jesus. Now nothing he did, nowhere he was taken, nothing that happened to him, absolutely nothing could separate Walter Ciszek from the risen Jesus. In his own agony of despair and helplessness, he had been gifted with a very special awareness of God's love. This gave him an invincible trust, whatever the future might hold. Nothing could really hurt him now because he was in God's loving hands, more than he had ever realized before. Yes, the eyes are windows into the soul. But the eyes of holiness are also reflectors. Holiness reflects the radi-ance of Someone Else's loving eyes. Just as Jesus knew the gaze of a dear Father's eyes, Walter Ciszek experi-enced God's loving gaze in the depths of his despair and helplessness. That same loving gaze blesses us all, each and every one, with a freedom and a trust that does not take all suffering out of our lives, but does enliven our hearts, our souls, and our eyes. It is no surprise that, whenever my friends and I met Father Ciszek, we felt we were meeting more than just that courageous, peaceful little man. Those lively, gray-ish- blue, dancing eyes were windows glistening with the wisdom, the freedom, the love of his soul. Those eyes mirrored the steady gaze of Jesus' love--a love that moti-vated everything Walter Ciszek did, a love that got him through fifteen years of undeserved hard labor in prison and five years of undeserved solitary confinement, a love that burned in his soul and left him unscarred by bitter-ness, anger, revenge. The eyes of Walter Ciszek told the story of his soul, a story of courageous love in incredible suffering and of invincible trust against all odds, because the most impor-tant story of love always glistens in the eyes of the risen Jesus. 6~.2 2004 mentoring FRED HERRON Merton and a Spirituality for Millennials Young people who grew up in the late 20th cen-tury, sometimes called millennials, easily relate to Thomas Merton as someone not entirely comfortable in any one place. Like him, they find it hard to root themselves in one "abiding place.''1 They are more comfortable describing themselves as "spiritual" rather than "religious." For them the paradigm shift that Merton illu-minated in his lifetime seems a dramatic release from the moorings of the stable past and an optimistic embarkation on a journey. By high-lighting such a change in his life and thought, Merton managed to offer direction and some cautions to those who would follow. Dwelling and Seeking Robert Wuthnow has argued convincingly that a major change took place in the spiritual Fred Herron is chairperson of the religious-studies depart-ment at Fontbonne Hall Academy and a member of the Department of Theology and Religious Studies at St. John's University, Staten Island. He may be addressed at Fonthonne Hall Academy; 9901 Shore Road; Brooklyn, New York 11209. Review.for Religious practice of the last half of the 20th century. He suggests that "a traditional spirituality of inhabiting sacred places has given way to a new spirituality of seeking." He con-trasts these two viewpoints this way: "A spirituality of dwelling emphasizes habitation: God occupies a definite place in the universe and creates a sacred space in which humans too can dwell." On the other hand, "a spiritual-ity of seeking emphasizes negotiation: individuals search for sacred moments that reinforce their conviction that the divine exists, but these moments are fleeting.''z Both forms of spirituality have found their place in the history of religions, and the world religions have sup-plied rich imagery for both. Wuthnow points out that, "in settled times, people have been able to create a sacred habitat and to practice habitual forms of spirituality. [However,] in unsettled times, they have been forced to negotiate with themselves and with each other to find the sacred." Settled times evoke an imagery of dwelling, and unsettled times one of journeys. In the former, "the sacred is fixed, and spirituality can be found within the gathered body of God's people; in the latter, the sacred is fluid, portable, and spirituality must be pursued with a sense of God's people having been dispersed.''3 A habitation spirituality is suggested by the Garden of Eden and a land of milk and honey. A spirituality of seeking, on the other hand, is illustrated by the taber-nacle and the tents of pilgrims and travelers. The first form can be seen in the secure routine of the monastery, the cloister, while the latter is seen as an ongoing journey. The story of the Shulamite woman draws the dis-tinction between these two spiritualities. At first she revels in the security of her spiritual home: "Our bed is green, the beams of our houses are cedar, and the rafters of fir" (Sg 1:16-17). Later, however, she wanders, seek-ing the warmth she has lost: "I will rise now., and go 63.2 2004 Herron ¯ Mertion and a Spirituality for Millennials about the city. In the streets and in the squares, I will seek the one I love" (Sg 3:2). Merton's metaphors of the "citadel" and of the "wide, impregnable country" point to similar visions.4 Note that both are images of security, but the former suggests secu-rity and the latter.openness and freedom. In the citadel there is isolation from others, whereas in the wide coun-try there is room for an indefinite number of people seeking God. A spirituality of dwelling seems to be more secure, while a spirituality of seeking seems less constraining. Both offer freedom, but quite different kinds of free-dom. Familiar places offer the freedom of not having to worry where the next meal is coming from, since both caring people and known resources are available. Anne Truitt describes this experience as "the lighthearted feel-ing of being in a litter of kittens.''5 That understanding of freedom is comparable to not worrying about achiev-ing any particular objective, that is, not feeling "bound by an inexorable result [but being] like the birds or lilies ¯. without care." 6 Seeking and Freedom The fifth volume of Thomas Merton's letters, VVitness to Freedom, suggests that there are three stages in his understanding of the growing freedom that is central to a spirituality of seeking.7 In Merton's youth, freedom meant doing whatever he pleased. The second stage came with his entrance into the monastery of Gethsemani in 1941. Merton recalls that, when Brother Matthew met him at the monastery gate, led him through that gate, and then locked it, "I was enclosed in the four walls of my new freedom." s This was the freedom of the citadel, the freedom to do what he was told and to keep the rules. Freedom here became obedience, one portion of the monastic Rule. Review for Religious Keeping the rules is central to both of these stages. In the first, the rules are the problem. In the second, the rules are the solution to the problem. The third stage led Merton to view freedom in a very different light: freedom as an inner reality guided much more from within than from without. In con-templation, Merton realized, we meet God, and in meeting God we discover our deepest freedom. People achieve this third level of freedom, a sense in which their deepest selves are in God and express God, to the extent that they rid themselves of the illu-sions that distort reality for them.9 Merton wrote to Jacques Maritain of these illusions: "There are great illusions to be got ridden of, and there is a false self that has to be taken off. There is still much to be changed before I will really be living in the truth and in nothingness and in humility and without any more self-concern." 10 The road to true freedom is strewn with idols: the false god, the false self, and the false image of God's crea-tures. A false vision of God causes us to see God as one among many, not as absolute, the Hidden Ground of Love, from whom all things come and in whom all things are sustained.ll From this arises the false self, for, instead of being an image of the true God, the self tends to become an image of the false god. Finally, to be fully free, we need to be liberated from the illusions that mark our relationships with other human beings and with the rest of God's creation. What, then, is the freedom that Thomas Merton con-siders essential to this spirituality of seeking? It is the freedom to choose the good and not to choose "freely" In contemplation, Merton realized, we meet God, and in meeting God we discover our deepest freedom. 63.2 2004 Herron ¯ Merton and a Spirituality for Millennials between two realities such as good and evil. Merton argues that "the free man is the one whose choices have given him the power to stand on his own feet and deter-mine his own life according to the higher light and spirit that are in him.''12 He says: "The mere ability to choose between good and evil is the lowest limit of freedom, and the only thing that is free about it is the fact that we can still choose good. To the extent that you are free to choose evil, you are not free. An evil choice destroys freedom . Perfect spiritual freedom is a total inabil-ity to make any evil choice." 13 St. Benedict's Rule and the Spirituality of Seeking The contrast between a spirituality of habitation and a spirituality of seeking is evident in the 6th-century Rule of St. Benedict. The Cistercian monk takes three vows: stability, obedience, and conversatio. Stability emphasizes setdedness, a "permanent and lifelong attach-ment to the monastery of one's profession." 14 Conversatio connotes the changeable life of the spirit. It is "a com-mitment to live faithfully in unsettled times and to keep one's life sufficiently unsettled to respond to the chang-ing voice of God." ~5 It involves a commitment to con-stant progress in virtue. The monk can never say that he has done enough. It is "the vow to respond totally and integrally to the word of Christ, 'Come, follow me,' by renouncing all that might impede one in following him untrammeled, all that might obscure one's clarity of intent and confuse one's resolve."16 As such, it is a source of peace. Peace comes when there is a "willingness to renounce our petty selves and find our true selves beyond ourselves in others, and above all in Christ." 17 Obedience here suggests a commitment to both sta-bility and conversatio. This is an obedience to God in all things. The monk uses this obedience as a means to grow closer to God. It is the obedience of faith in the context Review for Religious of love and discipleship. The wisdom of St. Bernard is that dwelling and seeking, stability and conversatio, are both part of what it means to be human.18 The desire for a dwelling, for a citadel or fortress of solitude, is evi-dent in the fact that people associate God with churches, synagogues, and temples. It is intimated by the feelings that are aroused by memories of the house in which we were raised or by the uprooting we feel when we need to move. A human habitat takes on sacred meaning, becom-ing a home that has a "heart and a soul," an abode that can be lived in with grace and in "the power of bene-dictions." 19 Merton spoke about Gethsemani, especially in his early years there, as a "sign of Christ.''2° Thomas Merton and a Generation of Seekers Americans live in increasingly complex and perilous times. We face conditions that appear to be spinning wildly out of control--terrorism, environmental pollu-tion, worldwide hunger and poverty, AIDS, crime. A spir-ituality of dwelling may appeal to many people, especially when reli-gious leaders promise secure space in which to worship God in famil-iar ways. For some, the purpose of any congre-gation will be to pro-vide a haven amidst the uncertainties of modern times. A spirituality of seeking, however, will appeal to more of the American people, precisely because it lets them choose their own understandings and their own ways of worshiping. For them, the believing community is less a haven than a supplier of spiritual goods and services. Neither style is entirely satisfactory. Both arise out of our conversation with our past. While earlier genera- The believing community is less a haven than a supplier of spiritual goods and services. 63.2 2004 Herron ¯ Merton and a Spirituality for Millennials tions found some peace and security in a spirituality of inhabiting, later ones take pride in being on a spiritual journey. This shift has roots in our immigrant history.21 Until the beginning of World War II, when Thomas Merton entered the monastery at Gethsemani, ethnic groups were still influenced largely by their immigrant experience. They had come looking for a better life. Together they built institutions. They came in search of both physical and spiritual homes. After the war they worked feverishly at the task of building new houses. Levittown came to symbolize that desire, and the Cold War represented a threat to that dream. The decade of the 1950s was to be an ending as well as a beginning in that regard. The world has changed substantially since the pres-idency of Dwight Eisenhower. Change has become a general condition of every part of modern life. The 1950s gave way to an era of racial unrest, political turmoil, and environmental havoc. The children of the 1960s seemed out of control and all too willing to question authority. That changing world is the world that Thomas Merton inhabited and somewhat came to personify. But the later Merton was firmly rooted in the earlier one. That is, his willingness to stand on his own two feet was not the mark of a radical individualist undertaking a ruggedly individualistic spiritual journey. Rather, it was the mark of a "free" human being dedicated to living faithfully in unsettled times as a person firmly in "one dear perpetual place." Stability, for Merton, was rooted in his relationship to his monastic family and his work within the monastery. It was the dedication of one who had come to grips with the allure of worldliness and won, leaving it behind in search of greener pastures. Merton was not claiming an "abiding place," for the Spirit of God did not let him put a mere place above the call of fidelity. His commitment was not simply to a commu- Review for Religious nity, but ultimately to the God who told him, "Come, follow me." A portion of Merton's enduring legacy to the mil-lennial generation rests precisely in his understanding of the Rule of St. Benedict. He cautions the next gener-ation about undertaking a journey for its own sake or in search of illusory goals. Better to live firmly in a com-munity that demands your constant focus on growth. If that involves a journey, so be it. But the journey, the "road trip," is not an end in itself. It needs to serve a greater truth. The challenge of conversatio for today's young people is to be constantly open to going where God takes them and not where the illusory goals of a consumer culture or a warrior culture might lead them. The call of obedience is to cling tightly to God and to the gift of true discipleship. Like the gyre that William Butler Yeats describes in his poem "The Second Coming," Merton struggled in his personal life and on his spiritual journey to find a way for the center to hold, to find a way toward some form of final integration[ The point where stability and conversatio meet was, for him, in obedience. Obedience holds both together, insisting that both are essentials in the spiritual life. Merton not only illuminates the dra-matic upheavals of our recent past, but points a way to our future. Notes ~ Dean Hoge, William Dinges, Mary Johnson SNDdeN, and Juan Gonzales, Young Adult Catholics: Religion in the Culture of Choice (Notre Dame: University of Notre Dame Press, 2001); James L. Heft SM and James D. Davidson, "The Mission of Catholic High School and Today's Millennials: Three Suggestions," Catholic Education 6 (June 2003): 410-422; T.P. Waiters, "Millennial Youth: Facts, Figures, and Priestly Vocations," in T.P. Waiters and B. Crawford, eds., The Millennial Generation: Hearing God's Call (St. Meinrad, Indiana: Abbey Press, 2001), pp. 15-25; and James D. Davidson et al., The Search for Common Ground: What Unites and Divides American Catholics (Huntington, Indiana: Our Sunday Visitor, 1999). 63.2 2004 Herron ¯ Merton and a Spirituality for Millennials 2 Robert Wuthnow, After Heaven: Spirituality in America since the 19YOs (Berkeley: University of California Press, 1998), pp. 3-4. 3 Wuthnow, After Heaven, p. 4. 4 Donald Grayston, Thomas Merton's Rewriting: The Five Versions of Seeds/New Seeds of Contemplation as a Key to the Development of His Thought (New York: Edwin Mellen Press, 1985), p. 371. See also Thomas Merton, The Seven Storey Mountain (New York: Harcourt, Brace, 1948), p. 33. s Anne Truitt, Daybook, the Journal of an Artist (New York: Pantheon Books, 1982), p. 22. 6 Thomas Merton, "Elias--Variations on a Theme," in his The Strange Islands (New York: New Directions, 1959), p. 233. 7 Thomas Merton, Witness to Freedom: The Letters of Thomas Merton in Times of Crisis (New York: Farrar, Straus, and Giroux, 1994). 8 Merton, Seven Storey Mountain, p. 372. 9 Thomas Merton, Turning toward the World: The Pivotal Years, Vol. 4 of The Journals of Thomas Merton (HarperSanFrancisco, 1996), p. 146. ~0 Thomas Merton, The Courage for Truth: The Letters of Tbomas Merton to Writers (New York: Farrar, Straus, and Giroux, 1993), p. 39. ~1 Thomas Merton, The Hidden Ground of Love: Letters of Thomas Merton on Religious Experience and Social Concerns (New York: Farrar, Straus, and Giroux, 1985), p. 452. ,2 Thomas Merton, The New Man (New York: Farrar, Straus, and Cudahy, 1961), pp. 178-179. 13 Thomas Merton, New Seeds of Contemplation (New York: New Directions, 1962), p. 199. 14 Thomas Merton, The Monastic Journey (Kansas City: Andrews and McMeel, 1977), pp. 66-68. is Wuthnow, After Heaven, p. 6. ~6 Merton, Monastic Journey, p. 110. 17 Merton, Monastic Journey, p. 40. ~8 Timothy Fry, ed., The Rule of Saint Benedict (Collegeville: Liturgical Press, 1982); Brian C. Taylor, Spirituality for Everyday Living: An Adaptation of the Rule of Saint Benedict (Collegeville: Liturgical Press, 1989); Joan Chittister, Wisdom Distilled from the Daily: Living the Rule of Saint Benedict Today (New York: HarperCollins, 1991), Eviatar Zerubavel, Hidden Rhythms: Schedules and Calendars in Social Life (Berkeley: University of California Press, 1981). 19 Mark Twain, cited in Witold Rybczynski, The Most Beautiful House in the World (New York: Penguin Books, 1989), p. 171. Review for Religious 20 Michael Mott, The Seven Mountains of Thomas Merton (Boston: Houghton Mifflin, 1984), p. 208. 2, Oscar Handlin, The Uprooted (New York: Little, Brown, 1951). Class Reunion The women, this fiftieth June after June Graduations, have buried the men: at this Table for ten, there are two husbands, Their two wives, a nun, and a quintet Of well-dressed, well-coiffed survivors, Not one a mere relict, but all Junoesque, Carrying Junoesque handbags at arms" ends. The nun carries nothing. The pair of men Draw together, only to be drawn apart Again by the women who treasure their presence: All that is left as stand-ins for the children. Amiably passed from widow to widow and back To spouse, they are lost, hosts at a table With too many partners, until saved, saved By the nun whose last name no one can Remember, sistering them with shy veiled Smiles, her innocence bridging the gap Between that June and this, seeming fifty Years younger than all the rest. The banquet Is served . Could Sister please bless? Nancy G. Westerfield 63.2 2004 LAURA SWAN Paradox in the Monastery: Lessons from Two Ammas Mwost of us have grown up with family stories that e have "always" been "familiar" with. This is oral tradition. Certain stories get told over and over, recalling the colorful, poignant, even troubling members and events of our families and congregations. Stories are retold among friends, families, and religious communities because the memory of them touches us deeply. They tell us something of who we are and where we have been. Stories unpack the mystery of the present and give us guidance into the future. We pass particular stories on because they have shaken something awake within us and we desire to share this awareness with others. We want to remember the lessons learned. Vowed religious remember stories retold about religious over the centuries along with the stories of their own monasteries and congregations. Which stories are dusted off and retold (and embellished) often says much about who we are and what we struggle with. Stories contain and sustain our cultural values. They assist in Laura Swan OSB, author of The Forgotten Desert Mothers, is prioress of St. Placid Priory; 500 College Street N.E.; Lacey, Washington 98516. Web page www.stplacid.org, and email to lswan@stplacid.org. Review for Religious passing on the traditions of our monasteries, congre-gations, faith communities, and families. In the desert of the early Christian movement, stories were collected, remembered, and passed on. Even today stories preserve the memory and teachings of the desert ascetics, the ammas and abbas who lived at the beginning of Christian monasticism. They sought the desert, a place of intense solitude, in order to focus their pursuit of the Holy One with single-minded devotion and limited distractions. Their goal was union with God. These stories formed an early oral tradition now known as Sayings (apothegms, apophtheg~nata). Side by side with this movement into the desert was a movement toward an evolving Christian monasticism. The desert ascetics were often associated with monastic communities. Eremitic communities were little more than groups of cells in the desert where the seekers occasionally met for teaching, prayer, and exhortation. There was no standard monasticism at this period. Religious life was quite diverse in all its expressions; every monastic community had its own rule and traditions. Two leading figures in the development of monasticism in Egypt were Pachomius (ca. 282-346) of Tabennisi in upper Egypt and Shenoute (ca. 348-464) of Atripe, also in upper Egypt. Writings of their followers, often called Lives, give us insight into the struggles and aspirations of early religious life and of Christianity itself. Many stories from the desert reflect the tensions of diverse expressions of Christianity and tensions between those seeking to articulate statements of belief, as in the Arian and Trinitarian controversies. The Holy Drunken Woman I would like to look at two stories. They confront us with paradox, and their themes are repeated in other stories from the desert) As the first story goes, on the feast 63.2 2004 Swan * Paradox in the Monastery of Abba Apollo, Abba Daniel went to the Upper Thebaid, visiting first the monastic community of men and then the monastic community of women. The community of three hundred women was called the Monastery of Abba Jeremiah, led by a "mother archimandrite.''2 In this story the women "violate" the tradition of not permitting men in their monastery in order to welcome a particularly venerated and beloved elder of the desert. In the tradition of desert hospitality, these monastic women welcome Abba Daniel and his companion into their monastery chapel and wash their feet. The women then bless themselves with the water used. Then they ask for a blessing and a word of teaching or exhortation. As the women seek a wise word from Abba Daniel--a common trait of desert stories--the scene shifts to an anonymous member of the women's monastery who remained away from the rest of the community. This anonymous nun believed to be drunk is asleep in the forecourt of the church, wearing clothing that is in shreds. Abba Daniel asks the mother archimandrite who this nun is, and he is told: "She's a drunk and we don't know what to do with her; we're afraid to take the responsibility of throwing her out of the monastery, and if we let her stay she demoralizes the sisters." 3 The community then redirects Abba Daniel to their refectory for a shared meal. Interestingly we are told that the women served the men simple vegetarian fare while they themselves ate well. When Abba Daniel inquires about this seeming disparity and violation of hospitality, the mother archimandrite responds: "You are a monk, and I served you a monk's food. Your disciple is a monk's disciple, and I served him a disciple's food. We, however, are novices, and we ate novices' food.''4 By example the women have exalted the venerable teacher by lowering themselves in an eccentric yet enticing paradox. Before leaving, Abba Daniel again concerns himself Review for Religious with the "drunken" nun, who was seen sleeping by the toilets. The men had been watching her. As the monastery retired for sleep, the woman rose and stood in a position of tearful supplication or prostrated herself in contrition. Whenever a nun came out to use the toilet, she would throw herself on the ground and snore. Abba Daniel calls the mother archimandrite, who joins him in observing this behavior. Realizing that the nun is merely feigning drunkenness and remembering her own mistreatment of her, the mother archimandrite confesses her own sin with deep conviction and contrition. When the "drunken" nun realizes that she has been discovered, she cleverly steals Abba Daniel's cowl and staff and disappears into the desert. The story concludes with Abba Daniel and the mother archimandrite declaring the "drunken" nun to be one of God's hidden servants. The woman rose and stood in a position of tearful supplication or prostrated herself in contrition. The Woman Who Feigned Madness From Palladius we learn of a women's monastery at Tabennisi in which a member feigned madness and demon possession.5 She was treated with contempt, and the other nuns avoided her company. This "mad" nun voluntarily worked at the most menial jobs in the kitchen. She wore a rag on her head while other members cropped their hair short and wore a cowl. She ate the scraps and leftovers only. She was never angry and never grumbled; she rarely spoke--all in the midst of being treated with contempt. She was insulted, cursed, and loathed by the other nuns. 63.2 2004 Swan ¯ Paradox in the Monastery An angel appears to Abba Piteroum, another venerated desert ascetic, inviting him to meet someone more holy then he, and a mere woman at that! The angel sends him to Tabennisi with a challenge: This woman is continually mistreated by her community and yet never takes her heart off God, while our venerable abba dwells in his cell yet wanders about the cities in his mind--a theme found throughout desert teachings, including the Sayings ofAmma Syncletica.6 For his angelic lesson, Abba Piteroum arrives at the women's monastery to see this holy woman, whom the nuns call "touched." She resists meeting him, but is physically forced into his presence. He immediately recognizes her as spiritually mature by an intuition of mind and heart. He falls at her feet seeking her blessing, and she responds by falling at his feet seeking his blessing, both vying to express their humility. The nuns are aghast. Abba Piteroum declares the touched nun to be the community's true spiritual mother. The nuns recognize the truth of his words and immediately begin to confess their mistreatment of this unknown amma and elder. Now elevated to "venerable," she cannot tolerate the place of honor and disappears from the community-- another common theme of the desert. The Paradox Most of us have experienced difficult people--in our congregations and monasteries, in our professional lives, in our faith communities and families. These are the people who know our buttons and hooks well. They have an innate ability to stir up our anger and impatience and frustration. These are the people who can make day-to-day living exasperating and an exercise in profound patience. Our inner reactions to these difficult people tell us more about ourselves than we care to admit. They gift us with all this opportunity for asceticism--and are Review for Religious usually quite unaware of it. While our history as religious seekers and as vowed religious includes eras of health-damaging fasts, hair shirts and nail beds, my Irish forebears standing for long periods in freezing cold water, and whips--these are all self-imposed ascetical practices of dubious value. These false ascetical practices betray our neo-Pelagian and neo- Jansenist hearts.7 Desert ascetics remind us that life hands us authentic asceticism: meetings, deadlines, "smallness" of income in the midst of aging, the ministrations that frail members call for, authority and obedience in tension in our individualistic culture, and difficult community members. Families have difficulty building and sustaining relationships in a culture that undermines those values and commitments. Desert ascetics sought to The desert tradition was intended to force the seeker to face self without distractions, illusions, or barriers. disappear, taking their wisdom with them. We know that the greater challenge is to build healthy communities and a healthy church. To us it seems the easier thing to disappear, to seek hiddenness. Yet the desert tradition was intended to force the seeker to face self without distractions, illusions, or barriers. Today's desert ascetics are, first and foremost, students of the desert and the spiritual difficulty encountered there. The desert teaches them self-knowledge and self-awareness. It teaches them to listen deeply and intensely. Daily they come to know a bit better who they are before God. While growing in awareness of who they are and who they are not, they detach themselves from reputation and any need to 63.2 2004 Swan ¯ Paradox in the Monastery defend themselves from those who may attack it. In the old and colorful stories, ascetics go beyond detachment from reputation to distancing themselves from others in order to live alone for God. We savor these stories because they invite us to multiple meanings, because they do not allow us a simplistic answer. Contemporary religious life recognizes--and painfully grows more aware of---fragile, disturbed, and disrupting members. Our call is to handle these troubling members wisely and compassionately, and at times firmly. We try to minimize the disruptions that wounded unruly members are capable of; we listen and ask ourselves what they are here to teach us. Often the stories we have retained and repeat pertain to the graced insights we have been given, the humor and lessons we have learned. Biblical scholar Walter Brueggemann speaks of the capacity of the Psalms to move us from orientation, through disorientation, to a new position of re-orientationf We experience times of disequilibrium, yet when God is there with us beautiful psalms can be birthed. In many ways this experience occurred in the lives of the desert ascetics. They were thrust into disorientation by accepting the gospel and striving to follow its earnest call by living in the desert or monastery. After each new experience of reorientation, the desert ascetics would be thrust again into disorientation through continued ascetical practices that could bring them to ever closer union with God. This rhythm stripped the seekers of all that separated their truest selves from God. The nun who feigned madness and the holy "drunken" woman open up the paradox that troubled members, nonconforming members, and the mentally ill confront us with. These women speak to us of the paradox of ultimate detachment, of letting go of all that keeps us from an intense relationship with God and our truest selves. And they are paradoxes because their pursuit Review for Religious of interior freedom causes disruption for others. These women certainly speak to us of ways that God is found outside our concept of "normal." And yet these women of old both challenge and help us to provide pastoral care for our nonconformist members who struggle with the daily reality of living out their vowed commitment or are mentally ill. We anguish on behalf of troubled members around questions of ability and willingness to live the demands of our life calling. Careful discernment is demanded of us. Is this person confronting a systemic problem in the monastery or community? Is she a prophetic element? What does the fruit of her behavior tell us? These women remind us that our teachers and mentors may come in the form of Balaam's ass--or a holy "drunken" woman or a woman who feigns madness. Indeed our troubling members call forth the strength of compassion and steadfastness and vision in ways we did not ever foresee. Sometimes we discover our best selves-- and sometimes our worst self comes out. These stories clearly teach the paradox of who was actually troubled: the woman or the community? The holy "drunken" woman and the woman who feigned madness behaved in disturbing ways, but were revealed to have pure hearts intent on God, while others manifested conformity and even appropriate conduct (not always the same thing) but inwardly lacked something even to the point of behaving badly. We are presented with a paradox, with a teach-ing/ learning moment. Discernment is necessary. What appears as "bad" is shown to be "good." What is in us-- our purity of heart, or our lack of it--is exposed. We are presented with classic stories of the desert, stories that support the desert goal of apatheia. Apatheia is the interior state in which people no longer have to struggle against inordinate attachments. Through 63.2 2004 Swan ¯ Paradox in the Monastery The desert ascetics taught all to deliberately let go of whatever keeps us from the single-minded pursuit of God. profound interior freedom, they are not pulled hither and yon by various worldly, desires. Apatheia is a mature mindfulness, a sound sensitivity, and a keen attention to one's inner world and to the outer world in which one has been living. Apatheia is purity of heart. The desert ascetics taught all to deliberately let go of whatever keeps us from the single-minded pursuit of God: feelings and thoughts that bind us or others, cravings and addictions that diminish feelings of worth, and attachments to self-imposed perfectionism. The paradoxical questions are: Does my purity of heart support my fellow seekers' own interior journey? Is it inappropriate if my purity of heart disrupts your journey? How do we discern this together? Desert ascetics faced suffering with determination and courage. They understood that suffering often has roots in their own attachments to thoughts, attitudes, motives, relationships, and reputation. Suffering was the avenue towards freedom, and detachment the avenue towards maturity and humility. And yet there are innumerable stories from desert monastic communities--possibly Shenouteand the White Monastery being the most famous--where misbehavior and harshness were too common.9 Benedict of Nursia's own Rule reveals a monastic leader purified by the fire of members' unruly misbehavior and matured by his attempts to curb it. The "mad" nun and the "drunken" woman remind us that the pursuit of holiness is a lifelong journey. Review for Religious As in all good stories, we are not given easy answers to hard questions. Paradox lives on and calls for discernment. We need self-awareness in order to understand what power the stories have and why we repeat them in our dining rooms. The "mad" nun and the "drunken" woman confront us: Who are our teachers? From whom are we willing to learn? At whose feet do we sit to receive the wisdom of desert cell and monastery? Are we alert to unexpected opportunities to learn? What do we do when our presumptions, prejudices, and expectations are exposed and thwarted? How do we discern? With whom do we discern? Who are our wise elders? Notes l I am drawing from Tim Vivian, "Witness to Holiness: Abba Daniel of Scetis," Coptic Church Review 24, nos. 1 and 2 (Spring and Summer 2003): 2-52. See also L~on Clugnet, "Vie et R~cits de l'Abbd Daniel de Sc~t~," Revue de l'Orient Chr~tien 5 (1900): 67-70. See also Witness to Holiness: Abba Daniel of Scetis, ed. Tim Vivian (Kalamazoo: Cistercian Publications, forthcoming). z Archimandrite is a term usually used only in the Orthodox and Coptic Christian traditions, referring to a leader of the monastery. 3 Vivian, "Wimess," p. 36. 4 Vivian, "Witness," p. 36. 5 Primarily I am using Palladius, Lausiac History, ed. and trans. Robert Meyer, Vol. 34 of Ancient Christian Writers series, ed. Johannes Quasten (New York: Newman Press, 1964), pp. 96-98. 6 Palladius, p. 97, and see The Life of Blessed Syncletica by Pseudo- Athanasius, ed. and trans. Elizabeth Bryson Bongie (Toronto: Peregrina Publishing, 1995). 7 Pelagius's name is given to the heresy that denies original sin and claims that human beings can choose the good on their own and thereby effect their own salvation. We see echoes of this in the posunodern North American and western European culture. Jansen's name is given to the heresy that human nature is so flawed by original sin that special grace is needed to follow Christ. His teachings around determinism are quite similar to Calvin's teachings on predestination. Jansenism was a rigorous and austere movement. I suggest that much of our perfectionist drive comes from the Jansenist influence on our culture. 63.2 2004 Swan * Paradox in the Monastery 8 See Walter Brueggemann, Praying the Psalms (Winona: St. Mary's Press, 1986). 9 See Susanna Elm, Virgins of God: The Making of Asceticism in Late Antiquity (Oxford: Clarendon Press, 1994), and Rebecca Krawiec, Shenoute and the Women of the White Monastery: Egyptian Monasticism in Late Antiquity (New York: Oxford University Press, 2001). They Who Sow in Tears. These are not hollow hours that the spirit spends in tortured wrestling with a loneliness trenchant and piercing. Even this ache that rends our subtlest calm beyond each day's regress with sharp-toothed gnawing at the being's core is heaven-sent, is calculate, is more than all our orisons, presaging joyous yield. This is the "sowing in tears" within His field. Agnes Margaret Humbert CDP (nursing home, age ninety-one) Review for Religious PATRICK SEAN MOFFETT Viewing Chapters as "Authoring" Our Congregations' Narratives ~hSU~S offers us his story. While walking the streets, lls, and lakesides of his homeland, he authored in Spirited word and action the initial chapters of the defin-ing narrative of Christianity. All eyes were on him in his hometown synagogue as he proclaimed that the words of Isaiah were being fulfilled in their hearing: "The Spirit of God has been given to me and has anointed me. God has sent me to bring the good news to the poor, to proclaim liberty to captives and to the blind new sight" (Lk 4:18-19). Chapters have a unique function in the lives of reli-gious congregations and their members and in the wider church. They merit re-viewing and re-hearing from a number of vantage points. Here I present a perspective that emphasizes the storytelling nature of these eccle-sial events. Stories We Live By In the stories people tell about themselves, psychol-ogists find a manifestation of two great motivational forces: agency and communion.~ Agency refers to behav- Patdck Sean Moffett CFC writes again from Christian Brothers, Central Harlem; 74 West 124th Street; New York, N.Y. 10027. I.LJ~K.~'O"~ 63.2 2004 iors that individuals perceive as uniquely their own: I think, I feel, I do. Communion refers to people's percep-tions of relatedness, of belonging, of being integral mem-bers of a group that they experience as us or we. In chapter preparations, various "Emmaus Walks" have gained favor as ways of fostering shared discern-ment. They are making a reappearance, displacing a pre-vious decade's preference for evaluations and sorting exercises' designed to evoke an exchange on personality types or styles of human interaction. Gospel based and focusing on people's unique life journeys, Emmaus Walks facilitate personal narration. Participants are usually assigned a partner randomly. After a time of reflecting by oneself (perhaps on a given theme or a text of Scripture) or checking in on one's own current affect, the pair simply take a walk during which they express what is happening within them. These exchanges are sometimes followed by testimonies within small or large groups or by a period of shared silence and a concluding blessing or hymn. The Emmaus Walk serves as an example of the story-telling which begins anew with the announcement of a coming chapter and characterizes much of what happens throughout the time of chapter. Individual members are invited to reflect on the movement of the Spirit within their individual and. communal experiences and then to share their observations with their sisters or brothers in local, provincial, and eventually congregational contexts. "Time of chapter" is the full period extending from the first announcement through, the preparations, the prechapter gatherings, the formal opening, and the issue and voting sessions to the chapter's formal conclusion. Consecrated Life in a Time of Chapter "Why is this day different from every other day?" The child's question opening the Hebrew Passover ritual Review for Religious might be applied to the time of chapter. Consecrated life in the Christian tradition is nourished by daily atten-tion to the Spirit of Jesus working in and through the individual and the community. A call to chapter is an invitation to each and all of the members to engage in discernment that goes beyond the usual daily praxis. In personal reflection, in personal and communal prayer, in speaking and listening, the focus in the time of chap-ter is our unity within our brotherhood or sisterhood in Christ. Our individual stories are narrated within the communal story. We attend individually to movements of the Spirit that may be intended for the whole community. I attend within myself, within the community, and within the people we are called to serve. I willingly risk asking if there is something in our shared life that I am called at this time to affirm, to question, to challenge, or to propose. I risk accepting a call to prophesy, a call to speak to my brothers or sisters in the name of God. I listen with special attention to those who speak in ways that challenge me, that call me to deeper levels of relationship with them and with our God. I test the spir-its that are stirring among us. I listen with mind and heart, noting particularly what evokes strong signs of passion, dissonance, or consent. Collectively, the members of the congregation under-stand that a general chapter is a defining moment in the ongoing story of their institute. Canon law is quite explicit: In an institute the general chapter has supreme author-ity in accordance with the constitutions. It is to be composed in such a way that it represents the whole institute and becomes a true sign of its unity in char-ity. Its principal functions are to protect the patri-mony of the institute . . . and to foster appropriate renewal in accord with that patrimony. It also elects the supreme moderator, deals with matters of greater importance, and issues norms which all are bound to obey. (c. 631, §i) 63.2 2004 Moffett ¯ Viewing Cbapt~ The New Testament offers what might be considered models of chapter. Stories within a Story The New Testament offers what might be considered models of chapter. Jesus gathers the disciples on the return from their first mission. They share stories marveling at all they had done and taught (Mk 6:30). Jesus chooses a committee consisting of Peter, James, and John to wit-ness the transfiguration. As Jesus approaches the time of his passion, he gathers the full group as friends at a meal in an upper room. He ritualizes his role among them as one who serves, and he enjoins them to follow his example. He speaks with great intimacy of his rela-tionship with his Father and with them, and of their incor-poration into his continuing story. He announces a new commandment revealing the defining characteristics of their agency and their commu-nion. "As I have loved you, you love one another. By this all will know that you are my disciples" On 13:3 4). Several postresurrection encounters are similar. Peace, self-reve-lation, and a shared mission are the recurrent themes. In the Acts of the Apostles, as the members of the early church confront issues of leadership, community management, and inclusiveness, there is a coming together to consider what is happening among them, to recall the story of tlieir mission, and to decide--"we and the Holy Spirit"--where to go from here. Religious hold as a treasure, but also as a memory of painful moments, the chapter stories of their congrega-tions- times of jubilee, special fervor, and renewal, but also of schisms, suppressions, and even denunciations of their founders. In the treasures of Franciscan lore, the gathering of the friars in 1217 at Pentecost continues to suggest Review for Religious images and hopes for new generations of the sons and daughters of the Poverello. He writes to those who were to gather, encouraging them to have a listening heart and to be "cleansed and enlightened interiorly and fired with the ardor of the Holy Spirit": Listen, then, sons of God and my friars, and give ear to my words. Give hearing with all your hearts, and obey the voice of the Son of God. Keep his com-mandments wholeheartedly, and practice his counsels with all your minds. Give thanks to the Lord, for he is good; extol him in your works. This is the very rea-son he has sent you all over the world, so that by word and deed you may bear witness to his message and convince everyone that there is no other almighty God besides him. Almighty, eternal, just, and merciful God, grant us in our misery that we may do for your sake alone what we know you want us to do, and may always want what pleases you; so that, cleansed and enlightened interiorly and fired with the ardor of the Holy Spirit, we may be able to follow in the footsteps of your Son, our Lord Jesus Christ, and so make our way to you, Most High, by your grace alone, who live and reign in perfect Trinity and simple Unity, and are glorified, God omnipotent, for ever and ever. Amen.2 In 1976 Eduardo Cardinal Pironio, in his role as pre-fect of the Sacred Congregation for Religious, offered a vision that anticipated many of the directions that chap-ters have taken during the past quarter century: A chapter is not a mere study meeting, a superficial gathering or a short-lived revision of life. A chapter is essentially a paschal celebration. For this reason it is above all a "penitential" celebration which aims at liv-ing two things deeply: a sincere attitude of conver-sion and a deep and painful search., for God's will in the present necessities of consecrated life. But, since it is a real paschal celebration, it is not just the penitential aspects that interest us in a chap-ter. It is the whole extent of paschal newness, a fresh- 63.2 2004 ness in the church and a good dose of pasc.hal opti-mism. If the chapter has been celebrated well, in poverty, prayer, and brotherly charity, it is a re-cre-ation of the institute, and its spiritual riches overflow upon the church and the world. Because of all this, the chapter is a salvific event, an ecclesial event, a family event. (L'Osservatore Romano, English edition, 16 September 1976) For many congregations the "time of chapter" has become increasingly inclusive of individuals and groups with whom they are associated in life and ministry. Coworkers and those served are invited to share in many aspects of the chapter preparations and celebrations. They respond with helpful and often challenging insights, genuine affirmations, and earnest testimonies to possible applications of the congregation's charism. They clearly have a role in the story of the institute. As the chapter moves into its more formal role of supreme authority with respect to the congregation's members and its choice of leaders, the various associates join with the universal church in prayerfully awaiting, outside closed doors, the moment of a new Pentecost. The church, historically the chief beneficiary of these charismatic moments, is most attentive in protecting the members' rights and asserting their duty to discern among themselves the movement of the Spirit. J Planning the Chapter Groups engaged in chapter preparations, when asked what outcomes are most desired, readily speak of a greater unity--unity in who they are and what they are about in the name of the Lord. "By this they will know that you are my disciples." A steering committee approaches the design of a chapter with the guidelines of canon law and with the congregation's constitution, statutes, directives, and cus-toms, but also with aspects of the "Zeitgeist" or cultural Review for Religious climate of contemporary religious congregations. Resources, facilities, travel possibilities, witness, means of communication, inclusiveness, ministerial pressures, and solidarity are some of the issues that have evoked creativity and diversity in the conduct of chapters. The Spirit has been called on to adjust to a great variety of venues. Faith is supported by Jesus' promise that, wher-ever two or three are gathered in his name, he will be around for whatever will be happening. Canon law offers chapter planners two notes: § 1. Participatory and consultative bodies are faithfully to carry out the task entrusted to them, in accordance with the universal law and the institute's own law. In their own way they are to express the care and par-ticipation of all the members for the good of the whole institute or community. §2. In establishing and utilizing these means of participation and consultation, a wise discernment is to be observed, and the way in which they operate is to be in conformity with the character and purpose of the institute. (c. 633) The initial request for community members' sug-gestions about the chapter tends to elicit many concerns about content and process that go well beyond what a large gathering could address within the limited time available, and so standing or ad hoc committees are assigned the tasks of: ¯ sorting through the initial input, ¯ performing or commissioning the research necessary for a more thorough study of stated expectancies and issues, ¯ developing preliminary drafts of papers or pro-posals, and ¯ offering opportunities for the members to share an emerging story in a variety of ways. (Letters, emails, calls, community and intercommunity gather-ings, retreats, liturgies, and assemblies become part of an extended effort to incorporate into the "time of chap-ter" the experiences and issues that may not find space and time in the formal chapter gathering.) 63.2 2004 Moffett ¯ Viewing Chapters A sacred history informs the narrative of our times. All recent retellings of the story of "consecrated life" make reference to defining characteristics articulated in the Vatican II Decree on the Appropriate Renewal of Religious Life, Perfectae caritatis. Religious hear a call to be faithful as men and women of our times, as followers of Jesus and his gospel, as members of the people of God sharing the mission of the church in the world, and as religious gifted with the charism of our particular congregation? The specification of a "time of chapter" is an invita-tion for members of a congregation to become more intensely engaged in sharing stories about the action of the Spirit in our personal and communal lives. My sisters and brothers encourage me: ¯ to attend to revelation I am receiving for the group, ¯ to share that truth in love, ¯ to attend to the prophecy of my sisters and brothers, ¯ to explore the differences, and ¯ to seek in faith the light, the direction, and the leadership that will guide our shared lives and mission toward the next chapter. When the members of the congregation or their del-egates come together for the formal affairs sessions and elections, it is a time for refinement, affirmation, and actualization of a consensus that has been emerging dur-ing several months of prayerful discernment, prophetic sharing, thoughtful listening, and rearticulation of the group narrative. In the process it is the movement of the Spirit that matters. The concluding chapter sessions, in their distinct moments, are a point of arrival and a new departure. Having clarified a shared vision for the life and mission of the congregation over the next few years, the members select those who will have a leadership role in helping Review for Religious membership remain attentive to the Spirit as together-- membership, leadership, and Spirit--they author the beginning lines of a new chapter in the continuing story of the congregation. The Zeitgeist and Some Dangerous Ideas As men and women of their times, members of reli-gious congregations, especially those working at the mar-gins of society, have a special vantage point for observing the surrounding culture, but also the risk of being affected by it. Much of what once happened only at general chap-ters has become part of congregations' ongoing admin-istration. Instant communication, travel opportunities, greater exposure to global issues, international and inter-cultural exchange, shared ministries, and increased col-laboration with governmental and nongovernmental organizations have broadened our ministerial vision and reduced our corporate response time. In the process, congregations have been exposed to prevalent cultural influences; sometimes they have regressed in search of past glories and a lost sense of security. Marist Father Gerald Arbuckle sounds the alert for "Avoiding Cultural Seduction in General Chapters" (Human Development 23, no. 3, Fall 2002). Recent terrorist activity has heightened awareness and concern about what propels groups toward conflict. Researchers are examining belief systems that seem to be fueling intergroup hostilities. Psychologists Roy and Judy Eidelson, in a review of the growing body of liter-ature, have identified five belief domains particularly important for further study: superiority, injustice, vul-nerability, distrust, and helplessness.4 They suggest a consideration of what happens as these ideas are incor-porated into the self-definition of individuals and then of the group to which they belong. 63.2 2004 Moffett ¯ Viewing Chapters Extraordinary times offer obstacles and opportuni-ties for evangelization. As in all instances of empathic ministerial response to hurt and evil, we are called to find within our own stories traces of what we seek to address. Our own sinful history attunes us to what makes Congregations sometimes have regressed in search of past glories and a lost sense of security. others particularly vulner-able to prevalent cultural influences, to what the Eidelsons call "dangerous ideas." Religious need not be suicide bombers or look beyond their own congre-gational experiences to have an initial insight into the dynamics of such ideas: "I and we are the superior ones. I and we have been the victims of injustice. I and we are particularly vulnerable. I and we cannot trust those who are not like us. I and we cannot do anything to change the situation." Significant insights become apparent in the telling of our stories. Chapters in an era of world conflict are called to attend afresh to the cry of the poor within and beyond the congregation. Those whose daily ministry affords them intimate interaction with the suffering Christ have stories that can lead to new life in the con-gregation. So can the stories of those who feel the dull pain of not having such opportunities. The challenge of chapter is that of evoking and attending to all these voices and recognizing the promised Spirit within them. From Our Stories to Our Story The current ages of those telling their stories can affect the themes that arise within the group. For exam-ple, a congregation that has numbers of older members and fewer young ones may find itself discussing genera- Revlew for Religious tivity (vs. stagnation) and integrity (vs. despair) and may be left with little time or energy for issues of identity, ministry, and intimacy, issues likely to concern the younger members. Accommodations may need to be made to assure that the group story will include the graces and struggles of all the members, not just the majority. Erik Erikson was in his eighties when he published a revision of his influential description of the life cycle. He focused on the way that personal identity, the "I," becomes ever more fully integrated into a "we." He said, "The sisterhoods and brotherhoods of the 'we' come to share a joined identity experienced as most real.''s A chap-ter needs to hear the congregation story as it is expressed anew in the lives of individuals and groups within the congregation. Not all the results will accommodate tran-scription onto paper or into electronic storage. Certain matters need to be transcribed. Constitutions and statutes govern the lives of the congregation's mem-bers. The approval process needs to be enlightened with all of the knowledge, wisdom, and grace available to those whose vote on specific matters will affect the future of all of their brothers or sisters. Records of valid voting procedures legitimate the transfer and continuity of lead-ership. Accounts and decisions concerning the patrimony of the congregation affect mission feasibilities and mem-bers' welfare, and they require skilled attention. All such matters are guided by canon law and by the law and cus-toms of the congregation. The experience of chapter, of specially shared broth-erhood or sisterhood and of the participants' careful pro-cedures and conscientious voting, is not easy to share with those who were not present. When words no longer adequately describe the lived reality of our being and doing, we struggle to find new words. We have a shared understanding of our collective story, about which words 63.2 2004 Moffett ¯ Viewing ~hapten The experience of chapter is not easy to share with those who were not present. fail, but the story is accurate. We measure other stories against that one. We likewise have intuitions of ourselves and of one another. By such intuitions we know for our-selves and others what is individually appropriate or not. Some words could be mine but not yours, some clothing would be comfortable for you but not me. In music, art, recreation, and so forth, in some way all that we become engaged in carries our unique signatures. Our collective images are shared. We can identify what is Franciscan, Dominican, Jesuit, typically Christian Brother, Mercy, or CND. Every document that is "ours" will have to fit within the domain of this collective vision. No document will ever capture it fully. As most of us sur-vive quite well without a definitive autobiography, so too our congregations. While described in a plethora of his-torical documents, as long as the congregation lives in its members, the story remains "in process." On the mountain Peter offered to capture in a build-ing project the brilliant manifestation of Jesus with Moses and Elijah. John probably had in mind a first draft of the account he never needed to write. James? For cen-turies great numbers of pilgrims to Compostela in Spain have touched into stories of this apostle's own manifes-tations. They speak of conversion and special graces. Yet all we know with some degree of certainty is that this James earned the crown of martyrdom in Jerusalem early in the story of the infant church (Ac 12:1). The words of Jesus reported in the synoptic accounts of his transfiguration suggest that each of the chosen delegates took from the mountain something to be cher-ished unspoken until it was time to proclaim the Son of Review for Religious Man's resurrection. Their privileged vision was not of something that was to come, but rather of that which always is. Together they beheld for a moment the light of the one God in whom they live and breathe and have their being. Such are our chapter stories. Notes t Dan P. McAdams, The Stories We Live By (New York: Wm. Morrow and Company, 1993); David Bakan, The Duality of Human Existence: Isolation and Communion in Western Man (Boston: Beacon Press, 1966); P.S. Moffett, "Promoting Agency among Children and Adolescents at the Margins" (invited address, American Psychological Association), Journal of Pastoral Counseling 30 (1995). 2 Taken from The Writings of St. Francis of Assisi, trans. Benen Fahy OFM (London: Burns and Oates, 1964), pp. 104 and 108. 3 Perfectae caritatis, Decree on the Appropriate Renewal of the Religious Life; Instruction on Essential Elements in the Church's Teaching on Religious Life as Applied to Institutes Dedicated to Works of the Apostolate, Congregation for Religious and Secular Institutes, 31 May 1983; lHta consecrata, apostolic exhortation of Pope John Paul II, 1996; Ytarting Afresh from Christ: A Renewed Commitment to Consecrated Life in the Third Millennium, CICLSAL, 19 May 2002. 4 Roy J. Eidelson and Judy I. Eidelson, "Dangerous Ideas: Five Beliefs That Propel Groups toward Conflict," American Psychologist 58, no. 3 (March 2003). s Erik Erikson, The Life Cycle Completed (London: W.W. Norton and Co., 1982). May Drunk on the wild plum, heady with endless stretches of bluebells surrendered to the woods (such are spring's goods, not to sell, but to sate novice eyes so long accustomed to the late gray winter's moods); all, all is given from these places where you, 0 Trinity, hide your faces. Eileen Haugh OSF 63.2 2004 J. THOMAS HAMEL Our Lady's Presence in the Spiritual Exercises gnatian tradition The first mention of our Lady in the Spiritual Exercises is in the first exercise of the First Week. "Preamble 1. This is the composition, seeing the place., the material place where the object I want to contemplate is situated . By 'mate-rial place' I mean, for example, a temple or a mountain where Jesus Christ or our Lady is to be found, according to what I want to contem-plate." ~ Is it by chance that the two examples given are a temple and a mountain? Major events took place in the temple (finding the lost twelve-year-old there) and, twenty years later, at the mount called Olivet (Jesus' ascension)--and who can doubt that our Lady was among the disciples there? (Lk 24:50-53; Ac 1:12-14). As a young child Mary was presented in the temple accord-ing to legend, even as later she presented her newborn to the Lord (Lk 2:22). Temple and J. Thomas Hamel SJ does spiritual direction and lives at College of the Holy Cross; 1 College Street; Worcester, Massachusetts 01610. Review for Religious mountain bring to mind what scripture scholars have long noted, that Mary was the only human person pre-sent to Jesus' life from beginning to end. The same is eminently true of her presence in the Spiritual Exercises. The first contemplation of the first day of the Second Week, on the incarnation, not only embraces the sacred event itself, but even invites retreatants to speak to "the eternal Word [so altogether newly] incarnate" in Mary's womb (§109). All of a sudden her womb is sacred space, a living temple. On the same first day, the presence and activity of our Lady is highlighted in the three points on our Lord's birth (§264). The second point simply quotes St. Luke: "She bore her firstborn son and wrapped him in swad-dling clothes and laid him in a manger" (Lk 2:7). In the third point the angelic choir sings "Glory to God in the highest" for Mary and Joseph and the child lying in the manger. (Ignatius conveniently forgets that the angels sang to the shepherds.) Putting her Son in a manger is our Lady's way of presenting him to the world. We can assume that Ignatius thought of that, and that the thought included a loving gaze at Jesus' entire life, the Life of the world. So aware of Jesus' birth in utter poverty, Ignatius recalls the arduous journey from Nazareth to Bethlehem. Ignatian contemplation is the exercise of being present first of all to details of some material things: the width of a road, its length, its smoothness or roughness, the width and depth of a cave, the size of a manger or trough, the height of a hill like Calvary. Imagined details about the route to Bethlehem invite us to be aware of the child pre-sent in Mary's womb on that long and arduous journey-- a prelude to journeys from Bethlehem to Egypt, and back to Galilee, later to the Jordan, to Samaritan territory, to Judea and Calvary. Jesus in the manger under his mother's care was the visible beginning of our finding our Savior 63.2 2004 Hamel ¯ Ou~ Lady's Pre~ence present everywhere in the world. Such is the way of the Holy Spirit at work in Ignatian contemplation. Our Lady's offering of her Son to the shepherds and to the world was a revelation, the source of Ignatius's own mysticism of apostolic gervice. Ignatian retreatants are invited to serve the needs of the mother, of Joseph, and the servant girl (§114) and, following the contem-plative gaze of Ignatius, are led on a journey that includes Christ carrying his cross to Calvary (§ 116). The mys-tery of the birth of Christ our Lord, or rather the mys-teries surrounding his birth, glow with something mystical. How else explain what Ignatius did when it was no longer possible for him and his first companions to go to the Holy Land? Thirteen months after his ordination to the priesthood, he celebrated his first Mass in the Church of St. Mary Major on 25 December 1538 at the altar of the manger in which Christ was said to have been placed. Once again Ignatius was reliving that sacred moment when our Lady placed her Son in the manger. Was the manger all along a kind of mystical manger which later prompted that long-standing desire of Ignatius that our Lady be pleased to place him with her Son? It is no sur-prise that her response was the mystical vision of La Storta in November 1537: He had resolved to remain a year, once he became a priest, without saying Mass, preparing himself and praying our Lady to be pleased to put him with her Son. And being one day

Issue 58.2 of the Review for Religious, March/April 1999. ; for rel igious Ch6sfar~ He6tages arid Cer~ter~p~rary L~v~r~g MARCH.APRIL 1999 o VOLUME 58 ¯ NUMBER 2 Review for Religious is a forum for shared reflection on the lived experience of all who find that the church's rich heritages of spirituality support their personal and apostolic Christian lives. The articles in the journal are meant to be informative, practical, historical, or inspirational, written from a theological or spiritual or sometimes canonical point of view. Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: foppema@slu.edu Manuscripts, books for review, and correspondenbe with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP P.O. Box 29260; Xa, Tashington, D.C. 20017 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©1999 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission, is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. for religious Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming SJ Philip C. Fischer SJ Regina Siegfried ASC Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm Jean Read James and Joan Felling ¯ Kathryn Richards FSP Joel Rippinger OSB Bishop Carlos A. Sevilla SJ David Werthmann CSSR Patricia Wittberg SC Christian Heritages and Contemporary Living MARCH-APRIL. 1999 ¯ VOLUME 58 ¯ ¯ NUMBER 2 contents 118 137 communal commitment: a symposium Luminous Traces: The Inbreaking Spirit amid Cultural Fragmentation Michael Downey offers a five-step tour of the culture horizon, pointing out the challenges and opportunities the U.S. culture presents to the communal commitment that lies at the core of most expressions of vowed religious life. Community Living." Beginning the Conversation Doris Gottemoeller RSM opens up a discussion on the meaning of community living in regard to its theological base, its spirituality, the role of leadership, and special challenges today. 150 paschal mystery The Credibility of Jesus' Resurrection: Two Interior Witnesses Leon McKenzie proposes that the voice of the resurrection archetype and the voice of the Holy Spirit provide credibility for Jesus' resurrection. 158 168 From Woundedness to Union Cynthia Bourgeault presents an explanation of the psychology of Centering Prayer. On the Go with Chronic Illness, Sitting Still with Mark Pamela A. Smith SSCM reflects on her own life in the context of Mark's Gospel: What is the Christian mix of resignation and stubbornness, relaxation and fight, that makes it possible to slow down and still go barreling forward? Review for Religious 175 184 the vowed life Friendship and Celibacy: Seeing Beauty from a "Holy Distance" Brian J. PierceOP makes the point that we need new stories and new language to affirm and celebrate the vow of chastity and the goodness and beauty of human and sexual love. Poverty: Now You See It, Now You Don't Elissa Rinere CP surveys the various meanings and implications for living the vow of poverty professed by men and women religious. 195 report U.S. Hispanic Catholics: Trends and Works 1998 Kenneth G. Davis OFMConv, Eduardo C. Fernandez SJ, and Ver6nica M~ndez RCD present a panoramic of the year's events within the U.S. Hispanic Catholic community. departments 116 Prisms 211 Canonical Counsel: Visitation 217 Book Reviews March-April 1999 prisms How are we to observe a year dedicated to God the Father at a time when we desire to be more sensitive about sexist phrases and patriarchal soundings? The male imaging of God, both in our theology study and in our liturgical services, has come under criticism from many Christians, often stimulated by the groundbreaking work of feminist theologians--no matter that Jesus referred most often to God as Father (though he also tised other image words or examples, of course, including feminine ones). Mthough the Hebrew word Abba is used only once in the Greek Gospels--in Mark--and seldom in Paul's epistles, the significant intimacy of this word (and its relevance to Jesus' teaching the prayer "Our Father") has made it central to the Christian understanding of the relationship of ourselves to God-v-One upon whom we can call, by our being baptized into Jesus, with his love-word Abba. God, for us Christians, is above all personal. We talk to God as a persbn. In our everyday life we learn early on to call out to "Mom" and "Dad," but we do not find ourselves saying "O Parent." Parent, much as it blends masculine and feminine, is not used in personal address. So parent and other ways of avoiding the Jesus-chosen name "FathEr" do not tend to keep us true to our Christian faith. Nor is it helpful to use activity names in our sharing in the trinitarian life since all God's activities outside the :Trinity are the work of the one God. In addition, the activity titles of creator, redeemer, and sanctifier are not the warm personal words that elicit and express a love-response on our part. Review for Religious Father Walter Ong SJ, in his book Fighting for Life, makes a helpful observation about how appropriate the use of the Father word is for God. The father metaphor seems more apt for God even than a mother metaphor because of the very way that God relates to us, A mother in carrying a child in her womb for nine months knows well the meaning of "bone of my bones and flesh of my flesh." In ordinary circumstances, a mother knows and feels how much this child (baby) belongs to her. A father's experience is necessarily different. A father must lay claim to a child. Leaving aside our contemporary scientific DNA testing for paternity, a father has to step forward and begin the bonding process with a baby boy or girl whom he believes is, and accepts as, the one he "fathered." We Christians understand that God steps forward and, in and through Jesus the Christ, claims us as his children. We are "daughters and sons of God," albeit "adopted" because Jesus alone merits the title "the only-begotten Son." True, we are God's creation, but we are not of the "substance" (like "bone of my bones and flesh of my flesh") of God. We are claimed by God in Jesus; we are adopted. The gospel metaphor of Father, then, in a transcendent way Of choosing and claiming, has given us the relationship we rejoice in--daughters and sons who rightfully call upon God with Jesus' word Abba. God expends great energy all our life long to convince us that we are beloved ones. Perhaps we glimpse the importance of God's choosing us as beloved in Christ when we consider the criteria of the apostle. When the Eleven were considering how to fill the place of Judas after the resurrection and ascension of Jesus, they used the criterion of having been present from the time of Jesus' baptism by John at the Jordan. For all of us followers of Jesus, he shares with us in our baptism what had been the consolation of his own in the Jordan event. We are taken into ¯ the circle of God's inner .life of trinitarian love. A year dedicated to God the Father help~ us appreciate more fully the graced relati6nship which we Christians, through Jesus Christ and our Scriptures and tradition, have been given the privilege of understanding--along with the ha.ppy responsibility of making our response. In balancing our images of God after the manner of Jesus, we Christians hold fast to the fact that our most basic response is our praying to God as "Our Father." David L. Fleming SJ March-April 1999 MICHAEL DOWNEY Luminous Traces: The Inbreaking Spirit amid Cultural Fragmentation "Peggy O'Donnell is dying." My mother was shocked when I, a first grader at Most Blessed Sacrament School, relayed the news. Peggy was a high school senior at West Catholic. She lived down the block from us in our Irish Catholic village in southwest Philadelphia. "What?" my mother asked incredulously. "Peggy O'Donnell looks just fine to me. There's nothing wrong with her." Over the course of the next few hours, my mother found out the real story via the neighborhood grapevine. "Peggy O'Donnell is leaving the world," Mother told me, "but she's not dying." But what was I to think when Nancy O'Donnell said of her sister, "Peggy's leaving the world"? Peggy did leave the world of that Irish Catholic village in southwest Philadelphia. She went to Rosemont, way out in the s~burbs, to the Convent of the Society of the Holy Child Jesus, a different world indeed from what was known to us in the city. But, however different the Michael Downey is professor of systematic theology and spir-ituality at Saint John's Seminary in Camarillo, California, and is theologian to Roger Cardinal Mahony. He edited the award-winning New Dictionary of Catholic Spirituality; his most recent publication is Textual Mysticism: Reading as a Basic Spiritual Discipline. This article is adapted from the presentation given at a symposium at VCernersville, Pennsylvania, in October 1998. He may be addressed at the Archdiocesan Catholic Center Office; 3424 Wilshire Boulevard; Los Angeles, California 90010. Review for Religious world of Peggy O'Donnell and the others out in Rosemont might be from ours, and whatever these words about "leaving the world" might have meant, deep down inside I knew that Peggy O'Donnell was still going to be in the world, part of the world. She was not dying. My mother told me so! I open with this cameo of Peggy O'Donnell because it evokes images of leaving one world and embracing another, shedding the skin of one culture so as to embrace the meanings, purposes, and values of another. But "leaving the world," moving from one world into another, shifting from the culture of an Irish Catholic village within a city to that of a convent in the suburbs of Philadelphia in 1958, was a very different sort of challenge from what religious face today amid the culture, the world, in which they live. I have been invited by the coordinators of this syrr~.posium on religious life to offer a tour of the cultural horizon, pointing out the challenges and opportunities our culture presents to the communal commitment that lies at the core of most expressions of the vowed religious life. I shall proceed in five steps. First, I shall address the question What is culture? (Culture, like experience or community, is a term much used in religious discourse today, but often it lacks precision.) Second, I shall identify certain shifts that have taken place in our culture, making the world a very different place from the world in which many religious were formed as children, as adolescents, and as novices. Third, I shall describe features of this culture that pose serious challenges to commitment of any kind, specifically commitment to a particular community of persons. Fourth, I shall suggest that cultural shifts, often seen negatively, can be good news precisely because they make room for something else to come into being, providing occasion for the inbreaking Spirit in the gift of hope. I shall spell out the conditions or attitudes necessary for receiving this gift of hope in our very dark age. And, fifth, I shall suggest a reconfiguration of hope for religious life and communal commitment in terms of a shift from community to communion. Culture Culture and the world are roughly approximate terms. The story of Peggy O'Donnell is intended to be a gende reminder that, in the not so distant past, religious life was another world, an alternative culture. When Nancy O'Donnell said of her sister Peggy that she March-April 1999 Downey * Luminous Traces, was leaving the world, what she meant was that she was leaving one culture for another. The word culture refers to the various forms by which meanings, purposes, and values are expressed and impressed. Culture is a language. Language here is much more than verbal communication; it is expressivity, and human beings express themselves in manifold ways. Human beings are of necessity always expressing themselves, "speechifying"--and, when they do, they do so in culture. Culture is the whole constellation of means by which human beings expres~ what is deepest and most important to them, for example, about family and progeny, social arrangements and sexual taboos, and how to deal with illness and aging. They do this through art, literature, and ritual. Culture includes the ethos of a people, the central story or vision that gives direction to their lives, the principles and governing concerns by which they gain a sense of order and cohesion in their lives. Culture encompasses economic systems, political structures, and the laws that give shape to a sense of right and wrong. Also included are the many ways in which human beings strive to express their perceptions of beauty in music, dance, architecture, and the fine arts. Because human beings perceive and pursue the gift and task ofself-expression in different ways, cultures differ, sometimes so much so that they appear irreconcilable. In other words, human beings create or participate in creating worlds of meaning, value, and purpose by means of culture. Wherever there are human beings, there is culture. Culture is second nature to humans. Culture is what human beings do with the "stuff" of the created order, the natural world, what might be referred to here as first natui'e. Human beings a{e always taking this givenness of the natural world, this first nature, and doing something with it. The created world in which we live is the "stuff" that is taken and shaped, created. We extend and transform this givenness in accord with particularly human meanings, purposes, and values. An apple is part of nature, but making apple pie is part of culture. While daffodils belong to nature, arranging a bouquet of them is part of culture. Precious metals are mined from nature, but exchanging and wearing rings is a cultural phenomenon, expressing love and fidelity and a whole range of related meanings. Solid marble is quarried from nature's Side. When slabs of it are carefully Review for Religious designed and skillfully chiseled, the result may be a contribution to culture. There are alphabets and dictionaries, but a poem or novel is something else again. There are musical notes, but the ordering and arranging of them in a distinctive musical composition is of a completely different order. It belongs to the order of culture, second nature to human beings. Any cultural form is expressive of multiple meanings, not just one. Flowers may be arranged in a bouquet and set in a place of worship as an expression of reverence and offering. They may be sent from a lover to the beloved as an expression of affection. Flowers are sent to people who are ill in the hope of cheering and strengthening their spirits. And they may be given in times of sorrow and loss as an expression of sympathy. All these are uses of the created order, of first nature, by human beings whose nature is to talk, to "speechify." So semantically laden is the cultural phenomenon of apple pie that, for many people in the United States, to be told that someone is "as American as motherhood and apple pie" precludes need of further description of the person's character and identity. But culture is about much more than nosegays, apple pies, wedding rings, and skillfully crafted marble edifices. As second nature to human beings, culture includes everything involved in the task of being and becoming fully human. Culture, then, refers to the whole sociosymbolic order in which humans live and by which they receive and shape meaning and identity. Here it must he recognized that the extension and transformation of nature for human purposes has a checkered history. Not every cultural expression advances truly human purposes. Not all humanpurposes are worthy as such, that is, simply because they are human. And not every value that human beings perceive as such is in fact so. From a Christian perspective, it is prayerful attention to the Spirit of God present in the world and moving human hearts toward God that opens up, orients, and often reorients culture to authentic human meanings, ptirposes, and values. An observation on "American culture" before proceeding. There is no longer one unified and unifying American culture, if ever there was one. In the Archdiocese of Los Angeles, Mass is Human beings create or participate in creating worlds of meaning, value, and purpose by means of culture. March-April 1999 Downey ¯ Luminous Traces celebrated every Sunday in over forty languages and dialects. At Hollywood High School, students speak more than eighty languages and dialects. Whatever may be the sense of "American" character and identity communicated in the rhetoric of "motherhood and apple pie," does this image speak any longer to such a range of people? When, in such contexts, inherited cultural forms begin to fragment, it should come as no surprise. It is no less surprising when traditional forms of the vowed religious life become semantically empty. They no longer "speechify" the meanings, purposes, and values that are perceived and pursued as central to the vowed religious life. Culture: Coming Apart at the Seams Using an image from life in southern California, we may liken our culture to a house situated on a fault line.There is a fissure running down the center of the treasury holding what is dearest to us. The culture in which we were formed seems to be coming apart at the seams. There is seepage and spillage everywhere. Bad news. But the good news is that inherited, deeply cherished cultural forms may be giving way so that something else may come into being. To speak of culture entails talking about 'its prevailing wo~'ldview. What was the worldview in which most United States religious were formed? What was the dominant view of human life and history? What was the view of the relation between God and the world that, I suggest, is now giving way to new ways of perceiving and being? ~ First is the boundless confidence in the capacity of the human mind to know everything by means of the so-called scientific method, an affirmation of the power of reason (very narrowly understood) to think its way through just about anything. Such a lofty understanding of the powers of reason began to wane once appropriate attention was given to the facts of history, to the enormity of human suffering, which baffles and disorients even the most serene exercise of reason.2 Second, in such a worldview, there is the conviction that individuals can make and shape themselves. Together with this, there is an unprecedented affirmation of individual rights and liberties. This affirmation of individual rights and liberties enshrined in the U.S. Constitution can often eclipse the pursuit of a common good. Review for Religious Third, with roots long, deep, and strong in Christian history, a marked dualism characterizes this worldview. In such a perspective, ¯ all reality in every sphere of life is divided into two parts, with the implication that one is superior to, and dominant over, the other: mind over matter, objective over subjective, intellect over affect, the analytical over the intuitive, prose over poetry, God over humanity, humanity over nature, male over female, white over black, yellow, red, and brown, clergy over lay, American and Western European over the Third World, rich over poor, speech over silence, the strong and powerful over the wounded and the weak. The fourth feature of the worldview which shaped many of us is perhaps the most problematic of all. History is viewed as inevitably progressive. Change is always improvement, and whatever is new is better. Progress is regarded as inevitable and therefore beyond moral adjudication. Whatever can be done must be done and therefore should be done. The horrors of history, the sufferings of individuals and of whole peoples, no matter how large and how utterly incomprehensible, are seen as unseemly wrinkles in the unfolding of an inevitably better future. The sentiment lingers. It is not at all uncommon to hear from undergraduate students something like: "God must have had a plan for eliminating six million Jews. He permitted it to happen to the Jews in order to teach them a lesson for their own benefit and the benefit of humanity. We just have to accept it." Here, no matter what happens, God is in charge, controlling the universe like an absolute monarch. Today we stand at a juncture. In starker terms, we are trying desperately to straddle a fault line. The inherited worldview and cultural contours briefly described above are crumbling. Our framework is in fragments, but much of it is still in our marrow. We are reluctant to relinquish this way of perceiving and being in the world. We are slow to give up. Even though we recognize that it no longer rings true, we nonetheless cling to it tenaciously because we are not yet altogether clear about what is still coming to be. From the perspective of the student of Christian spirituality, the worldview that so shaped us has failed to satisfy the deepest longings of the human heart. The worldview that so shaped us has failed to satisfy the deepest longings of the human heart. March-April 1999 A Downey * Luminous Traces The construal of the human being as a self-made self and the unprecedented affirmation of the superiority of reason and of individual rights and liberties are not easily reconcilable with present modes of perceiving and being in the world. In contemporary Christian spirituality, there is a deeper realization that the human person is not to be defined principally as a rational animal with separate faculties of intellect and will, a composite of body and soul often at odds with one another.-Rather the person is a whole, a being defined by heart, affectus, affectivity--the capacity to be touched and drawn into relationship and interpersonal communion with another, others, and God. More importantly, people today live with an uneasy sense that there is no longer a big picture. For many people, deeply religious people no less, the world does not hang together, the center does not hold, in the way it was once thought. This puts a bold question mark before our understanding of God and the nature of God's relation to the world. God the all-powerful monarch, manipulating and controlling the universe, is simply beyond belief. It is precisely this understanding of God that cannot be sustained, and with it the worldview that rests upon it. Further, efforts to reach even the slightest measure 0fagreement on the nonnegotiable elements of a coherent worldview seem futile. Consequently, no commonly held values provide a sense of shared purpose. As but one example, over the course of fifteen years of undergraduate teaching, I would ask students year by year: "What do you value most of all? Is there anything that you would be willing to give your life for, perhaps even to die for?" Invariably there was reticence, indeed reluctance~ in the face of my question. But eventually there seemed to be some measure of agreement that "family" is what is to be valued above all else. But, when pressed to speak about the nature o~ "family," all thirty-five or more students would have different understandings of what "family" means and why this slippery term designates or suggests a value at all. It has become increasingly difficult to arrive at a common-sense understanding of "family" or of what "family values" might be. In addition to the loss of a big picture, there is a growing conviction that the future is not inevitably progressive. Today there is clearer recognition that change is not always for the better and that the future is not necessarily brighter. That is to say that history is riddled with interruption, disorientation, and a sense of randomness, indeed chance? Not everything that happens should Review for Religious be assigned to God's providence. As a variation on the theme of a rather tasteless bumper sticker: Things just happen! But the interruptive character of history, thought on first reading to be irreconcilably at odds with God's providential plan, is not of necessity so and may in fact be more in keeping with biblical understandings of God's action in history, specifically in the person of the Christ, than the view of God's providence characteristic of the inherited worldview now passing away.4 Much of what has contributed to our fundamental sense of meaning, purpose, and value is now a shambles, no matter how much we care to think otherwise: family, neighborhood, political and economic institutions, and religious life as we have known it. Efforts at retrenchment and restoration may meet with ostensibly satisfactory results in the short term, but, no matter how big the shoulders trying to hold up these and other elements of a culture-in- collapse, another course is required, not simply desirable. Rather than trying to hold up what can no longer stand on its own, what is called for is a clearing of the house, making room, so that something new can come into being. What is coming to be may find no clear precedent in human or Christian history. And it is precisely because it finds no clear precedent in Christian history that it may come into being by the presence and power of the Spirit of God, the Spirit of Christ. As these outer worlds of meaning and purpose and value splinter, fragment, and shatter, there is a strong tendency to turn inward for stmething reliable. Many currents in spirituality today are characterized by self-absorption, self-preoccupation, and self-fixation. Spirituality is thought to be about interiority, often to the exclusion of the wider spheres of life. The movement inward appears to go faster and faster, if not deeper and deeper, as outer worlds of meaning continue to collapse with increasing rapidity. All of this seems like very bad news, but it need not be. The hallmark of our age is the self-emptying of forms because inherited cultural forms cannot hold God. And, as they are emptied and found wanting, perhaps there will once again be room enough for the God of constant coming, whose gift always and everywhere overspills all our efforts to lock it in, pin it down in tightly knit thought forms, theological systems, and patterns of religious living. There is, then, a reason for the hope that lies within us (see 1 P 3:15): the Christ who is always and everywhere drawing us forward cannot be chained by cultural forms and worldviews, which, March-April 1999 Downey ¯ Luminous Traces however adequate they may be in the service of the truth, are always necessarily limited, partial. They cannot contain God. They are unable to hold the fullness of God. Recall that culture is language and is second nature to us. But no matter how deeply we are indebted to our inherited cultural forms, to the language which is second nature to us, God's giving overspills any and all mediation. Today there is a deepening sense that God is incomprehensible mystery, beneath and beyond all our efforts to dissect, scrutinize, and systematize. From the perspective of a student of Christian spiritual and mystical traditions, even as we are stalled at a cultural crossroads, we are being invited to enter more deeply into the apophatic way, to be educated in the Spirit's school of unknowing, to proceed on the path toward a dazzling darkness at the heart of which is the One whose name above all names is not God.5 For even the name God is no proper name for the One whose name beyond and beneath all naming is Love. And Life. And Light. Even and especially in the darkness. The Rhetoric of Culture: Choice over Commitment Though something new is coming to be, we are still dogged by elements of that earlier worldview that pose serious obstacles to growth and development in the spiritual life in general and the vowed religious life in pa(ticular. These may be thought of as deep wounds inflicted by our culture, whatever one may care to say about its merits. More specifically, they constitute sometimes seemingly insurmountable hurdles to comm. itment of any sort. In the not too distant past, it was common enough to give a good bit of attention to the so-called "enemies of the spiritual life." In approaches to religious formation, "particular friendships" were often viewed in such terms. Today there are indeed enemies of the spiritual life, but they are quite different from those identified in earlier approaches to formation. They must be tackled by a different strategy. As I see it, the three major obstacles that must be hurdled in any approach to commitment, specifically a lifelong commitment to a community of persons, are narcissism, pragmatism, and unrelenting resdessness.6 The first is related to the disproportionate emphasis in the culture on individual rights and liberties. We are inclined to think of ourselves first and finally as individuals who choose; or elect, to be in relationship. The self is thought to be the first and final Review for Religious arbiter, not only of meaning, purpose, and yalue, but also of all reality. Individual fights and liberties and the ability of individuals to make and shape themselves by choosing from among a multiplicity of options is, in the minds of many, of preeminent value. When traveling in different parts of the world, I often ask what impression others have of the culture or cultures in the United States. Invariably the response is something akin to: "You are very practical people. You are achievers. You get things done. You are doers." Indeed we are a practical people, pragmatists. In the mind of the pragmatist, the truth is what works. And, if it works, it must be true. We have become the people of the bottom line. We are governed by a preoccupation with outcomes, assessments, and five-year plans. We all too readily think of ourselves and others in instrumentalist, pragmatic terms. Created goods, even human lives, have become commodities. Everything is considered in terms of what gets achieved, done, accomplished, produced to satisfy the needs of some consumer. It may be useful here to recall: "If you are what you do, when you don't, then you're not." A cameo may convey my meaning here. On a visit to Santa Barbara on a beautiful Sunday afternoon, I strolled from the beach to the caf~ for a cup of one of those designer coffees. Seated near me were two young women, perhaps seniors in high school or entry-level undergrads. They were hunched over huge textbooks with graphs and charts of some sort, reminiscent of those in my sophomore-year geometry book. Basking in the splendor of Santa Barbara's light while sipping away at their Starbucks, the two were studying very hard--judging from their knitted brows. In due course one looked up and said to the other in a tone at once exasperated and apodictic: "Look, if it's not common sense, it's wrong!" Hers is the voice of an age impatient with the speculative, unwilling to stay with an idea for a long time, unable to engage in the discipline of thinking something through, lacking the endurance to follow an argument to its logical conclusion. Unless it cashes out, has empirically verifiable results, some clear practical merit, why be bothered? Speculation, as in the commonplace "ivory-tower speculation," has become a nasty word. We are a people who are unrelentingly resdess. We are. hungry for experience. We live in a culture in which we are urged to keep on going, exploring options, choosing from among a myriad of possibilities. Another cameo: For me as a child in that Irish Catholic March-April 1999 Downe~ ¯ Luminous Traces village within the city of Philadelphia, the trick was to convince Mother and Dad to allow us one half hour in front of the television, after we had been out to play and after we had done our homework. If permitted to watch an evening TV program, my sister and I would sit glued to the television set for thirty minutes without budging. Now when Mikey, my twelve-year-old nephew, walks in the door of my home, I remind him, "No surfing in my house!" It is not the surfboard I have in mind, of course, but the TV remote control. Mikey has learned that in my home he is welcome to watch a TV program, for much longer indeed than half an hotir, but for him this takes real discipline. It is altogether different from channel surfing-~staying with this station for two minutes and that one for three minutes and the next one until it is time for ~he commercial. Mikey's TV wanderlust is not uncommon, and it is symptomatic of a much deeper wandering, squandering perhaps, of the human spirit. Unrelenting restlessness is manifest in many expressions of spirituality today. We tend to move from one thing to the next, from one approach to spirituality to another, first taking some tips from the Ignatian school, then making a retreat at a Benedictine monastery, perhaps a little lec~io divina. The "spiritual quest" can become little more than a cruise down the spirituality superhighway, gobbling up soundbite supplies of spiritual wisdom that "work for me." If it does not work for me, then I move on. Narcissism, pragmatism, restlessness! These are the enemies of the spiritual life today. They are cultural wounds, and you and I carry them with us in making, cultivating, and sustaining our religious commitments. They are in our bloodstream. We think of the individual as first and final in a way that blinds us to the relational matrix of all life.7 We are numb to the simple truth that absolutely everything is related to everything else. We are pragmatists to the core. ~Fhe fact that monks continue to rise at three in the morning to pray to God in the dark long before the dawn is virtually incomprehensible, in our culture. What good does that do? What difference does it make? What are the outcomes, the results, of praying in the dark? Why pray at all? Why live in a monastery? At least go out and do something with yourself in the real world! Make a contribution to society! Make a difference! Do something! Anything! And we are restless, indeed driven. In a culture in which the rhetoric of choice has rendered mute the language of commitment, Review for Religious many of us find it hard to stay at anything for very long. Our age is characterized by impermanence and provisionality. We find it difficult to stay with anything, and be really alive and passionate about anything, day after day, week by week, year by year. Diversion is what is constant. We move on when there seem to be no immediate results. We resist going back to the book every single day, listening long and lovingly to that Word beneath and beyond all the words, staying with it long enough to hear the beating of the heart of God beneath and beyond the cacophony and clutter of our own making, staying still long enough to find ourselves in God and there to rest--even and especially when such staying does not "work for me" or "do" any good whatsoever. The Inbreaking Spirit As cultural forms collapse around us, the appropriate response lies not in trying to hold on to them or hold them up by sheer force of will or by fuzzy references to the will of God. Nor does it lie in accommodation to the individualism, pragmatism, and unbridled restlessness characteristic of our age. It may lie in the cultivation of forms of life more in keeping with the person of Christ, the presence and power of the Spirit, and the apocalyptic sting of the gospel. Just as Peggy O'Donnell left the world in 1958 and embraced an alternative culture, the new world of Rosemont, so too the future of religious life lies in patterns of living that stand in marked contrast to a culture-in-collapse now increasingly recognized to have been a bad bill of goods. Neither is ready retrenchment or hasty rebuilding an appropriate response amid cultural fragmentation. Rather, the more effective strategy would be to create space, provide room, for the coming of something that is not of our own making. This calls for deep reserves of hope. It is precisely at the moment when our own efforts fail, when we are unable to .make and sustain our commitment, that the Spirit comes in the gift of hope--breaking in on our willful efforts to hold together and hold up what is broken, even and especially our deepest selves. In our times, isn't hope the most important virtue? And the most necessary? And the rarest? We live in a disruptive and disorienting age. On every street, behind every other door, lives someone who is deeply disheartened if not actually despairing. This may be brought on by people's awareness of massive and March-Aprll 1999 --129 Downe~ ¯ Luminous Traces meaningless death and the randomness of violence, by the onset of early illness, by the loss of a loved one or a job or a sense of meaning and value--or the loss of cherished ways of perceiving and being in the world. Our inability to relinquish deeply ingrained patterns of narcissism, pragmatism, and restlessness signals a crisis of hope and beckons us to deeper levels of willingness to be open to this gift. What exactly is the hope that breaks in, amid the shambles, as the gift of the Spirit? As I see it, there is nothing more important to the human being than hope. People can live without faith, and many do. In our own day, certainly, many people live without explicitly religious faith, and evidence of loveless lives abounds. But people simply do not live without hope. They cannot. Hope is "the very center of a human being.''8 Though we need hope more than anything else in life, little has been written about it.9 Compared with faith and love, hope has been given little attention in the traditions of Christian theology and spirituality. Hope may be likened to the proverbial middle child, the neglected one among the theological virtues, sandwiched in between faith, which makes the first move, and love, which is preeminent in most readings of Christian Scripture, tradition, and theology. Hope is the drawing force of all human initiative. It looks to the coming of the new, the never before, the undreamt of. Hope is a pregnant, many-layered .concept. We can distinguish in it shades of meaning that the French language, for example, conveys with different terms--espoir and esperance. We can make the distinction between hope for success (espoir) and something deeper: the anticipation of a desired good, a desire-filled wanting, in a word, esperance. In a more metaphysical and religious sense, hope, esperance, is a movement of the person by which we relativize the present and all its prospects of success so as to be open to something that we realize can come only as gift. The more unpropitious the context in which we demonstrate hope, the deeper the hope is. Hope is precisely what we have when we do not have something. Hope is not the same thing as optimism that things will go our way, or turn out well. It is rather the certainty that something makes sense, is worth the cost, regardless of how it might turn out. Hope is a sense of the possible. It strains ahead, seeking a way behind and.beyond every dead end. Hope moves in three steps. First, what I hope for I do not yet Review for Religious have or see. Hope's object is future. Second, what I hope for may be difficult. But, third, I just might have it! There are no guarantees, but it just might be possible. In short, hope is directed to a future good that is hard but not impossible to attain. Its attainment, though, is in the mode of reception. Hope is the retrieval of possibilities that can only come as gift letting something come into life that is not self-generated. But with the gift comes judgment. The counterpart of hope is the admission of failure; the condition for the possibility of the Spirit's inbreaking in the gift of hope. Indeed hope of the deepest kind, esperance, calls for humility, a willingness to be judged by the gospel, to submit to its apocalyptic sting. Historical events interrupt our sense of order and cohesion. Our educational institutions have lost sight of the purposes for which they were founded. In light of the Lordship of Christ, it becomes clearer that our cultural forms, our sense of the fixedness of meaning, our grand schemes for improvement, have failed. Though hope for the future cannot come unless there is a willingness to admit failure and be judged by the light of Christ's gospel, there is in us a tenacious resistance to accepting the fact that we have failed. Without humility, poverty of spirit, and filial fear of the Lord, we remain unable to face the simple fact that our lives as persons and as a people are deeply fragmented. But the willingness to admit that the way we have done it until now is no way into the future liberates us to attend to other possibilities. It allows us to be open to voices and visions that were never heard or seen in earlier ways of perceiving and being. Admitting failure in light of the Lordship of Christ and by the presence, and power of the Spirit renders us free to receive the many gifts that, even and especially amid the ruins, are still on offer. When we relinquish the big-shoulders strategy of holding up what is falling down, we can attend to the shimmering shards amid the crumbling of our worldview and our culture, even and especially our religious culture. It is not at all uncommon to find that what we have put our energies into, indeed what we have staked our life on, proves unreliable, and that what we have affirmed in faith is no longer believable. What, then, is the reason for the hope? Can we continue to hope in such circumstances? It is precisely when faith crumbles There is nothing more important to the human being than hope. March-April 1999 Downey ¯ Luminous Traces and love grows dim that hope really begins.'° It is in the wonder and weakness of one's faith that we find the real meaning of hope. For hope is the willingness to not give up precisely when one draws no consolation from faith. Hope does not t~ to determine how God's ways will be shown. It remains open for all new and astonishing manifestations of the divine presence. It is in our most vulnerable state that God's gift of the Spirit, in hope, comes. Hope !s indeed God's gift to the vulnerable. It is only when we are exhausted, speechless, impotent--that is, only in our radical brokenness and vulnerability, by which we participate in the kenosis of God--that God can find room enough to enter and sustain us. The hopelessness and emptiness of the darkness of our age is precisely the condition that makes hope possible. And it is in the self-emptying of inherited forms of religious life and communal commitment that we can find room for what is yet to come. Amid the ruins, our consolation and our hope are found in the One who has left behind a trace of his presence even amid the crumbling?' However much we may wish it otherwise, sometimes it is no more than a trace of God's nearness that we have. For those who are rocked and shaken to their core, shattered by the inbreaking Spirit who is the very gift of hope, shimmering traces may have to suffice, enabling us to take the next step, and the next, toward what is yet coming to be--as the gift of God's giving. From Community to Communion It is clear that inherited expressions of the vowed religious life cannot escape the self-emptying of forms that is the hallmark of our age. This gives cause for lament, and for hope. The future of religious life is ineluctably tied to the willingness of vowed members to lament what has been, what is now passing, and-- rather than trying to rebuild from what little remains of the past-- to create spaces where something of God's constant coming as gift can be recognized, named, and celebrated in memory and in hope. Forms of religious life as we have known it are giving way to something new, new forms of religious life, perhaps, but without clear precedent in Christian history. In the midst of the crumbling of forms in which community and communal commitment played a large role, lamentation can give rise to hope. As community identity " seems on the brink of collapse and communal commitments seem stretched to the breaking point, there may be gained a glimpse of Review for Religious the deeper mystery of interpersonal communion. Is it at all possible that what is presently operative in religious communities is a self-emptying of forms so that vowed members may participate more fully in the mystery of communion? The fundamental Christian mystery is that God is a communion of persons in loving relationship: Father, Son, and Spirit toward us, for us, with us, in us. The very being of God is to be in relation, to be toward us, for us, with us, in us. To be created in the image of God is to be created for relationship, for communion, for establishing, cultivating, sustaining relationships based on reciprocity, mutuality, and equality rooted in the mystery of the divine perichoresis~ To say that the whole world is created in God's image is to say that the whole of creation, every inch and ounce of it, is created for relationship. Growing in the divine likeness, reaching our true destiny as persons, is realized as we participate ever more fully in the mystery of this holy communion. And this we do as we seek to establish and sustain right relationship with self, another, others, God, and with every living creature22 Various expressions of religious life in community have sought to embody this mystery of communion. Community life and communal commitment give form to, or bring to speech, the mystery of trinitarian communion. Re!igious communities and communal commitment have been expressive of, embodiments of, a language of communion. But there is no strict equation between community and communion. The relational matrix at the heart of all the living will not pass away. It alone is the ground on which we stand, and which will withstand the splintering and shattering of the forms that have sought to speak its mystery. Butit may now be time to "speechify" this mystery of communion through the articulation of new cultures of communion that express more adequately the emergent understandings of God, human life, history, the world, and the church. It is quite possible tha~ the good word amid all this hard news is that vowed members of religious institutes have occasion to lean into, fall into, the mystery of communion--the very mystery of God whose very being is to be in relationship. This holy communion of persons divine and human is beneath and beyond all the forms. It is Hope is allowing something to come into life that is not self-generated. March-April 1999 Downey ¯ Luminous Traces the gift given by the Word whose name is Love beneath and beyond all other words. Amid the rubble the Spirit of God in hope comes, perhaps offering an alternative possibility to the worldview which shaped us to the core, offering in its place the possibility of creating a culture of communion as a gentle corrective in the face of the narcissism, pragmatism, and restlessness of our age. At this stage it is all too easy to offer forecasts about the forms religious life will take, in view of such factors as greater collaboration with lay associates and the need for a sharper ecclesial identity and a stronger sense of corporate mission according to the charism of an institute's founders. It would be easy to provide practical directives for the reconfiguration of community as participation in the mystery of communion. But doing so might be one more instance of clinging to the culture that is passing, of holding on to a worldview that would offer a consoling sense of certainty regarding an inevitably brighter future--replete with false promises and unreliable guarantees. Forecasts, clear pictures, and precise directions are at odds with the logic of the trace. What is yet to be will be shown as we make our way into the fullness of the trinitarian communion by following the traces, the luminous traces Christ has left in the gospel. Further, to see in Christ the trace of the trinitarian communion in which we live even now. Whatever new forms of religious life and communal commitment are coming to be will be cultivated and sustained only by prayerful participation in this holy communion wherein we may be given the courage to live with just a trace. Then follow it. In the shattering of ~hat we hold most dear, it is possible to see with new eyes, as if for the first time. Everywhere there are luminous traces of the mystery of communion, hidden from those who keep squinting.and straining for a neat and tidy worldview, or from those who want to build a religious culture of the rubble of the past. As religious communities continue to stretch their numbers and splinter yet further, astonishing acts of faith and love and hope continually spring forth between the cracks. Vowed religious go on, convinced that they will find a way forward. And, if there is no clear path ahead, they will make a way by responding to the gift of God's constant coming; they will follow the traces deeper and deeper into the mystery of communion between and among persons both human and divine. The traces shimmer, sometimes so brilliantly as to blind the clear-sighted: a dazzling darkness! At this juncture in the history of religious life, vowed members in Review for Religious communities of commitment are learning from the inside out the wisdom at the heart of the Christian mystic's experience of Light: If you want to be sure of the path you are on, then close your eyes and walk in the dark. It is hope, and hope alone, that takes the next step. And the next. Notes l Though I am describing the shift from "modernity" to "post[-I modernity," I am avoiding use of that terminology here. Helpful descrip-tions of the emergent post[-]modern consciousness include: Stanley J. Grenz, A Primer on Postmodernism (Grand Rapids: Eerdmans, 1996); Richard Kearney, The Wake of Imagination: Toward a Post-Modern Culture (Minneapolis: University of Minnesota, 1988); Paul Lakeland, Postmodernity: Christian Identity in a Fragvnented Age (Minneapolis: Fortress Press, 1997); David Tracy, Plurality and Ambiguity: He~vneneutics, Religion, Hope (San Francisco: Harper and Row, 1987). 2 For a good example of the turn to historical fact in Christian the-ology, see Johann Baptist Metz, Faith in History and Society: Toward a Practical Fundamental Theology (New York: Seabury, 1980). See also Johann Baptist Metz and JOrgen Moltmann, Faith and Future: Essays on Theology, Solidarity, and Modernity (Concilium; Maryknoll: Orbis Books, 1995). 3 See, for example, Elizabeth Johnson, "Does God Play Dice? Divine Providence and Chance," Theological Studies 57, no. 1 (March 1996): 3- 18. 4 For a treatment of the interruptive character of history, see The Holocaust as Interruption (Concilium), ed. Elisabeth Schiissler Fiorenza and David Tracy (Edinburgh: T. and T. Clark, 1984). 5 For a treatment of some of the issues involved in naming the God who cannot be named, see Jean-Luc Marion, God without Being, trans. Thomas A. Carlson (Chicago: University of Chicago Press, 1995). 6 See Ronald Rolheiser, The Shattered Lantern: Rediscovering the Felt Presence of God (New York: Crossroad, 1995). 7 While others have emphasized the relational character of God and its implications for human and Christian life, I am particularly indebted to the contribution of Catherine Mowry LaCugna, God for Us: The Trinity and Christian Life (San Francisco: Harper, 1991). 8 William E Lynch, Images of Hope: Imagination as Healer of the Hopeless (Baltimore: Helicon Press, 1965), p.9. 9 Lynch, p. 21. 10 For a fuller treatment of my understanding of the dynamics of hope, see Michael Downey, Hope Begins V~here Hope Begins (Maryknoll: Orbis Books, 1998). ~ Post[-]modernist Jacques Derrida uses .the image of the trace to March-April 1999 Downey ¯ Luminous Traces avoid speaking of presence. The image is also used extensively by Emmanuel Levinas and Paul Ricoeur. In Ricoeur the term is associated with the distanciation of the text. What is found in the narrative of an event but the trace of the event? There is no immediate access through any kind of historical reconstruction or through the forging of univocal meaning. It is intriguing that Th4r~se of Lisieux drew on the image of the trace in speaking of her faith and confidence even in the depth and dark-ness of her trial as she neared death. The title of this presentation derives from TMr~se. She writes: "Since Jesus has reascended to heaven, I can follow him only in the traces he has left; but how luminous these traces are! How perfumed! I have only to cast a glance in the Gospels . " See her Story of a Soul, trans. John Clarke (Washington, D.C.: ICS Publications, 1976), p. 258. ,2 For a treatment of the implications of a thoroughly relational understanding of God for the Christian spiritual life, see Catherine Mowry LaCugna and Michael Downey, "Trinitarian Spirituality," in The New Dictionmy of Catholic Spirituality, ed. Michael Downey (Collegeville: Liturgical Press, 1993), pp. 968-982. Easter (at a retreat house surrounded by cemeteries) Our propensity (as part of nature) is to f!ll up emptiness. Graves hunger for bodies and for earth and, in time, more earth as,flesh diminishes to nothing. But emptiness is essential for God. The hollow of a nest is just right for hatching and only when egg and tomb lie empty does life emerge. Eugene Cartier Review for Religious DORIS GOTTEMOELLER Community Living: Beginning the Conversation Fmor several years I have had the growing perception that com-unity living may be the Achilles' heel of contemporary apos-tolic religious life. ("Achilles' heel" means a point of special vulnerability. Referring to the ancient myth, the dictionary defines it as "a small but mortal weakness.") Before I proceed, let me make two clarifications abdut this perception of mine. First, I see a prob-lem not with community in the abstract (an ideal which we all affirm), but with community living, an experience that is tangible and daily. Secdnd, I sense that our vulnerability consists in our inability to see what this commitment, this ideal, really requires of us. Often the mere mention of the topic brings about an awkward silence, embarrassed dismissals, or defensive equivocations. We have all heard, and perhaps even voiced, statements like these: "Community doesn't mean living under the same roof" . "My ministry is so demanding that I need time and space apart just to keep going" . "I don't want to participate in a basically dysfunctional lifestyle". "My parish [or my ministry team] is my community" . "There are no opportuni6es for community living in my locale" . and, from someone relocating her ministry, "I refuse to go from community to community and ask if they are willing to have me." Doris Gottemoeller RSlVl wrote "Religious Life: V~rhere Does It Fit in Today's Church?" in our March-April 1998 issue. The present article was her contribution to the sy~nposium at the Jesuit Center for Spiritual Growth in ~,rernersville, Pennsylvania, in October 1998. Her address remains Sisters of Mercy of the A~nericas; 8300 Colesville Road #300; Silver Spring, Maryland 20910. March-April 1999 Gottemoeller * Community Living I believe that our inability or unwillingness to answer the questions of what community living means today and what our common obligation or commitment is weakens our credibility internally and externally. We ourselves have failed to get a clear vision of community that we can agree on and live together in, and outsiders take note of a number of confusing appearances. When we are ambiguous about this significant dimension of consecrated life, can we invite potential new members to explore this life? A number of factors and circumstances have brought us to this point of confusion and uncertainty. The adaptation and renewal mandated by Vatican Council II led us to discard many styles and expressions of community that are no longer relevant to contemporary culture and ministry. Economic factors such as the loss of parish convents, the conversion of former motherhouses to other uses, and the withdrawal from many sponsored ministries (hospitals, colleges, high schools) meant that sisters have had to seek other places to live. These are usually rented (and therefore impermanent), not associated with a ministry site, and able to accommodate only a small number--one, two, or three sisters. In these transitions we were clearer about what we were discarding than what we were choosing. (Indeed, we make choices of living arrangements today amid a flurry of considerations: companionship; cost; proximity to work, family, community members, other friends, and doctors; comfort; witness to simplicity; and so forth. All of them are legitimate, but not all are equally significant to the congregation's mission.) Moreover, after a site for community living has been chosen, there is often no set of expectations concerning behavior in one another's regard. A further indication of the silence that surrounds this issue is the nonreception given the 1994 document on community published by the Congregation for Institutes of Consecrated Life and Societies of Apostolic Life (CICLSAL): "Fraternal Life in Community." In my view this document is a clear and sympathetic statement of the present situation of community living, offered "to support the efforts made by many communities of religious, both men and women, to improve the quality" of their community life (§6). Its composition was preceded by co.nsultation with religious in many parts of the world. It has, however, been largely unnoticed or ignored by religious--for several possible reasons. The first is, of course, its unfortunate tide.~ A second possible reason was voiced by a sister in my community: "It gives an excellent presentation of Review for Religious ? the present situation, but the solutions offered are not helpful." Is this not tantamount to an admission that the responsibility for finding solutions belongs with us? A third possible reason is the widespread resistance to any consideration of the topic--in other words, our Achilles' heel. We were not yet ready in 1994 to entertain any discussion of this issue that lies close to the heart of our vocation. Perhaps we are still not ready. But in the interest of testing that premise--and of beginning a conversation--I would offer some starting points. These reflections are offered in response to six questions: (1) What are we talking about when we talk about community life? (2) What is its theological basis? (3) What can we say about a spirituality for community living? (4) What is the role of leadership in community living? (5) What are some special challenges to living community life today? (6) What can we do to renew this dimension of our community life? Note that these questions do not focus on the past, on our previous experience of community living, or on all the factors that have altered it or contributed to our present situation. Some current resources for the reflection are "Fraternal Life in Community" and the apostolic exhortation on consecrated life, Vita consecrata. In addition, and more significantly, each congregation brings its own charism, mission, and experience to the consideration of community living, and the insights shared and directions chosen will not necessarily be the same for each congregation. What are we talking about when we talk about community living? It is impossible to describe community living in a way that anticipates every circumstance, style, and modality. As noted above, we are not talking about an abstract idea, but about a social experience. I would suggest that, put as simply as possible, community living is what happens when two or more people relate to one another in a significant, mutually beneficial, and ongoing way. A significant relationship is one which is weighty, valuable, more than casual; it is multidimensional, not just spiritual, financial, social, or spatial. It is more than spiritual, that is, meeting regularly to pray together. It is more than financial, that is, sharing resources and accountability for the use of Community living is what happens when two or more people relate to one another in a significant, mutually beneficial, and ongoing way. March-April 1999 Gottemoeller * Community Living them, It Jis more than social, that is, gathering for periodic card games, meals, nights out, and so forth. It is more than spatial, that is, living under the same roof or in close proximity to one another. The relationship is significant because all of these dimensions are integrated in a mutually beneficial and ongoing way. A mutually beneficial relationship contributes to the greater integrity and well-being of each participant. It is not crippled by immature dependencies, but strives for a healthy adult mutuality of responsible caring. "Carrying one another's burdens" in time of sickness or special need is an obligfition and a privilege of community life. The benefits sought and exchanged are on many levels, for example, relationship, spirituality, ministry, and, in some cases, mentorship in a new way of life. Finally, I would suggest that a bona. fide experience of community living is ongoing. It is a stable, predictable arrangement, not a succession of sporadic episodes or chance encounters:~ In essence, community members say to one another, "I will be there for youl you c~n count on me," whatever the circumstance or need. Continuity is essential to build trust and undergird mutual expectations. Notice that this description of community living does not say anything about specific situations such as living alone, in twosomes, or in large or small communities. It should be clear, however, that "two or more people in a significant, stable, mutually growthful relationship" does not include busy professionals who only cohabit for the sake of convenier~ce and economic efficiency. It does not include "boarding houses" where anonymity and inde~pendence are the chief values. Instead, .we are talking about good-faith efforts to live a principal value of religious life. With few exceptions it will include a common residence. What is the theological basis for community living? This is a question calculated to make the eyes glaze over, because it sounds so theoretical. It is, however, the fundamental question of motivation. Why do we choose a life of community? Beyond economy, efficiency, convenience, friendship, or natural attraction, what are the reasons that are rooted' in faith, that speak to the core of our identity as apostolic religious? Are there reasons which flow from our commitment toseek God that we call a~religious vocation? I would suggest two lines of reasoning or justification for community living, starting from personal call or vocation and from ecclesial identity. Review for Religious Each of us experienced a call to a way of life, an invitation from Jesus Christ to a life of greater intimacy. We joined our various congregations because membership in that congregation makes pursuit of that way of life possible. A "way of life" is a constellation of fundamental life choices having an internal coherence and consistency. One's way of life is defined by choices about relationship to God, to the Christian community, to sexuality, to possessions, to companions, to those in need. The way of life known as religious life is a radical response to the call of Jesus who says, "I am the way." The internal coherence of a way of life means that all the parts reinforce one another. For example, community life supports and is shaped by the practice of evangelical poverty. Together we share our earnings to provide for our needs and the needs of others. Together we decide how much is enough, whether for today or for our future. A single person living alone in the world could take a vow of poverty, but it would not be the same vow that religious take. It would differ in its expression and its obligations. Similarly, community life supports and is shaped by the practice of the vow of celibacy. Together we can accept the loneliness of unmarried life because of the companionship of one another. Together we witness to the surpassing love of Christ Jesus, who calls us to be for one another in community. And so forth. Obedience, prayer, mission-- all are shaped by and within community. Community living is not an accidental dimension of the way of life we have chosen, but a determinant of the way in which we realize every other dimension. This assertion needs special emphasis with respect to ministry. Before the synod on consecrated life, there was a fear expressed in some quarters that the outcome would be an affirmation of "consecration" over against "mission," of being vs. doing, and that this emphasis would be used to promote a quasi-monastic lifestyle. In actuality, however, the synod document expresses a beautiful integration of consecration and mission: "By the action of the Holy Spirit who is at the origin of every vocation and charism, consecrated life itself is a mission, as was the whole of Jesus' life" (§72). In other words, the life itself, in every dimension and in its totality, is apostolic. Therefore, if the demands of ministry are such as to diminish adherence to the other aspeCts--for example, prayer or community life or obedience--then an imbalance has been created which needs to be corrected. A reflection on the relationship of ministry to community is a March-April 1999 Gottemoeller * Community Living good segue into a reflection on the ecclesial identity of religious life and its implications for community living. Vita consecrata presents community living as an especially eloquent sign of ecclesial community, that is, of the church's fundamental identity. Community demonstrates that sharing in trinitarian communion can change human relationships and create a new type of solidarity, not built on family ties or natural attraction, but on common values and commitments. "In this way it speaks to people both of the beauty of fraternal communidn and of the ways which actually lead to it. Consecrated persons live 'for' God and 'from' God, and precisely for this reason they are able to bear witness to the reconciling power of grace, which overcomes the divisive tendencies present in" the human heart and in society" (§41). Community is described as a "God-enlightened space in which to experience the presence of the risen Lord" (§42). It is a life in communion, which signifies and enriches the church and renders it better able to carry out its mission. Of course, being a sign of something implies a certain visibility. We have to ask: To what extent is our experience of community living visible? Who knows that sisters are present in an apartment building, a neighborhood, or a parish, and what does it sayto them? People in the world today hunger for an experience of community, for evidence that it is possible. In fact, a few years ago a group of intellectuals and public-policy experts formed a new movement called the communitarian movement. Its goal is to strengthen participatory democracy and to call on citizens to balance rampant individualism with a concern for the common good. Healthy religious communities balance individual needs with the common good day after day, in small ways and large. We do it out of love for God and for the sake of mission. If we find ways to share this experience with others, it can make the church more visible and be a gift to the world. What can we say about a spirituality for community? If the theological question deals with the why of community, the spirituality question deals with the how. What kind of spiritual focus, what kinds of practices, nourish and support community life? The first hallmark of community is that it be apostolic or outer-directed. "Not for ourselves alone" should be the watchword. As we said above, consecrated life is apostolic in its very essence. It is not that persons in religious congregations do apostolic works or have individual ministries, but that the whole way of life is for the sake of Review for Religious making visible and attractive the love of God. Community life, therefore, as an intrinsic element of the consecrated life, should be mission oriented in its intentionality and expression. An apostolic community welcomes neighbors and friends and even, at times, aliens and strangers. An apostolic community weaves the needs of the world into its spiritual consciousness and common prayer. An apostolic community shares its resources with the needy. An apostolic community responds to the concerns and priorities of the larger congregation. An apostolic community welcomes new members and introduces them to the way of life. In short, an apostolic community is not turned in on itself, isolated and self-sufficient, but open to receive and share with others. Community life is nourished by dialogu4 and prayer, ritual and celebrations. We are embodied people who need tangible expressions and symbols of shared values and commitments. From time to time we need to say what we believe in, what we question and wonder about, what we care about, and we need to hear others do the same. Every local community will have its own points of intersection, its own rhythm of coming together to speak to one another and together to speak to God. Many of today's religious entered their congregations at a time when the lifestyle was burdened with customs and practices that were no longer appropriate for contemporary life. In rejecting these, however, we sometimes lost sight of the fac.t that we still need tangible expressions of common beliefs and values. In a healthy community life, regular expectations, mutually agreed on, are complemented by spontaneous gatherings and special events. Prayer together furnishes moments of special intimacy. The congregation, in its constitutions and policies, should articulate some expectations that are common to all settings, while leaving room for local creativity. It is too great a burden for local groups to renegotiate everything every year or whenever there is a change in the membership. The common expectations should incorporate congregational feasts, texts, and traditions. Community life requires asceticism. No surprise here! We all Community demonstrates that sharing in trinitarian communion can change human relationships and create a new type of solidarity. March-April 1999 Gottemoeller * Communi~ Living know that community living involves virtues and practices such as self-discipline, generosity, tolerance, and patience. It requires deliberate choices to be available to others, even to be inconvenienced by them. From time to time it gives us opportunities to "bear wrongs patiently" and to seek and to give forgiveness. Community life :is a privileged venue for discernment. The evangelical counsel that is most intrinsic to community life is obedience, not only in the sense of approvals for ministry and residence choices, but also in the sense of holding oneself open to the ongoing promptings of the Spirit in both small matters and large. The place where those prompfings can be heard, the persons who can articulate them, are often found in the local setting. Members in community are not on individual spiritual journeys that only occasionally intersect, but on a shared journey where the challenge or misadventure of one can become an opportunity for all. What is the role of leadership in creating and sustah~ing community? Over the years I have noticed the ease with which we affirm leadership in ministry and the difficulty we have affirming it in community. For example, if someone is an excellent principal or parish administrator or earns an award or grant for a creative ministry project, we are happy to congratulate her and to publish the achievement. We fail to notice, however, that congregations also have members with natural gifts for leadership within community. Here I am not thinking particularly of administrative skills, but of the ability to call the members to unity, to prayer, to responsibility for shared commitments, to celebration, and to reconciliation when needed. Years ago these were some of the responsibilities of the local superior. But now, with that role largely absorbed by province administration and with a collegial lifestyle in the local setting, we no longer have access to, nor honor, these gifts for community building. 1 am not suggesting that congregations institute an annual award for community, but I do want to point out that some sisters have special gifts for bringing out the best in the rest of us. By their example and by their initiative they help us create a more vibrant community life. Further, I suggest that this is not a second-order gift, less important than the ability to create and sustain new or difficult ministries. It is an essential gift that needs to be recognized and affirfi~ed for itself. This is particularly true because the sister Review for Religious who is especially adept at community building is often someone who is especially good at attracting, inviting, and welcoming new members, an activity that is vital to the congregation's future. I suspect that the gifts for community building are more widespread than we realize and that, by honoring them, we may encourage one another to cultivate them. In his book Religious Life as Adventure, Albert DiIanni SM says that the effective regeneration of religious communities depends on leadership from below, arising from the religious instincts at the grass roots. He counters to a degree the Nygren-Ukeritis study indicating the importance of visionary leadership for successful renewal. He suggests that this study may contain a hidden assumption, namely, that the present crisis in religious life is a functional one, a lack of leadership skills. In contrast, he maintains that the crisis has deeper roots, that it is a crisis of enthusiasm and faith, and that, if this is so, nothing will serve but a conversion of heart in a significant number of members at the base, a re-forming of congregations at the level of their faith.2 We all know of places where community is lived with special vibrancy, authenticity, and zeal. We all have women in our midst who live the life with generosity and joy. One problem we face is that too often these individuals are isolated from one another and thus their influence is dissipated. They can grow discouraged and settle into ruts of middle-class complacency--then the congregation's mission and charism are further diminished, less visible. My leadership team once had a conversation about the possibility of bringing some of these sisters together to create a "critical mass." We rejected the idea because we did not want to seem to be recognizing an "elite," or to suggest that what is required of.a Sister of Mercy is beyond the reach of any member. We decided that what is needed for vibrant communities are clear expectations, clearly expressed and honored by all. The goal is for every expression of community living to be intentional rather than associational. What are some special challenges to living community life today? There are a number of them. They are signs of our times, and represent significant challenges for individuals and congreghtions desirous of renewing community life. One is our relationship to the life of the parish and the local church. At one time most local communities were associated with parishes. The parish convent and the sisters in residence there were a symbol of the compassionate face of the church, a center of hospitality and help in time of need, March-April 1999 Gottemoeller ¯ Community Living and a witness to the reality of our way of life. Today there is no common venue where we are present. For those who would like to know more about us, there is no place to "look" for us. Perhaps a communal choice to participate in a specific parish community-- rather than shopping around for liturgies at convenient times or with congenial celebrants--might be a means of community renewal and public visibility. Related to the demise of the parish convent is the general disappearance of congregational properties for community living. As motherhouses are sold or converted to other uses and as sisters are dispersed into varied ministries, congregations have fewer sites that can accommodate a community gathering of more than two or three. Sisters gravitate into apartments because it seems there are no other choices. Congregations favor rentals because they cannot afford to purchase properties or because they have no assurance that" sisters will use congregational properties if they make them available. Of course, if a congregation's commitment to community life includes, for example, common prayer, hospitality, public witness, and multigenerational living, that commitment would involve making suitable residences available and using them. Another challenge is our simultaneous participation in multiple and sometimes intersecting communities. Our parish, our ministry setting, our professional colleagues, our family, and our friends can all make legitimate claims on us. In addition, we may be drawn to specific ecclesial and social groups such as the charismatic movement, the pro-life movement, or Call to Action. These commitments can enrich community life or strain it beyond endurance. It calls for a special discernment to strike the right balance, but participation in community life should enjoy a priority in virtue of its connection to the essence of our vowed commitment. A further challenge is the responsibility for the care of aging parents. Surely no one has a greater call on our generosity than those who have given us life. In some cases it means taking time outside other community and ministry duties to help with shopping, transportation, and similar needs. Occasionally the only way to respond to parents' needs may be to move into the family home in order to provide day-to-day assistance. These situations call for a special sensitivity on the part of community members to different family circumstances. An important question is: How can they share the burden and support one or more individual members in their ministry to their parents? Review for Religious Perhaps the most difficult challenge is the drift towards living alone. There are, of course, some reasons that justify this option. Most congregations have a few members whose psychological health is so fragile that they are unable to cope with the requirements of community living. Sometimes their coping mechanisms involve behaviors that make it extremely difficult for community members to live with them. These conditions warrant living alone, for as long as the conditions persist. It is a special responsibility of leadership to support the well-being of these members. To take another case, some ministry needs would go unmet were it not for some sisters' willingness to live, for a time, apart from the daily support of community life. A question for discernment is whether or not the ministry was chosen precisely to justify .living alone. As in the case of sisters living with aging parents, community members will want to reach out to support the individual who is at a distance. Beyond these two circumstances (and absence for the purpose of study), there is a growing tendency to justify living alone solely on the basis of personal choice. Where this choice has gained a legitimacy on a par with other community choices, the congregation's community life would seem severely compromised. Such a. choice--particularly if the sisters are healthy and actively engaged in ministry--deprives other members of the benefits of their companionship and reduces the number of community settings available. Further, the choice fails to uphold the responsibility to provide communities that can nurture new membership. Unfortunately, in some congregations the issue of living alone is so neuralgic that it cannot even be discussed, let alone challenged. Finally, our experiences and desires regarding community living are affected by intergenerational and multicultural issues. Age and ethnicity (and sociocultural background, education, ministry experience, and other factors too) may condition one's style of participating in community. At times these differences may be experienced as gift, at other times as limitation. The need to In some congregations the issue of living alone is so neuralgic that it cannot even be discussed, let alone challenged. March-April 1999 ,Gottemoeller ¯ Community Livin~ integrate these differences sensitively is one more reason for being clear about the congregation's expectations for community living. Moreover, in a world torn' by division and conflicting interests, "the presence of communities where people of different ages, languages, and cultures meet as brothers and sisters, and which remain united despite the inevitable conflicts and difficulties inherent in common life, is in itself a sign that bears witness to a higher reality.''3 What steps can we take to renew our community life? First, we can break the silence. We need to ask questions like: What would attract a young person to investigate our way of life? How would we welcome a potential new member and show her what our life is like? How is my spirituality nourished from our communal roots? How .does our way of life give visible witness to simplicity, communal sharing, prayer, love for one another, zeal for the gospel? We can no longe~r take for granted that nothing can be said about these matters. We may discover, in the conversation, that there is a hunger among us to talk about expectations, to be challenged out of complacency, and to live our communal life more intensely. In addition to beginning a conversation, we can resolve to "go with the life," wherever it is happening. We can affirm the vibrant communities that already exist, recognizing that they are not just happy accidents, but the fruit of effort and conviction. We can direct our financial and personal resources toward creating new communities among individuals who are willing to take the risk. We can invite other members to join existing communities that are vibrant. We can share our experience of community with associates, parishioners, inquirers, in ever widening circles. But this will be effective only if at the center a group of deeply'committed religious are living their vocation with sincerity and passion. I began these reflections by asserting that our inability to be clear about our understanding of and commitment to community living is a potentially fatal weakness. What followed were some thoughts designed to prompt the discussion and discernment that most congregations urgently need. Let me cite here a phrase that is the subtide of the document "Fraternal Life in Community": "The Love of Christ Gathers Us into Unity." This phrase captures the motive and dynamism of community life. Only the love of Christ is enough to support and sustain this way of life. Love attracts and gathers us. The process is never finished, always calling us to greater unity, greater generosity, greater zeal. This is an ideal from which we will all fall short, but one which will never be approached Review for Religious unless it is articulated in behavioral expectations appropriate to the charism and mission of a congregation. Not everything has been said here, but perhaps these reflections will be enough to break the silence and begin the conversation. The time has come, I believe, for us to consider community living with fresh eyes. The consideration can be the key to our ongoing conversion and our authentic renewal. Notes ~ During a visit with the Congregation for Institutes of Consecrated Life in 1993, the officers of the Leadership Conference of Women Religious and the Conference of Maior Superiors of Men pointed out the unsuitability of the title. The only recognition of our objection, how-ever, is a note saying: "In this text, 'fraternal' and 'fraternity' refer inclu-sively to both women and men and are, in the iudgment of the translators, the words most apt in English for conveying the fullness and warmth of communion which lies at the heart of community." 2 New York: Society of St. Paul, 1994, pp. 96-97. The Nygren- Ukeritis study referred to is "Religious-Leadership Competencies," Review for Religious 52, no. 3 (May-June 1993): 390-417. 3 "Fraternal Life in Community" (1994), §56. How Often Must I Forgive? (Matthew 18) The first purple crocuses of spring forgive your indifference, your neglect of alleluias at sunshine and the reassuring spill of birdsong . from still-bare maples. March forgives your detraction and contempt for its necessary gusts and its mud like that made by Jesus with spittle and now rubbed on the face of your yard to cure it of winter. Pa~ricia Schnapp RSM March-April 1999 1dO - - LEON McKENZIE The Credibility of Jesus' Resurrection: Two Interior Witnesses St. Augustine of Hippo once asked a fascinating question about the believability of Jesus' resurrection from the dead.1 The raising of a dead man to life was as much a mystery of unspeakable proportions then as it is today, and Augustine wondered whether the proclamation of the resurrection is credible or incredible. Suppose bodily resurrection is essentially unbelievable. From Augustine's perspective in the early 5th century, most of the world believed that Jesus rose from the dead and ascended into heaven. This raised two points for consideration. On the one hand, if millions of Christians believed despite the incredibility of the Gospels, belief in the resurrection would itself be miraculous and a sign from God supporting the Christian message. On the other hand, if multitudes of Christians believed because the resurrection is credible, it would imply the resurrection is essentially believable. Nonbelievers, then, must ask themselves why they find it impossible to believe. The saint's scholarship in the art of persuasion and logic is evidenced in his formulation of the question. After reflecting seriously on the issue, it is with some ease Leon McKenzie EdD, professor emeritus at Indiana University, recendy published Pagan Resurrection Myths and the Resurrection of Jesus: .4 Christian Perspective. His address is 274 Adrienne Drive; Greenwood, Indiana 46142. Review for Religious that one arrives at the conclusion that the proclamation of Jesus' resurrection is highly credible. The Appeal of the Kerygrna The resurrection was credible to early Christians, in part because they heard the Good News heralded by apostles who were soon to suffer for the truth of what they announced. After the last of the apostles died, others announced the gospel, often at the risk of their lives. As historians note, those who heard the testimony of the martyrs and early apologists accepted the Good News of Jesus' resurrection in very large numbers. Beyond the valor of those who preached the resurrection, the message itself possessed its own intrinsic appeal. Evidently something subtle was working in the lives of converts to the Way, as the Christian life was called, something that made the Good News eminently credible. I suggest that two interior witnesses of great power were at work: the voice of the resurrection archetype and the voice of the Holy Spirit. The Resurrection Archetype An archetype is a pattern in the mind and a standard for discerning meaning. The profound depths of each human heart are shaped in such a manner as to influence a favorable response to the message of resurrection. This archetype can be compared, in a manner of speaking, to an instinct for what is true and good, to a natural power to grasp what is tremendously significant for human existence. This meaning structure of the human psyche, I propose, has been learned over countless years of universal human experience. The resurrection archetype cultivates a natural appetite for the central proclamation of the Christian faith, the resurrection of Jesus. The testimony of the Holy Spirit builds on this natural archetype and urges us, at the supernatural level, to affirm Jesus' resurrection as God's decisive word in history. The resurrection archetype takes its form from everyday experiences of members of the human race. The great theme of death and resurrection is etched indelibly on the world. The workings of the world reveal the death-and-resurrection motif in ordinary natural processes. Sometimes our experiences of these March-April 1999 For those who look, death and resurrection themes positively abound in our experience of the world. McKenzie ¯ The Credibility of Jesus' Resurrection patterns of death and resurrection are so subtle that we fail to advert to them consciously. Nonetheless, these daily "texts" spelling out the meaning of the cosmos eventually enter into our hearts. Someone once said, "A perfume of promise is in the air." Even in the natural world, the very air seems to hold a promise of resurrection. Many resurrectiori themes are active in our daily lives. All we need do to discover these motifs is observe and reflect. Five of these experiences of death and resurrection are presented here: (1) the daily death and resurrection of the sun, (2) the burial of seeds in the fall and the resurrection of vegetation in the spring, (3) the death of joy that occurs in emotional depression and the eventual resurrection to a new life of happiness, (4) the promise of resurrection in the life cycles of small crawling creatures, and (5) our death each night in sleep and our resurrection in the morning. It must be emphasized again these are simply representative examples~ For those who look, death and resurrection themes positively abound in our experience of the world. The Daily Death and Resurrection of the Sun Each day the sun is born in the east. On many days the arrival of the sun is accompanied by a spectacular show of its glory. The golden disk goes across the sky and descends into the darkness beyond the western horizon at night. We can only imagine the power of this experience for ancient peoples who lacked a scientific explanation of what was happening. Even for us who have a scientific explanation, the experience is substantial. What dies in the gloom of the western horizon arises again in the glory of the morning sky. The Burial of Seeds and the Resurrection of Vegetation How mystifying it must have been for ancient peoples to watch the burial of seeds in the fall and the subsequent resurrection of flowers, young saplings, and crops in the spring. This universal experience of death and resurrection inscribed itself deeply in the Review for Religious human .psyche and was the cause of festivals of joy and promise. This experience was the source of myths of hope, once stripped of fantastic and sometimes bizarre details. Celebrations of new life and stories of renewed life reinforced the resurrection archetype. The Death of Joy and the Resurrection of New Life Perhaps every normal individual has experienced the death of joy on the occasion of the ordinary depression associated with such events as the death of a loved one, the loss of a friend due to a thoughtless word, the loss of a job, and even the losing of a pet dog or cat. Some persons undergo more serious depression and begin to believe they will never again experience happiness. Eventually the day arrives when joy returns, laughter is possible, and a resurrection of sorts takes place. The resurrection archetype grows stronger in our heart of hearts. The Promise of Resurrection in Small Crawling Creatures There is a hint of the resurrection of Christ, and our own resurrections with him, even in the small crawling creatures of the natural world. The larval grubs entombed in the earth emerge as beeries. The caterpillar wraps itself in a chrysalis only to come forth again as a beautiful butterfly. In its most elemental forms, nature displays signs of resurrection hope. Ancient peoples, much less distracted than we are today, could, not have missed reflecting on what meaning resides in the transformations of the least of God's creatures. The Death of Sleep and the Resurrection to Consciousness Perhaps nothing in our lives comes closer to modeling the death and resurrection motif in our experience of the natural world than the phenomenon of sleep. We lose ourselves in sleep and put aside conscious advertence only to regain ourselves and our consciousness in the daily resurrection that occurs with our awakening. At one level of explanation, we fall asleep because we are tired and arise because we are refreshed. At a more profound level of interpretation, we fall asleep and rise again as a sign of death and resurrection. These repeated experiences, universal in their scope among human beings, wrought profound developments in the resurrection meaning-structures of the collective unconscious of the race. It is not at all difficult to believe that God put resurrection motifs into March-April 1999 McKenzie ¯ The Credibility of Jesus' Resurrection the world as promises of the defining event in human history, the resurrection of Jesus Christ. Functions of the Resurrection Archetype How has the resurrection archetype functioned? First, after taking form in the hearts of people who lived long ages ago, it found its way into myths that sages and storytellers told and retold about gods who died and came to life again--particularly agricultural gods, in accord with the seasons of growing. How these myths may have come to be is an interesting process, but one that is too complicated to review within this brief article.2 Suffice it to say that the resurrection archetype was the primary guide for the mythmakers who created "once upon a time" stories of gods who regularly descended to the underworld and returned later. Frequently these myths were used to explain why vegetation died in the fall and was reborn in the spring. Second, in accord with divine providence, the archetype worked to prepare the way for the acceptance of the risen Lord. After Jesus' resurrection, it continued providentially to provide, at a natural level, an interior witness to his resurrection. Upon hearing the announcement of Jesus' resurrection, a bystander who was open to God might think, "This sounds very interesting. This message resonates in my soul. The proclamation of Jesus' resurrection is supported by my entire experience of the workings of the world. Perhaps my experience of the death and resurrection themes in nature was God's way of preparing me for this message about Jesus." Now this initial natural attraction to the notion of Jesus' resurrection would probably not be put into words. Instead, the bystander in the preceding paragraph probably experienced an unspoken intuition that stirred a natural feeling favorable to the Good News. For some indefinable reason in the bystander's mind, he or she would have felt drawn to the message. Creation and the Resurrection Archetype One final issue about the archetype must be considered. The resurrection archetype" in the depths of the human psyche grew out of the universal experience of the resurrection theme in the workings of the world. But how did it happen that these Review for Religious resurrection motifs came to exist in the world? The answer is related to the very creation of the world. We read in Genesis that God created the heavens and earth and "the earth was without form and void, and darkness was upon the face of the deep" (Gn 1:1-2). In the act of creation God rescued the world from its own nothingness. From nothingness God brought forth a dynamic world that participates in his own being. This "stamped" the world, so to speak, with the pattern of death and resurrection. The very act of bringing cosmos out of chaos is the fundamental motif of death and resurrection that is repeated everywhere in the workings of the world. The resurrection themes we experience it the world are the "traces" of the first act of creation. They are reminders of creation. The signs of resurrection manifested in the world of our experience are hallmarks of a God who brings forth something out of nothing and life out of death, a God who does things we might deem "impossible." We are heirs of the Father with Jesus, and our inheritance is everlasting life. The Holy Spirit The second interior witness to the truth of Jesus' resurrection is the Holy Spirit. One of the most revealing New Testament passages concerning the Holy Spirit's testimony to the resurrection of Jesus is Romans 8:1-17. The passage speaks to a number of major ideas. It seems as if St. Paul experienced a flood of rich insights as he dictated his letter to his scribe Tertius. "The mind that is seton the flesh is hostile to God," Paul says; "it does not submit to God's law---indeed, it 'cannot, and those who are in the flesh cannot please God." A little further along Paul says, "If the Spirit of him who raised Jesus from the dead dwells in you, he who raised Christ from the dead will give life to your mortal bodies also through his Spirit which dwells in you." Finally, Paul concludes this passage by noting, "When we cry, 'Abba! Father!' it is that very Spirit bearing witness with our spirit that we are children of God, and if children then heirs, heirs of God and joint heirs with Christ." The Holy Spirit is our interior witness to several truths, all of March-April 1999 McKenzie ¯ The Credibility of Jesus' Resurrection which are closely connected. First, we are children of God because Christ has set us free from the flesh, that is, from that part of us that is unredeemed. We are, in fact, on intimate, terms with the Father and even address him as Abba or Papa. Second, we are heirs of the Father with Jesus, and our inheritance is everlasting life. This is the life to which Jesus was raised after his death and burial. Third, this inheritance is due precisely to the Spirit of God who raised Jesus from the dead. The Holy Spirit gives witness within us to our adoption, to the risen Christ, and to our inheritance of Jesus' everlasting life. The Holy Spirit testifies to the truth of the resurrection. Credence in the "Incredible" Humanly speaking, and looking only to the surface of things, it seems incredible that someone who is dead could be raised to a new life. Note that Jesus was not merely resuscitated or revived to life in the old flesh. He rose to life in a glorified body (I Co 15:1-47). In the days after the ascension and before the descent of the Holy Spirit on Pentecost, some might have thought that the message of Jesus' resurrection had "almost no chance of being accepted. But those who heard the announcement of Jesus' resurrection--the proclamation of an event long before it became a teaching--not only affirmed the resurrection, but did so in large numbers. People believed not only because they heard the words of the aposdes and their successors, but also because they were attuned to what they heard in their own hearts. That so many new people accepted the Good News of Jesus' resurrection from the dead in the 1 st century and that the Christian faith became so widespread in such a short time seems miraculous. The testimony of credible witnesses such as the apostles to something that seemed incredible in human terms, namely, the raising of a crucified "criminal" to a new life, evoked strong affirmations of faith. Such affirmations, however, would have been futile without the interior testimony of the resurrection archetype at the natural level of human existence and the testimony of the Holy Spirit at the supernatural level. The interior witness of the resurrection archetype and the Holy Spirit transformed a . proclamation that seemed incredible into. something utterly . -I-~6-I believable and altogether inviting. Review for Religious Notes ~ St. Augustine, The City of God, trans. G. Walsh et al. (New York: Doubleday Image Books, 1958), pp. 505-508. 2 See my Pagan Resurrection Myths and the Resurrection of Jesus: A Christian Perspective (Charlottesville, Virginia: Bookwrights Press, 1997). The Recital Sacred was the silence as the tiny woman caressed the keys almost~ possessively. This was bliss: seven cherished friends gathered to hear her heart's story, eager to let her bare the glory of a soul poured out in ardent prayer. She knew they knew she met her God through her Magnificat of making music. Anna Marie Mack SSJ March-April 1999 -.157 CYNTHIA BOURGEAULT From Woundedness to Union ~early fifteen years ago, in his now classic Lost Christianity, .&. ¯ Jacob Needleman argued the need for an "intermediate Christianity" that might bridge the gap between the religion's lofty spiritual teachings and the ability of the average Christian to put them into practice. "Stone must become water before it can flow," he writes. "The pathos of Christendom. is that of preaching to stones that they must flow into the ocean.''~ Midway through the book there is a cameo app.earance by the Catholic monk Father Thomas Keating, at the time (1978) abbot of St. Joseph's Abbey in Spencer, Massachusetts. Here he and a few associates were experimenting with a new prayer form called centering prayer, aimed at expressing the essence of the Christian contemplative heritage in a simplified form accessible to contemporary Christians. In the course of a lengthy interview, Needleman expresses excitement that Keating's experiments might be headed toward recovering that lost link, though he stops short of commending them outright. Among the many debts of gratitude I owe to this book is that it was my introduction to Thomas Keating, who has subsequently become my teacher and friend. In the sixteen years since that Cynthia Bourgeault PhD is founding director of the Maine Monastic Foundation, a network of people attempting to live the contemplative life in the world according to the Benedictine Rule. She is also an Episcopal priest, adjunct professor of spirituality at Bangor Theological Seminary, and a developmental editor for Thomas Keating. The current article has been slightly adapted from one published in Gnosis, No. 34 (Winter 1995). Her address is 526 Isabella Point Road; Salt Spring Island, British Columbia; V8K 1V3 Canada. Review for Religious interview at Spencer, there have been significant developments. A year after Lost Christianity was published, Keating resigned as abbot of Spencer and "retired" to the small mountain monastery of St. Benedict's in Snowmass, Colorado. There local interest in centering prayer quickly snowballed into a national organization called Contemplative Outreach Ltd., now a decade old and some fifteen thousand members strong. In the effort to develop a conceptual framework for the growing ranks of practitioners, Keating has produced a series of books--Open Mind, Open Heart (1987), Invitation to Love (1992), and Intimacy with God (1994)---in which he develops an increasingly cohesive and subtle vision of the Christian spiritual journey, the path of inner transformation that begins when one embraces a regular practice of centering prayer. Keating says, "The method of centering prayer was specifically developed as a dialogue between contemporary psychological models and the classic language of the Christian spiritual path." That "classic language," which envisions a progression through purgative, illuminative, and unitive stages, has guided the journey of many a saint, but for many reasons both good and bad it often fails to resonate with the spirit of our own times, where the prevailing paradigm for transformation consists of woundedness, recovery, and wellness. ls there a way of integrating these visions? Keating's system is an attempt to do just that--to sketch out a road map which begins in woundedness and ends, if one follows it all the way, in transforming union. While most of the elements are individually familiar, the system itself represents a significant new synthesis. Furthermore it is yoked to a powerful meditational praxis through which people change more quickly and deeply than through any other method I have seen. It is not exactly an "intermediate Christianity" according to Needleman's specifications, which he defines as "the accumulation of the force of inner attention" (p. 119). But, functionally, Keating seems to be achieving the desideratum that Needleman described so eloquently: to help stones become water, to take the first steps toward significant inner transformation within a classically Christian framework. Not All Meditation Is Alike Before exploring the intricacies of Keating's paradigm, it is first necessary to understand something of the properties of centering March-April 1999 Bo_ur~eault * From Woundedness to Union prayer. While common understanding might consider all meditational methods basically interchangeable in that they begin by gathering the mind and end by transcending it, Keating's entire teaching rests on the assertion that centering prayer is a distinct method whose most apparent characteristic is a tendency to trigger the unconscious. This discovery, which grew out of direct observation rather than theory, came several years after the progress report in Lost Christianity~ At that time Keating and his associates Father William Meninger and Father Basil Pennington were still thinking in terms of a renewal of contemplative prayer, the creation of an inherently Christian meditation in response to the massive defection of younger Catholics to Eastern meditational paths. Based largely on the 14th-century text The Cloud of Unknowing, centering prayer took its place among other Christian meditational forms sprouting at the time, particularly Christian Zen prayer and the "Christian Meditation" of Dora John Main. It was a devotional method pure and simple, a way of deepening and intensifying the relationship with God. There was at that point no psychological underpinning attached to it, nor even a clue that one might exist. Then in 1983 a charter group of centering-prayer initiates organized the first ten-day Centering Prayer Intensive at the Lama Foundation in San Cristobal, New Mexico, hoping to achieve a more concentrated meditative experience on the general model of a Zen sesshin. While Keating and several others in the group were well-experienced in sesshins, no one was prepared for the volume and vibrancy of emotional outpouring that flooded forth from five hours a day of centering prayer. Tears, repressed memories, deep intuitions all came to the surface in a jumble, along with a sense of catharsis and bonding among the dozen participants that to this day has not faded. From his years as abbot, Keating was used to the gradual sensitizing of the unconscious during the course of contemplative life, but not with such speed and intensity. He recalls seeing "people going through in ten days what it might have taken them twenty years to go through at a monastery." He quickly realized he had a tiger by the tail, and it did not take long to figure out why: it lay in the methodology of the prayer itself. Most meditational methods are concentrative in nature: they start by gathering and focusing the attention, whether by repeating Review for Religious a mantra, following the breath, or focusing on bodily sensation. With centering prayer, however, one starts at the opposite end of the spectrum, "not with attention, but with intention," as Keating puts it. The intention in this case is simply to rest in the presence of God beyond all thought and emotion. A "sacred word" is used in the prayer, but not as a mantra, to be repeated consistently as a focal point .for attention, but simply as a touchstone for intent: when one finds oneself attracted to a thought or emotion during the course of prayer, the sacred word simply serves as a reminder to let go of the thought and rest in the bare presence of God. Thus thoughts may--and do---come and go; the idea is to develop a detached attitude .toward them. One reaches contemplation through the access point of consent, not through focused attention. If meditational methods were arranged on a scale from most concentrative to most receptive, centering prayer would be at the far end of the receptive methods, dropping below even the bare awareness of vipassana (insight) meditation or dzogchen. As Keating suspected--and transpersonal psychology has subsequently confirmed--the more receptive the meditational method, the greater the involvement of the unconscious. Concentrative methods tend to retard this "unloading of the unconscious," as Keating terms it. Receptive methods, on the other hand, foster it, particularly in an intensive group situation such as at that pioneering Lama retreat. But Keating's real intuitive leap was to recognize the import of this observation: this unloading of the unconscious was not an inconsequential side effect, but a significant purification process at work. This was the connecting link he had long been looking for, between purification as traditionally presented in Christian teaching (as a reprogramming of conscious motivation, or the struggle against sin) and the realization by contemporary psychology that such reprogramming goes only skin-deep and in fact can cause serious damage if used for repression and denial of unconscious impulses. "The real ascesis is the purification of unconscious With centering prayer, one starts at the opposite end of the spectrum, "not with attention, but with intention," as Keating puts it. Bourgeault ¯ From Woundedness to Union L ¯ J motives," Keating had long argued--but how to get at them? With centering prayer as a catalyst for the release of unconscious elements, he found his tool and his paradigm. Apophatic Psychotherapy Keating's teaching begins by fundamentally repositioning meditation in the context of a spiritual praxis. Rather than seeing it as a tool for developing concentration, relaxing stress, or accessing higher states of consciousness, he sees it as a catalyst for the purification of the unconscious. This purification is itself prayer. It is not a preparation for relationship with the higher, but the relationship itself. Upon this cornerstone he builds his paradigm of "the Divine Therapy." How does this purification work? As the unconscious unloads during centering prayer, Keating teaches, these small purifications are actually a part of a larger project. One begins to dismantle the "false self,!' the needy, driven, unrecognized motivations that govern most of our untransformed human behavior. Dovetailing classic Christian teaching with contemporary psychology, Keating suggests the false self as a modern equivalent for the traditional concept of original sin. Beginning in infancy (or even before), each of us, in response to perceived thr¢ats to our well-being, develops a false self: a set of protective behaviors driven at root by a sense of need and lack. The essence of the false self is this driven, addictive energy, consisting of tremendous emotional investment in compensatory "programs for happiness," as Keating calls them. It is this false self .that we bring to the spiritual journey; our "true self" lies buried beneath the accretions and defenses. In all of us a huge amount of healing has to take place before our deep and authentic quest for union with God--which requires tremendous courage and inner p~'esence to sustain--escapes the gravitational pull of our psychological woundedness and self-justification. This, in essence, constitutes the spiritual journey. So far this is orthodox psychological and theological fare. But where Keating takes the boldest step is in his assertion that centering prayer is a direct catalyst for this purification of the false self. As one sits in centering prayer, with the intent to rest and trust in God, the unconscious begins to unload "the emotional junk of a lifetime." Repressed memories, pain, and accumulated dull hurt rise Review for Religious to the surface and are, through an attitude of gentle consent, allowed to depart. As Keating visualizes the process, The level of deep rest accessed during the prayer period loosens up the hardpan around the emotional weeds stored in the unconscious, of which the body seems to be the warehouse. The psyche begins to evacuate spontaneously the undigested emotional material of a lifetime, opening up new space for self-knowledge, freedom of choice, and the discovery of the divine presence within. As a consequence, a growing trust in God, a bonding with the Divine Therapist, enables us to endure the process. Thus. the gift of contemplative prayer is a practi-cal and essential tool for confronting the heart of the Christian ascesis--namely, the struggle with our uncon-scious motivation--while at the same time establishing the climate and necessary dispositions for a relationship with God and leading, if we persevere, to divine union.2 For me the most fruitful connection here is the linking of the "dark night" or "cloud of unknowing" of the traditional apophatic path and the psychological process--the "darkness" of the psyche. If psychoanalysis represents "cataphatic therapy"--using words, concepts, and awareness to illuminate the darkness of our inner ground--Keating is presenting centering prayer as a kind of "apophatic psychotherapy" ("apophatic" meaning that which points one toward the ineffable beyond all words, concepts, and forms). What really happens when one enters the cloud of unknowing--resting in God beyond thoughts, words, and feelings--is a profound healing of the emotional wounds of a lifetime. As these wounds are gradually brought to the surface and released in prayer (one simply lets them go nonpossessively, rather than retaining them for inspection as one does in psychoanalysis), the false self weakens and the true self grfidually emerges. For Keating this is the real meaning of the term "transforming union." As he states in Intimacy with God, "We can bring the false self to liturgy and to the reception of the sacraments, but we cannot bring the false self forever to contemplative prayer because it is the nature of contemplative prayer to dissolve it" (p. 98). Keating does not claim that such a practice replaces the need for ordinary psychotherapy. Indeed, material that arises out of the unconscious in prayer sometimes requires the assistance of psychotherapy, particularly in cases of retrieved memories of emotional or sexual abuse. But in centering prayer this healing and March-April 1999 Bourgeault * From Woundedness to Union purification occurs within the sanctuary of prayer, combined with a deepening trust in God. So, at the same time that healing is going on at the psychological level, a deepening of the spiritual faculties is occurring as well--recollection, vigilance, attention of the heart-- leading to a blossoming of the traditional theological virtues of faith, hope, and love. The Shape of the Journey Traditionally we are used to thinking of spiritual transformation as an ascent. The effects of a spiritua~ practice, we expect, are to make us more calm, more able to cope, more filled with equanimity. Keating's model, however, suggests a different scenario. The ascent is inextricably bound to a descent into the ground of our own psyche. Thus periods of psychological ferment and destabilization are signs that the journey is progressing, not that it is a failure. As the. practice of meditational.prayer loosens repressed material in the unconscious, the initial fruits of spiritual practice, may not be peace and enlightenment, but destabilization and the emergence into consciousness of considerable pain. One woman in our group in Maine experienced this process particularly vividly. After only a few weeks of regular practice of centering prayer, she found herself increasingly tense and irritable and frequently went home from meditation to pick a fight with her husband. She was tempted to quit, but with the encouragement of the group she stayed on and cooperated with the process. What was happening (rather quickly in her case) was that a brittle control--keeping everything at a superficial level of "niceness"--collapsed almost immediately in the face of her immersion in contemplative silence. She found herself face-to-face with a deep guilt about, her second marriage and her terror that God would punish both her and her husband with cancer. Needless to say, "resting" in such a God was not a tranquil experience! But with a good deal of courage she has been able to face these feelings, work through them, and reestablish a relationship with both her husband and God on a deeper, fleer level. In my own work with centering prayer, I have learned by repeated experience that the "reward" for a period of deepening practice is often the emergence of a patch of pain long buried followed by several days of emotional turmoil, Keating calls it "the Review for Religious archaeological dig." As trust grows in God and practice becomes more stable, we penetrate deeper and deeper down to the bedrock of pain, the origin of our personal false self. The results are often horrifying to ourselves. Yet, says Keating, this does not mean that the spiritual journey is a failure, but that it is doing its job. The fruits of this unloading are more than worth the pain. In response to each significant descent into the ground of our woundedness, there is a parallel ascent in the form of inner freedom, the experience of the fruits of the spirit, and beatitude. There are several practical implications to this idea, but the paramount one--for both spiritual seekers and spiritual guides--is to recognize that centering prayer is a psychological method and will produce results in that realm, some of them initially painful. In Intimacy with God Keating recounts how a graduate student recendy did a thesis on centering prayer, along with several forms of Eastern meditation, recommending them as a way to reduce anxiety. Keating wrote back to the man saying, "Centering prayer will reduce anxiety for perhaps the first three months. But, once the unconscious starts to unload, it will give you more anxiety than you ever had in your life." For individual practitioners he recommends a limited dosage-- twenty to thirty minutes twice a day is the normal iprescription--to prevent the premature emergence of material into consciousness. Ten-day retreats rely on a trained staff to help handle a more intensive unloading process. Keating insists that the method is safe and that only in the case of serious depression or psychotic symptoms should the prayer be discontinued. By interweaving the contemporary language of healing with the traditional language of holiness, Keating extends the range of both. His synthesis is spacious, with plenty of room for .growth. For those preoccupied with their own recovery from woundedness (and many come to centering prayer by way of the recovery movement), it provides a gende and supportive context in which the process can unfold. But recovery is not the endpoint. For Keating the real goal Keating has bridged the gap between contemporary psychology and the traditional language of spiritual purification. March-April 1999 Bourgeault ¯ From Woundedness to Union of the inner transformation is not one's personal healing, but the ability to be a Christian as measured by the ability to follow the teachings of Christ all the way to mystical union. For in the final analysis it is Keating's own deep mystical spirit that undergirds the entire paradigm, offering .a scale as vast as the cosmos: There remains a further energy, which is reserved for the next life. That is ~vhat theologians call the Beatific Vision. This requires freedom from the limitations of the physical body in order to experience it. This energy is so intense that, if it were not mediated by the ordinary affairs of daily life that distract us from continual contact with the divine energy, we would turn into a grease spot. This is the energy that lights the universe and forms the whirling nebulae. We can receive only a little of it at a time. In heaven we can have all we want.3 Toward an Intermediate Christianity Keating's thinking has evolved considerably since his interview with Needleman years ago, and it is still evolving. Many of his observations bear much more dialogue and fine-tuning, but at this point his appears to be a cohesive new.synthesis that offers a significant first step in the direction of a functional "intermediate Christianity." Clearly gaps are being bridged. The first of these is the gap between theory, and practice: Keating's method seems to provide a way for stones to become water. By restoring a meditational praxis--and one so uniquely consonant with the basic modality of Christianity--he has created an inner laboratory for practicing the basic gesture of faith. I have watched people like the woman in Maine confront their woundedness, heal, and come alive spiritually as they make the connection between their daily lives and what goes on in prayer. Second, Keating has bridged the gap between contemporary psychology and the traditional language of spiritual purification. By repositioning meditation as a tool for purification of the unconscious--and by insisting that people do it, not just talk about it--he can be faithful to contemporary models of healing while pointing the way beyond, toward profound inner transformation in ever deepening surrender. In so doing, he has rescued us both from the vagueness of contemporary psychojargon and from the violence of traditional metaphors based on renunciation, vigilance, and Review for Religious "spiritual warfare" (as if a part of us had to be killed, or at least locked up, in order for holiness to grow). For Keating, spiritual transformation is gentle, ever-so-gentle, and holds always before one the need for integration of psyche and spirit. The one cannot dominate the other; they must proceed apace. If the spirit's role is to be strong, the psyche's is to be vulnerable, and the lion must lie down with the lamb before the peaceable kingdom will reign within. The touchstones of the entire teaching are gentleness, patience, consent, and a willingness to let the process of integration unfold with its own pace and authenticity. Of course there is woundedness, but there is holiness as well. How the two come together--not which wins, but how they join-- constitutes the unique and profound meaning of one's life, the emergence of the true self, transformed in Christ. Of Thomas Keating's many contributions~ this one is for me the most powerful. ~r Notes l Jacob Needleman, Lost Christianity (San Francisco: Harper and Row, 1980), p. 119. 2 Thomas Keating, Intimacy with God (New York: Crossroad, 1994), p. 3. 3 Keating, p. 103. Resurrection Power Behold the slender shoot Reaching for the light, The flower just unfurled, The barren branch Heavy with blossoms. Here is the Force That walked out of the tomb, Conquering our worst foe. Here is Life incorruptible, The Risen One waiting To spring forth in you. Teresa Burleson March-April 1999 PAMELA A. SMITH On the Go with Chronic Illness, Sitting Still with Mark How does anyone with a long-term, life-threatening, complex, and confounding chronic illness stay with it and retain humor and hope for the long haul? How does one take in and make sense of the regular reminders from endocrinologist, internist, and consulting counselor that it does inevitably get less manageable and, yes, worse? How does one stay happily productive in the face of the evidence that most folks in the same situation have long since quit work and gone on disability leave? What is the Christian mix of resignation and stubbornness, relaxation and fight, that makes it possible to slow down and still go barreling forward? These were some of the questions--maybe the most critical ones--which I carried with me on a rainy March day to a hideaway in close proximity to tentatively budding trees and a horse pasture still tinged with the orange and yellow of winter grass. The evergreen shrubs and hedge persisted, drippingly at the moment, around the Michigan country home to which I retreated (with all my griefs in my arms, as Dylan Thomas said of lovers, and all those griefs probably everywhere else too). My IDDM--insulin-dependent diabetes mellitus, long ago labeled "britde"--was afflicting me with "diabetic fatigue," I had recently told my boss, the rector of a seminary. He affirmed my request to take some needed time away. I can get a bit gl

n/a ; Timeline of key events: March 2011: Anti-government protests broke out in Deraa governorate calling for political reforms, end of emergency laws and more freedoms. After government crackdown on protestors, demonstrations were nationwide demanding the ouster of Bashar Al-Assad and his government. July 2011: Dr. Nabil Elaraby, Secretary General of the League of Arab States (LAS), paid his first visit to Syria, after his assumption of duties, and demanded the regime to end violence, and release detainees. August 2011: LAS Ministerial Council requested its Secretary General to present President Assad with a 13-point Arab initiative (attached) to resolve the crisis. It included cessation of violence, release of political detainees, genuine political reforms, pluralistic presidential elections, national political dialogue with all opposition factions, and the formation of a transitional national unity government, which all needed to be implemented within a fixed time frame and a team to monitor the above. - The Free Syrian Army (FSA) was formed of army defectors, led by Col. Riad al-Asaad, and backed by Arab and western powers militarily. September 2011: In light of the 13-Point Arab Initiative, LAS Secretary General's and an Arab Ministerial group visited Damascus to meet President Assad, they were assured that a series of conciliatory measures were to be taken by the Syrian government that focused on national dialogue. October 2011: An Arab Ministerial Committee on Syria was set up, including Algeria, Egypt, Oman, Sudan and LAS Secretary General, mandated to liaise with Syrian government to halt violence and commence dialogue under the auspices of the Arab League with the Syrian opposition on the implementation of political reforms that would meet the aspirations of the people. - On October 26, the Ministerial Committee held discussions in Damascus with President Assad. - The establishment of the Syrian National Council (SNC) in Istanbul, the first opposition coalition of different groups, but failed to gain international recognition because of deep divisions. November 2011: Syrian government agreed to implement a new Arab Action Plan (attached) endorsed by LAS Ministerial Council to end all acts of violence, release detainees, withdraw Syrian military and armed forces from cities, and ensure freedom of movement for journalists and observers throughout the country. -LAS Ministerial Council suspended the membership of Syria (November 16), and imposed economic sanctions (November 27) and some member states withdrew their ambassadors from Damascus, as it failed to comply with the Action Plan. December 2011: Negotiations with Damascus were resumed and an agreement is finally reached on the implementation of the Action Plan. LAS Observer Mission was deployed in Syria to monitor the implementation of the plan (December 24). - The Mission later submitted a report (attached) covering the period from 24 December 2011 to 18 January 2012 in accordance with the mandate conferred by the protocol concluded between the Syrian government and LAS. The report was divisive among the members of the Arab League, as it blamed both the regime and the opposition for the violence. January 2012: LAS Ministerial Council adopted resolution 7444 (attached) which called on the Syrian President to immediately hand over power to his deputy in order to begin the process of a political transition, which would include negotiations with the opposition, the formation of a national unity government, and the holding of elections. The resolution also, requested the Chair of the Arab Ministerial Committee and the Secretary General to brief the United Nations Security Council on the developments and get it to endorse the plan. - On January 22, Saudi Arabia withdrew its monitors, followed by the other GCC members on January 24. - On January 28, the Secretary-General of LAS announced the suspension of the activities of the observer mission, given the serious deterioration of the security situation. - On January 31, Sheikh Hamad bin Jassim bin Jabr Al-Thani, Prime Minister and Minister for Foreign Affairs of the State of Qatar, Chair of the Arab Ministerial Committee and Dr. Nabil Elaraby, Secretary General of the League of Arab States briefed the Security Council (attached) on Arab efforts and called on the council to adopt a draft resolution submitted by Morocco, supporting Arab League resolution 7444 (which called on the Syrian President to hand over power to his deputy) February 2012: - On February 4, Russia and China vetoed a draft Security Council resolution (attached), tabled by Morocco (the Arab member of the Security Council) and others. - On February 12, the Arab League adopted its resolution 7446 (attached), practically "transferring the file" to the United Nations Security Council. - On February 16, the issue was taken to the General Assembly, which adopted its Resolution 66/253, calling-among other things- for the appointment of a Special Envoy. - On February 23, former United Nations Secretary-General Kofi Annan was appointed as the Joint Special Envoy (JSE) of the United Nations and the League of Arab States on the Syrian crisis, to facilitate a peaceful Syrian-led and inclusive political solution. - On February 24, and upon the initiative of President Sarkozy of France, the first meeting of the Group of Friends of the Syrian People was held in Tunis, with the participation of more than 60 countries and representatives from the United Nations, the League of Arab States, the European Union, the Organization of Islamic Cooperation, the Arab Maghreb Union and the Cooperation Council for the Arab Gulf States to discuss the worsening situation in Syria. The group noted the Arab League's request to the United Nations Security Council to issue a resolution to form a joint Arab-UN peacekeeping force following a cessation of violence by the regime, and called on LAS to convene a meeting of all disparate opposition groups to agree on a clear statement of shared principles for a transition in Syria. The meeting recognized the SNC as a legitimate representative of Syrians seeking peaceful democratic change. Text of the Conclusions of the Meeting. March 2012: The SNC formed a military council to organize and unify all armed resistance. - The JSE, Kofi Anan, submitted a six-point peace plan to the UN Security Council (which the council adopted in April in its resolution 2042), that called for commitment to a Syrian-led political process, achieve an effective United Nations supervised cessation of armed violence in all its forms by all parties, ensure provision of humanitarian assistance, intensify the release of arbitrarily detained persons, ensure freedom of movement for journalists and respect the freedom of demonstrating peacefully. It was later approved by the Syrian government, and the opposition remained skeptical. April 2012: United Nations Supervision Mission in Syria (UNSMIS) was established by United Nations Security Council resolution 2043 (attached) initially for a 90-day period, to monitor a cessation of armed violence in all its forms by all parties and to monitor and support the full implementation of the Joint Special Envoy's six-point plan on ending the conflict in Syria. June 2012: The Action Group for Syria, with the participation of the Secretary Generals of the United Nations and the League of Arab States, the Foreign Ministers of China, France, Russia, United Kingdom, United States, Turkey, Iraq, Kuwait, Qatar and the European Union High Representative for Foreign and Security Policy, chaired by the JSE, met in Geneva and adopted the Geneva Final Communique (attached) which called for the establishment of a transitional governing body, with full executive powers, as part of the agreed principles and guidelines for a Syrian-led political transition. July 2012: The Syrian Opposition meeting was held under the auspices of LAS in Cairo, and reached an agreement on a national compact and a detailed transition plan. The two documents complemented the guidelines and principles laid out by the Action Group in Geneva. August 2012: UNSMIS mandate came to an end owing to an intensification of armed violence and use of heavy weapons. - Prime Minister Riad Hijab defected, and US President Obama's first direct threat of force against Syria, if Assad's regime deploys or uses chemical or biological weapons, calling such action a "red line" for the US. - Joint Special Envoy, Kofi Annan announced his resignation because of the Security Council failure to reach binding resolutions; Lakhdar Brahimi succeeded Annan as the Joint Special Representative of the United Nations and the League of Arab states for Syria (JSR). September 2012: Egypt hosted the high level preparatory meeting of the regional Quartet on Syria on September 10, which included Turkey and Saudi Arabia key backers of the Syrian Revolution, and Iran the major supporter of al-Assad regime, in an initiative to bring together regional powers to voice their positions on how to end the Syrian conflict. - On September 17, the Quartet's ministerial meeting took place in Cairo; Saudi Arabia opted out while Iran proposed a peace plan which called on all parties to cease violence and stop all financial and military support to the opposition, and suggested the deployment of observers from the quartet's nations to Syria. The participants failed to reach an agreement. October 2012: a four-day ceasefire attempt was announced towards late October, in respect to Eid al-Adha Holiday, which was breached on the first day in Homs, Aleppo and Damascus. November 2012: National Coalition for Syrian Revolutionary and Opposition Forces (SOC) was formed in Qatar, responding to repeated calls from their Western and Arab supporters to create a cohesive and representative leadership, it excluded Islamist militias. December 2012: US, Britain, France, Turkey and Gulf states formally recognized SOC as "legitimate representative" of the Syrian people. January 2013: the Emir of Kuwait hosted the first pledging conference on Syria, international donors pledged more than $1.5bn to help civilians affected by the conflict in Syria. March 2013: LAS Ministerial Council adopted resolution 7595 (attached) to recognize SOC as the "sole legitimate representative" of the Syrian people and called on the SOC to establish an executive body to take up Syria's seat. April 2013: Abu Bakr al-Baghdadi, leader of the Islamic State, released a recorded audio message announcing Jabhat al-Nusra as an extension of al-Qaeda in Iraq and Syria. The leader of al-Nusra, Abu Mohammad al-Joulani, refused the merger. Divisions among the jihadists emerged. - Hezbollah's involvement deepened when it led the ground assault on Al-Qusayr, a Sunni town in Homs province by the Lebanese border. August 2013: The Assad regime was accused of using chemical weapons in Eastern Ghouta to kill hundreds of civilians. The government denied using chemical weapons. President Obama sought congressional authorization for the use of force. September 2013: UN Security Council unanimously adopted resolution 2118 (attached) requiring the Syrian regime to dismantle its chemical weapons arsenal by mid-2014, and avoid military strikes. December 2013: US and Britain suspended "non-lethal" support for rebels in northern Syria after reports Islamist rebels seized some bases of Western-backed Free Syrian Army. January 2014: the Geneva II Conference on Syria was held in Montreux on January 22, and attended by 37 states, 4 organizations and both Syrian parties. Iran was invited by SG Ban Ki- Moon on January 19, the Opposition declared its refusal to attend if Iran was not excluded, the US viewed Iran's invitation "as conditioned on Iran's explicit and public support for the full implementation of the Geneva Communique"; Iran refused any preconditions to the talks, and refused to endorse the Geneva Communique specially the transitional governing body. February 2014: two rounds of negotiations to discuss: 1- ending violence and 2-combating terrorism, 3-transitional governing body, national institutions, and 4- national reconciliation and national debate. The Syrian government refused to discuss a transitional government and insisted on discussing combating terrorism. The talks came to a halt. May 2014: JSR Brahimi announced his resignation because of the lack of progress and failure to agree on an agenda. - Iran proposed a political settlement of four points; a comprehensive cease-fire at national level, forming a national unity government consisting of the regime and the internal Syrian opposition, by transferring presidential powers to the government whereby the government will enjoy wide-ranging powers in years to come, and preparation for presidential and parliamentary elections. - Syrian rebels withdrew from the Old City of Homs, under an Iranian brokered deal and facilitated by the UN, after three years of Syrian government bombardment and siege. June 2014: President Assad held presidential elections, he was re-elected for another seven-year term allegedly winning 88.7% of the votes. July 2014: UN Secretary-General announced the appointment of Staffan de Mistura as his Special Envoy for Syria (SE)- NOT as a joint envoy with LAS. August 2014: US-led coalition began its airstrikes against the Islamic State in Iraq and expanded its strikes to Syria the following month, focusing on the city of Raqqa. September 2014: SE held his first round of consultations with concerned capitals, since taking up his office, it included his a visit to Damascus where he met with President Assad, senior officials and the tolerated internal Syrian opposition. October 2014: SE focused on establishing a series of local ceasefires, "freeze zones", starting with Aleppo, which aimed at the de-escalation of violence and allowance of the return of normalcy to it. February 2015: SE briefed the Security Council members on the 17th, announcing Syria's willingness to halt all aerial bombardment over Aleppo for a period of six weeks. It was not clear when would the freeze go into effect, reporting that a date would be announced from Damascus. June 2015: Egypt hosted the second Syrian Opposition meeting in Cairo, which excluded the National Coalition and announced a new road map to resolve the crisis which did not abolish Assad's government. July 2015: SE announced that his office would facilitate intra-Syrian working groups to generate a "Syrian-owned framework document" on the implementation of the Geneva Communiqué. Main themes of the groups were Safety and Protection for All, Political and Constitutional Issues, Military and Security Issues, and Public Institutions, Reconstruction and Development. September 2015: Russia conducted its first airstrikes against IS in Syria. The US and the Syrian Opposition claim it is targeting rebel-held areas instead. October 2015: First meeting of International Syria Support Group (ISSG) took place in Vienna, it included China, Egypt, the EU, France, Germany, Iran, Iraq, Italy, Jordan, Lebanon, Oman, Qatar, Russia, Saudi Arabia, Turkey, United Arab Emirates, the United Kingdom, the United Nations, and the United States. They agreed on a nine-point plan, but still had substantial divisions on the future of Assad. It was the first time Iran and Saudi Arabia were brought to the same table. November 2015: Second meeting of the ISSG was held in Vienna adding LAS to its members. They set a time frame to prepare for a parallel ceasefire and political process by January 2016 that would lead to credible, inclusive and non-sectarian governance within six months, followed by the drafting of a constitution and elections within 18 months. Jordan was tasked to develop a list of groups and individuals identified as terrorists, and Saudi Arabia to hold a meeting to unify the Syrian opposition and prep for the talks with the government. December 2015: - Syrian political and armed opposition factions met in Riyadh, to agree on a common position to negotiate with Syrian government, and resulted in the formation of the High Negotiating Committee (HNC). The main Kurdish group was excluded, while Islamist hardliners such as Jaysh Al-Islam and Ahrar Al-Sham were present. - The Secretary General of the Organization of Islamic Cooperation (OIC) joined the follow-up meeting of the ISSG in New York, Saudi Arabia and Jordan briefed the group on their tasks. There was no agreement on the list of identified terrorists, especially with Russia's insistence on adding Ahrar Al-Sham to the list, which is considered pivotal to the unified Opposition bloc. - UN Security Council unanimously adopted resolution 2254 (attached) which reaffirmed the road map set out by the ISSG and urged the Support Group to apply pressure on the Syrian parties to put an immediate end to the indiscriminate use of weapons against civilians, and allow unimpeded access to humanitarian aid convoys. January 2016: the SE sent out invitations to the Syrian participants, in accordance with the parameters outlined in Security Council resolution 2254, to start on the 25th with proximity talks and had expected to last for six months. The HNC requested assurances of goodwill from the government as precondition to beginning of talks, such as release of prisoners or lifting of sieges. February 2016: Talks were delayed and lasted two days before they were suspended for three weeks. - The ISSG met on the margins of the Munich Security Conference and decided that humanitarian access will commence same week of meeting to besieged areas, and an ISSG task force would elaborate within one week modalities for a nationwide cessation of hostilities. - The US and Russia announced the adoption of the terms for a cessation of hostilities in Syria, and proposed that the cessation of hostilities commence at 00:00 (Damascus time) on February 27, 2016. The cessation of hostilities does not apply to "Daesh", "Jabhat al-Nusra", or other terrorist organizations designated by the UN Security Council. - The Security Council endorsed the announcement in its resolution 2268 (attached). March 2016: SE announced March 9 set as target date of resumption of talks in Geneva. On March 14, SE resumed the intra-Syrian proximity talks in Geneva, which mainly discussed procedural matters to reach a shared list of principles and relied on Security Council resolution 2254 as its agenda. - SE briefed the Security Council on the cessation of hostilities which lowered overall levels of violence and more than 238,000 people had been reached with humanitarian aid. - On the same day, President Putin announced the withdrawal of most Russian forces from Syria, after it had largely fulfilled their objectives in Syria, and SE stated that it would have a positive impact on the negotiations. - On March 17, the PYD announced the establishment of a federal system in Kobane, Afrin and Cizire cantons in northern Syria, and its Constituent Assembly of the Democratic Federation of Northern Syria-Rojava (DFNS) announced its final declaration. Both the Syrian government and other opposition affiliates denounced the plan, as well as the United States. - On March 24, the SE ended the first round by submitting a paper on the commonalities between the Syrian sides regarding the future of Syria and would help structure the next round that would address political transition. - Syrian government forces retook Palmyra from the Islamic State, with Russian air assistance. April 2016: The SE paid visits to Amman, Beirut, Damascus and Tehran ahead of the new round of talks. - The third round of proximity talks were set to start on April 13, which coincided with the parliamentary elections in the government-controlled areas in Syria. The SE met with the High Negotiations Committee delegation (Syrian Opposition) in Geneva and was expected to meet with the Syrian Government delegation within the following days. - During the 13-27 April round of negotiations, the SE developed a Mediator's Summary that identified eighteen points necessary to move forward on political transition arrangements. - on April 28, airstrikes in Aleppo on al-Quds hospital supported by both Doctors Without Borders and the International Committee of the Red Cross, which killed dozens of civilians and medical personnel. May 2016: The Security Council adopted unanimously resolution 2286 (attached) which called for the protection of civilians and medical facilities during armed conflict. - On May 4, the US-Russia brokered a 48-hour ceasefire in which helped reduce the violence, and was later extended for another 72 hours. - On May 9, France held a ministerial Friends of Syria meeting in "Paris Format", attended by the United States, Germany, the United Kingdom, Italy, the European Union, the United Arab Emirates, Saudi Arabia, Qatar, Turkey and Jordan, and issued a statement that called on the resumption of negotiations, unimpeded access of humanitarian assistance and the implementation of international law obligations to the protection of civilians. - Later on the same day, the United States and Russia issued a joint statement on Syria to reconfirm their commitment to intensify their efforts to implement a nationwide ceasefire and promote humanitarian assistance in accordance to security council resolution 2254. - On May 17, the fourth meeting of the ISSG took place in Vienna and reaffirmed its determination to strengthen the cessation of hostilities, to ensure full and sustained humanitarian access in Syria, and to ensure progress toward a peaceful political transition. Australia, Canada, Japan, the Netherlands and Spain joined the group. June 2016: The SE announced that the time is not yet right for a resumption of the intra-Syrian talks because of the escalation of violence in Aleppo, Idlib, Latakia and other rural areas around Damascus, but the intention is to begin an official third round as soon as possible. - Riad Hijab, the Coordinator of the Opposition High Negotiations Committee, proposed a nationwide truce throughout the month of Ramadan. - On June 16, Jan Egeland Advisor to the Special Envoy for Syria announced that 16 of the 18 besieged areas have been reached since the humanitarian taskforce started in late February. - On June 21, the SE briefed the United Nations General Assembly on the situation in Syria regarding the cessation of hostilities and humanitarian assistance access, as for the resumption of talks, it is yet to be decided and the OSE currently holds technical meetings with the parties on core issues. July 2016: - On July 6, the Syrian army declared a three-day nationwide "regime of calm" in respect to Eid al-Fitr holidays nonetheless pro-regime forces continued to engage in clashes and airstrikes across the country, particularly near the flashpoints of Damascus and Aleppo City. - On July 14, U.S. Secretary of State John Kerry met with Russian President Vladimir Putin in Moscow to discuss a proposal for bilateral military cooperation in the Syria; The proposal calls for the establishment of a 'Joint Implementation Group' (attached) based in Amman, Jordan to "support deliberate targeting" of Syrian Al-Qaeda affiliate Jabhat al-Nusra and "maximize independent but synchronized efforts" against ISIS in Syria, according to a draft memorandum leaked by the Washington Post. - On July 25, Stephen O'brien, the Under Secretary-General for Humanitarian Affairs and Emergency Relief Coordinator, briefed the security council (attached) on the deteriorating humanitarian situation in Aleppo due to the escalation of violence over the Castello Road, the last access route in and out of eastern Aleppo, and the continuous attacks on medical facilities. O'brien called on the security council not to allow turning Aleppo into another besieged area where 250,000 to 275,000 people reside, and called to establish a weekly, 48-hour humanitarian pause to enable humanitarian aid deliveries across borders. - On July 28, the Russian Minister of Defense Sergei Shoigu announced, right after the Syrian government announced it has cut off the Castello Road and encircled the city of Aleppo, setting up three humanitarian corridors in Aleppo City to allow in food and medical aid, and help people flee the besieged city; the fourth corridor would be established in northern Aleppo near the Castello Road to allow the withdrawal of armed insurgents, and appealed to the Syrian government to provide guarantees to the amnesty provided to rebels to lay down their weapons. - On the same day, Abu Mohammed al-Julani, Jabhat al-Nusra's Leader announced split from al- Qaeda and mentioned that its new name would be Jabhet Fateh al-Sham, in order to get the group off the terrorist list and "to remove the excuse used by the international community – spearheaded by America and Russia – to bombard and displace Muslims in the Levant: that they are targeting al-Nusra Front, which is associated with al-Qaida". - On July 29, the SE commented on the Russian initiative in a press stakeout, that it should take into consideration a few improvements such as putting the 48-hour humanitarian pause into place on a sustainable basis irrespective of the humanitarian corridors; and suggested "to actually leave the delivery of aid through corridors to the UN and its partners"; and stressed that civilians should leave voluntarily, and given the option of leaving to areas of their own choice. August 2016: - On August 1, a Russian helicopter was downed near Saraqeb, in rebel-held Idlib province, on its way back to Russia's main air base in Hmyeim in the western province of Latakia, killing the five Russian military personnel on board. The downing of the helicopter marked the single deadliest event for Russia since its air campaign began in Syria on September 29, 2015. No group claimed the shooting down of the helicopter. - Since then, Russian warplanes conducted retaliatory airstrikes against several small opposition-held areas in the vicinity of Saraqeb. Syrian rebels accuse Russia of using incendiary munitions while conducting airstrikes against Idlib City on August 7, suggesting that Russia intended to achieve punitive and deterrent effects against opposition forces in the province. - In the early weeks of August, rebel forces launched a major assault, known as the "battle for Aleppo", on government-held southwestern towns of Aleppo City, to break the siege, and control supply lines in the south connected to eastern Aleppo. They claimed breaking the siege and capturing Ramouseh Artillery Academy, parts of the cement plant and Khan Touman-Ramouseh road. Intense fighting between warring parties continues to claim control over previously lost vicinities. - On August 9, Russian President Vladimir Putin met with Turkish President Recep Tayip Erdogan in St. Petersburg, after the Turkish President officially apologized for the downing of a Russian military aircraft on June 27, 2016, and announced during a press conference that they discussed lifting of Russia's ban on imports of Turkish products, resumption of charter flights, the Turkish Stream project, Syrian settlement, and anti-terrorism efforts. - On August 10, Lieutenant-General Sergei Rudskoi, a senior Russian Defence Ministry official, announced a daily three-hour ceasefires in Aleppo, starting August 11, to allow humanitarian convoys enter the city safely, and would run from 10 a.m. to 1 p.m. local time. - On August 16, the Russian Ministry of Defense announced that Russian aircrafts took off from Iranian airbase Hamedan to carry out airstrikes on ISIS and Jabhat al-Nusra-held facilities in the provinces of Aleppo, Idlib and Deir ez-Zour. - On August 18, the SE adjourned the HTF meeting as humanitarian convoys could not reach any of the besieged towns during the month, and called for at least a 48 hour humanitarian pause in Aleppo to deliver UN humanitarian assistance, through the Castello Road, to all parts of Aleppo City. - Also, on August 18, the Syrian government forces, unprecedentedly, launched strikes against Kurdish forces in Hasakeh in Northern Syria, after pro-government National Defense Forces (NDF) were engaged in clashes with the military wing of the Kurdish Workers Party, known as Asayish. The Syrian government claimed that "Asayish had escalated their acts of provocation attacking state establishments, stealing oil and cotton, disrupting examinations, carrying out abductions, and causing a state of chaos and instability, in addition to targeting positions of the Syrian Arab Army which required a suitable response by the Army as it targeted the sources of artillery fire and the gatherings of armed elements responsible for these criminal actions." - On August 19th, while the Kurdish fighters pushed back government forces and their allies, the Pentagon threatened to shoot down Syrian government aircrafts as they pose a threat to the US Special Forces deployed in the Kurdish People's Protection Units (YPG) area. - On August 21, it was announced that a truce agreement had been reached between YPG and NDF, through Russian mediation, to start on August 21, 2016 at 17:00, which involved evacuating the wounded and transporting them to hospitals in Qamishli, and restore the situation to how it was prior to the clashes and hold talks on August 22 to resolve the remaining unresolved issues. - On August 22, most likely the ceasefires agreement failed as fighting escalated. - On August 24, Turkey and the International Coalition Air Forces launched "Operation Euphrates Shield" offenses to support the Free Syrian Army aligned with U.S.-backed Syrian Democratic Forces SDF against IS militants in Jarablus, in northern Syria. - On August 26, U.S. Secretary of State John Kerry and Russian Foreign Minister Sergei Lavrov, addressing a joint press conference after their meeting in Geneva, announced that they failed to reach a breakthrough deal on military cooperation and a nationwide cessation of hostilities in Syria, saying they still have issues to resolve before an agreement could be announced. - On August 27, Kurdish militias targeted Diyarbakir airport in southeast Turkey, near the borders with Syria. Turkey retaliated by warplanes and artillery on targets held by Kurdish-backed forces the following day, despite US pentagon's criticism of the fighting. September 2016: - On September 4, Turkish Prime Minister Binali Yildrim announced that Turkish military forces and Ankara-backed Free Syrian Army (FSA) had successfully purged the border region, from Azaz to Jarablus, from "terrorist organizations." - On September 9, the US and Russia reached a deal which called for a nationwide ceasefire in Syria, and unimpeded humanitarian access to all besieged areas starting on September 12th. If sustained for seven continuous days, the U.S. and Russia would establish a Joint Implementation Center (JIC) in order to share intelligence and coordinate airstrikes against both ISIS and Jabhat Fateh al-Sham (formerly Jabhat al-Nusra). - On September 21, the cessation of hostilities deal was implemented with regular violations, while the Syrian government continued to block humanitarian access to opposition-held districts of Eastern Aleppo City despite the agreement. - On September 17, the US-led coalition accidentally launched an air strike on Syrian government forces in Deir ez-Zour. - On September 19, a UN humanitarian convoy was shelled near Urum al-Kubra near Aleppo, killing 20 humanitarian aid workers and drivers, and destroying 18 out of 31 trucks. The US blamed Russia and the Syrian government for the attack; the latter declared unilaterally the end of the ceasefire agreement. - On September 20, the UN temporarily suspended its humanitarian aid to Syria after the attack, while international powers failed to reach a consensus to restore the ceasefire during an acrimonious UN Security Council Meeting on September 21st as well as two separate meetings of the International Syria Support Group on September 20 and September 22. - On September 22, the Syrian government announced a new military offensive in the rebel-held eastern Aleppo, and further escalation in a bombing campaign by Russian and Syrian airstrikes that had already intensified the day before. - On September 25, the Security Council Meeting discussed the recent escalation of violence in Aleppo after the Syrian government announced its intention to retake all of Aleppo City, and the SE called on the Security Council to "to press for a cessation of violence, and for the protection of civilians, and the civilian infrastructure; secondly to press for weekly 48-hour pauses in the fighting to ensure that the United Nations and its partners can reach eastern Aleppo, without preconditions from either the Government or the Opposition; and thirdly to press for medical evacuations of urgent cases." - On September 27, the Syrian government launched a large scale ground offensive in eastern Aleppo, and state media announced that it recaptured the central district of Al-Farafirah northwest of the Aleppo Citadel. - On September 29, the YPG set conditions to participate in operations to seize IS-held Raqqa City: the US provides arms to the YPG, recognizes its autonomy of the Federation of Northern Syria, and ensures that the Syrian Kurds are officially invited to participate in peace talks. October 2016: - On October 1, continuous airstrikes in eastern Aleppo damaged a major hospital codenamed M10, which was partially closed because of the raids. - On October 2, Stephen O'brien, the Under Secretary-General for Humanitarian Affairs and Emergency Relief Coordinator, urged warring parties and their supporters to bring about a cessation of all hostilities, a medical evacuation system for eastern Aleppo, and regular unimpeded humanitarian access to eastern Aleppo, and he reiterated his plea to the Security Council for a 48-hours weekly humanitarian pause in fighting, at the very least. - In an official statement, the Syrian Army offered amnesty to fighters and their families to leave Aleppo under guarantee of safe passage to other rebel-held areas, after the Syrian regime forces recaptured strategic areas on the northern outskirts of the city. - On October 3, the EU announced an emergency humanitarian initiative for Aleppo, in cooperation with the United Nations and civil society organizations, in order to facilitate the urgent delivery of basic life-saving assistance to civilians in eastern Aleppo, and ensure medical evacuations with focus on women, children and the elderly. The EU has mobilized 25 million euros to support its humanitarian partners' response to cover medical, water and sanitation, and food assistance in Aleppo. The HNC issued a statement welcoming the European initiative to protect civilians in Aleppo. - The Security Council began negotiations over a draft resolution, circulated by France and Spain, which demanded all parties to the Syrian conflict "implement and ensure full implementation of cessation of hostilities, including an end to all aerial bombardments", and called on the US and Russia to "undertake joint efforts to stabilize the situation in Syria, with special measures for the Aleppo region", as well as the UN Secretary-General to propose options for a UN-supervised monitoring mechanism of the ceasefire and to "take further measures" in case of non-compliance of any party, without invoking chapter 7 of the UN Charter. The French Foreign Minister Jean-Marc Ayrault headed to Moscow and Washington to push for a vote on the draft resolution. - The United States suspended talks with Russia on trying to end the violence in Syria and accused Moscow of not complying with its commitments under the ceasefire agreement and would withdraw all personnel that were dispatched to prepare for military cooperation with Russia. - On October 4, Prince Zeid Ra'ad, the UN High Commissioner for Human Rights, warned over the use of incendiary weapons in Syria, and demanded bold initiatives such as limiting the use of the veto by the permanent members of the Security Council to refer the situation in Syria to the International Criminal Court (ICC). Russia rejected Zeid's call. - The Russian Defense Ministry declared its deployment of S-300 missile system to its Tartus naval base in Syria. - On October 6, the SE offered in a press conference to escort up to 1000 al-Nusra fighters to bring an end to the bombardment by Russian and Syrian forces to Idlib or anywhere else of their choice. While the Russian Defense Ministry announced it would shoot down US-led coalition jets if the US launches airstrikes against pro-government forces in Syria, after American officials had discussed using limited airstrikes to force government forces to halt its raids on Aleppo. - On October 7, Russia called for a Security Council emergency meeting to hear the SE's briefing (attached) on the situation in Aleppo, while the Russian Parliament ratified Moscow's deal with Syria on its "indefinite" deployment of forces. - On October 8, the Security Council held a meeting on Aleppo, and voted on the Russian-drafted resolution calling for the revival of the ceasefire deal, without mention of ending military fights in the city, and on the French-drafted resolution. The French draft received eleven votes in favor, China and Angola abstained, while Russia and Venezuela voted against. The Russian text only received four votes in favor of China, Egypt and Venezuela, Angola and Uruguay abstained, while the remaining nine council members voted against. - On October 9, France announced its intention to call the ICC for war crimes investigation in Syria, and shall contact the ICC Prosecutor on how to launch these investigations, putting into consideration that the only way is through the Security Council referral, which had been vetoed before by Russia in May 2014. - On October 13, the Deputy Special Envoy for Syria Ramzy Ezzeldin Ramzy confirmed the Syrian Government's approval of the October aid plan and for convoys to reach 25 of 29 besieged and hard-to-reach areas across Syria, but not to eastern Aleppo and three parts of the rural Damascus province. - On October 15, US Secretary of State John Kerry hosted a meeting on Syria in Lausanne, with the participation of Russian Foreign Minister Sergei Lavrov and seven foreign ministers from the region, from Iran, Iraq, Saudi Arabia, Turkey, Qatar, Jordan and Egypt, with the presence of the SE. The meeting failed to reach a joint statement on how to end the bombardment of Aleppo or on the aid delivery to the besieged towns. - On October 16, the UK's Foreign Secretary Boris Johnson held a meeting with his US, French and German counterparts and "like-minded" Gulf Arab states on the Syrian conflict in London. The UK and the US announced their consideration of imposing more sanctions against Russia and the Syrian Government to halt their ongoing raids on Aleppo. - On October 17, the European Council condemned the Syrian regime and Russia for their deliberate and indiscriminate bombardment of civilians and infrastructure in Eastern Aleppo, and called for a monitored cessation of hostilities, lift of sieges, and a nationwide sustainable humanitarian access. - On October 18, the Russian Minister of Defense Sergei Shoigu announced the cease of Russian and Syrian airstrikes on Aleppo to hold an 8-hour humanitarian pause on October 20th, in order to allow civilians and medical evacuations through six humanitarian corridors, and expected militants would withdraw with their weapons through two corridors, one via the Castello Road and the other near the souq al-Hai area in the south of the city. It was later announced that the eight-hour pause will be extended to eleven hours for four days. The armed opposition groups (AOGs) rejected the proposal in a joint statement claiming that "the initiative came at the same time as forced displacement operations are being carried out by the Assad regime in the Damascus suburbs of al-Mouadamiya, Qudsiya and al-Hama, and before that in Daraya." - On October 20, in conclusion of the EU summit, the EU failed to reach an agreement on imposing sanctions on Russia for the escalation of violence in Aleppo, and stated that "the EU is considering all available options should the current atrocities continue." The unilateral ceasefire took effect, and the Syrian Army declared that it would last for three days while artillery exchanges erupted around a crossing point near the rebel-controlled Bustan al-Qasr district shortly after the pause began. The Secretary-General and the SE briefed the General Assembly in an informal session on the situation in Syria, in response to an initiative led by Canada, after the Security Council failed to take action to end the aerial bombardment on Aleppo and revive peace efforts. - On October 21, the United Nations Human Rights Council held a special session on the deteriorating situation of human rights in Aleppo, upon the request of Britain (letter attached) that was submitted on behalf of a core group of 11 Western and Arab states. The Council adopted a resolution by a 24 in favor vote, seven against and 16 abstentions. It urged "the immediate implementation of the cessation of hostilities, and demanded that the regime and its allies put an immediate end to all aerial bombardments of and military flights over Aleppo city. The Council demanded that all parties, in particular the Syrian authorities and its supporters, promptly allowed rapid, safe, unhindered and sustained humanitarian access, including across conflict lines and borders." The Council further "requested the Independent International Commission of Inquiry on the Syrian Arab Republic to conduct a comprehensive, independent special inquiry into the events in Aleppo, and identify all those responsible for alleged violations and abuses of international human rights law. It further requested the Commission of Inquiry to support efforts to ensure that perpetrators of alleged abuses and violations be held accountable, and to provide a full report of the findings of its special inquiry to the Human Rights Council no later than its thirty-fourth session." - On October 22, the humanitarian pause expired without any evacuations made and without further renewal despite the UN request. No medical evacuations had been made as no security guarantees had not been granted as requested by the UN. - On October 23, Turkey intensified its strikes targeting IS militants and Kurdish YPG forces in the town of al-Bab, in an attempt to sweep them away from its borders. The Turkish-backed FSA gained control over three areas of Tuways, al-Gharz and Tlatinah south of Akhtarin in northern Aleppo two days later. - On October 25, Russian Deputy Foreign Minister Mikhail Bogdanov stated Moscow's willingness to restore the ceasefire in Aleppo and that the Western-backed opposition forces should be separated from terrorist groups in order to be able to move forward; after the UN had blamed all parties for the failure of evacuating injured people in Eastern Aleppo during the three-day ceasefires and called for "a permanent and comprehensive ceasefire so that life-saving humanitarian activities, including medical evacuations, can resume," meanwhile the Syrian Ambassador to Moscow ruled out any opportunity to restore the ceasefires. - On October 26, a school in the village of Haas, in rebel-held Idlib, was hit by a raid of airstrikes, causing the death of twenty-two children and six teachers. The UN Secretary-General called for an immediate investigation on this attack, as it could amount as war crimes if deliberate. Russia denied its responsibility and claimed that the damage was not consistent with an airstrike. - On October 27, Virginia Gamba, the head of the UN-OPCW Joint Investigative Mechanism, presented the mechanism's findings to the Security Council. The report indicated that of the nine cases the JIM investigated, the Syrian regime used chlorine gas against civilians in three cases and the IS used mustard gas in one case. In the remaining five cases, the JIM investigated allegations that the government dropped chlorine bombs in rebel-held areas. While the JIM could not make a conclusive determination in three of these five cases, it was able to establish that government airstrikes had occurred and the presence of a toxic substance, but it was unable to fully determine the link between the two, or the actors responsible. Russian Ambassador Vitaly Churkin questioned the JIM's findings, and expressed reservations over the US-draft resolution to extend the mandate of the mechanism for another year, which would end on 31 October 2016. - The EU added ten top Syrian officials to its sanctions list who are held responsible for "violent repression against the civilian population in Syria." - On October 28, Syrian rebels relaunched Aleppo counter-attack aiming to break the siege imposed on Eastern Aleppo. The factions included the FSA and Jaish al-Fath targetting government-held Western Aleppo. - Syrian Foreign Minister Walid Muallem met with his Russian and Iranian counterparts in Moscow to discuss counterterrorism, the cessation of hostilities and improvement of humanitarian operations, and the resumption of the intra-Syrian talks. The three ministers held a joint press conference following their meeting. - On October 30, SE condemned Syrian rebels for the indiscriminate shelling of civilian areas in Western Aleppo, raising the number of casualties in the last 48 hours. - On October 31, the Security Council extended the mandate of the UN-OPCW JIM until November 18, 2016. November 2016: - On November 1, in a teleconference with the leaders of the Russian Armed Forces, Russian Defense Minister Sergei Shoigu mentioned that Russia had halted air strikes on eastern Aleppo for 16 days, following western criticism over a Russian-Syrian government assault that killed civilians and destroyed infrastructure. - On November 2, DM Shoigu announced that it would enforce a 10-hour humanitarian pause in Aleppo on November 4, to allow civilians and fighters to exit the city through eight safe corridors. - On November 4, despite the announced unilateral ceasefire in Aleppo, there were no sign of civilians or fighters leaving the city, and opposition fighters vowed to continue fighting to break the siege. - On November 6, the SDF declared the launch of Operation "Wrath of the Euphrates" in the IS capital of Raqqa, which aimed at surrounding and isolating the city as an initial phase, in coordination with the US-led coalition airstrikes. The SDF had rejected any Turkish role to liberate the city. - On November 8, the Russian Defense Minister Shoigu announced that the first attack from the Admiral Kuznetsov, the aircraft carrier, and heavily armed escort ships were to bomb rebel positions in Aleppo. - On November 10, Jan Egeland, Advisor to the Special Envoy for Syria, declared in a press stakeout following the weekly HTF meeting that Eastern Aleppo had run out of food rations, and that the UN had proposed an initiative of four elements which included delivery of food and medical supplies, medical evacuations and access for health workers. - On November 11, the OPCW Executive Council condemned all parties for the use of chemical weapons in Syria, after voting on a US-tabled text in a closed session. The text was supported by 28 members, including Germany, France, the United States and Britain; it was opposed by Russia, China, Sudan and Iran, and there were nine abstentions. - On November 15, Russia launched its "major operation" targeting the IS and Jabhat al-Nusra's positions in Idlib and Homs provinces. Heavy airstrikes and barrel bombs pounded Eastern Aleppo after the pause declared by Russia and the Syrian Government on October 18. It is considered the first mission operated from the aircraft carrier Admiral Kuznetsov. - The Third Committee of the UN General Assembly adopted a draft resolution tabled by Saudi Arabia on the human rights situation in Syria, by a vote of 116 in favor, to 15 against with 49 abstentions. It called upon the Syrian regime and the IS to cease using chemical weapons, and stop their attacks on civilians. - On November 17, the UN Security Council adopted the US-draft resolution to extend the mandate of the UN-OPCW Joint Investigative Mechanism to 18 November 2017. - On November 20, Syrian Foreign Minister Walid Muallem held talks with the SE in Damascus, on the latest escalation of violence, the targeting of medical facilities and infrastructure, and the humanitarian initiative in Eastern Aleppo. The UN proposal of the withdrawal of al-Nusra fighters while maintaining the opposition's local administration of Eastern Aleppo; the proposal was rejected by the Syrian Government and called it a violation of "national sovereignty". - On November 23, the French Minister of Foreign Affairs Jean Ayrault announced that France would hold a meeting on Syria early December 2016. - On November 24, Jan Egeland Advisor to the Special Envoy for Syria briefed the press on the HTF meeting and the assistance deliveries of the month of November, not being able to reach besieged areas because of the absence of government approvals for convoys to enter and the escalation of violence. Egeland stated that the UN had received written approvals of the AOGs in eastern Aleppo and Russian support of the UN four-point plan, and still waiting for the government's approval. - On November 27, the rebels in Khan al-Shih town, in the outskirts of Damascus, handed in their weapons, as part of a local agreement with the Syrian government to withdraw to rebel-held Idlib province, so as government siege would be lifted. It was the only town not under government control on a major supply route from Damascus to Quneitra, in southern Syria. - On November 29, Egypt, New Zealand and Spain put in blue their draft resolution calling to put an end to all attacks on Aleppo, and allow unimpeded humanitarian access for the period of 7-days with consideration of further extension. The draft was later vetoed on 5 December by Russia and China, Venezuela voted against, and Angola abstained. It is Russia's sixth veto on a Syria draft resolution, and China's fifth veto. - After the Acting High Representative for Disarmament Affairs Kim Won-soo briefed Council members during Syria's chemical weapons consultations; the P3 announced they would circulate a draft resolution to impose sanctions on Syria for its use of chemical weapons against its own population. - On November 30, upon the request of France and the UK to hold an emergency meeting on Aleppo, SE Staffan de Mistura, USG Emergency Relief Coordinator Stephen O'brien and UNICEF Regional Director Geert Cappelaere briefed the Security Council on the situation in Aleppo, who agreed on the growing number of civilians fleeing eastern Aleppo and the dire need for safe humanitarian access. December 2016: - On December 1, ten AOGs announced the formation of 'Jaysh Halab' in Eastern Aleppo, in an attempt to unite their efforts to lift the siege and restore the districts where the pro-government militias took over in northeast and east Aleppo. It was led by Abu Abdul Rahman Nour, a senior commander in 'Jabhat al-Sham'. While Jan Egeland, Advisor to the Special Envoy for Syria, and the SE briefed the press on the humanitarian situation in Aleppo after the HTF meeting; they mentioned that over 400,000 IDPs are in west Aleppo, and UN convoys reached reached all towns under the Four-Towns Agreement, including Madaya, al-Foua and Kafraya, and Zabadani, and that the December Plan was yet to be approved by the Syrian government. - On December 3, the Syrian armed forces and its supporting militias advanced into east Aleppo, taking over 60 percent of the city that was once under rebel control since mid-2012. More than 80,000 civilians fled the area since the beginning of the regime's offense on November 15. - On December 7, AOGs called for a five-day ceasefire in Aleppo, and medical and civilian evacuations without mentioning the withdrawal of their fighters as demanded by Moscow and Damascus. Meanwhile, U.S. Secretary of State John Kerry met with Russian Foreign Minister Sergei Lavrov in Germany to discuss the evacuation of opposition-held districts of Eastern Aleppo, and no agreement was reached. While leaders of Canada, France, Germany, Italy, the UK and the United States released a joint statement on the situation in Aleppo calling for an immediate ceasefire and the resumption of political negotiations. - On December 8, the SE briefed the Security Council in closed consultations after the Russian announcement that it paused its operations in eastern Aleppo to allow the evacuation of civilians. Jan Egeland had said, after the weekly HTF meeting, that the co-chairs are "poles apart" on a united humanitarian diplomacy. IS launched a major offensive on Palmyra, seizing a number of gas fields in the north and few mountains in the south. - On December 9, the General Assembly adopted the Canadian-drafted resolution A/RES/71/130, which calls for an immediate cessation of hostilities and the implementation of resolutions 2268 and 2254. The resolution passed by a vote of 122 to 13, with 36 abstentions. Russia, Iran and China opposed the resolution. - On December 10, Paris hosted a meeting of "like-minded" counterparts on Syria; it brought together US Secretary of State John Kerry, German Foreign Minister Frank-Walter Steinmeier, British Foreign Secretary Boris Johnson and Turkish Foreign Affairs Minister Mevlut Cavusoglu, along with Qatar, the United Arab Emirates, Jordan and Saudi Arabia. They discussed the humanitarian situation, and called for a ceasefire and a post Aleppo plan, as Syrian government forces neared victory over rebels there. - On December 11, ISIS recaptured the city of Palmyra in Eastern Homs Province forces despite heavy air support provided by Russia. - On December 13, the United Nations Secretary-General Ban Ki-moon briefed the Security Council on the situation in Aleppo, the growing number of IDPs and allegations of torture and executions. Meanwhile, AOGs agreed to evacuate their remaining positions in eastern Aleppo after the Syrian government recaptured the city and following an agreement between Russia and Turkey. The evacuation was initially scheduled to take place on 14 December, but was delayed after Iran called for simultaneous evacuations from the besieged Shi'a-majority towns of Fu'ah and Kafraya in Idlib Province. - On December 15, the LAS held an emergency meeting at the level of representatives, based on Qatar's request, and adopted resolution 8105 condemning the attacks on civilians in Eastern Aleppo. - On December 19, the Security Council unanimously adopted the French-drafted resolution 2328 which demanded that the UN and other relevant agencies to carry out adequate and neutral monitoring of evacuations from eastern Aleppo, ensure the deployment of staff members for this purpose, and emphasized that the evacuations of civilians must be voluntary and to final destinations of their choice. Also, the LAS Ministerial Council welcomed resolution 8106 reiterating the necessity to establish a full cease-fire in Aleppo in accordance with the Security Council resolution 2328, and condemned terrorism in all its forms and crimes committed against civilians by ISIS, Fateh al- Sham Front, and that actions of both the Syrian regime and other militant groups may amount to war crimes. - Following the adoption of resolution 2328, the Office of the Special Envoy for Syria announced "the intention of the United Nations to convene the intra-Syrian negotiations mandated by Security Council resolution 2254 in Geneva on 8 February 2017." - On December 20th, the foreign and defense ministers of Russia, Turkey and Iran held parallel trilateral meetings in Moscow, despite the assassination of the Russian Ambassador to Turkey Andrey Karlov on December 19, and adopted the "Moscow Declaration" by which they agreed to act as guarantor powers for a peace accord between the Syrian government and the opposition. - On December 21, the UN General Assembly adopted a resolution establishing a mechanism to assist in the investigation of serious crimes committed in Syria since 2011. The resolution received 105 votes for, with 52 abstentions, and 15 votes against (Algeria, Belarus, Bolivia, Burundi, China, Cuba, DPRK, Iran, Kyrgyzstan, Nicaragua, Russia, South Sudan, Syria, Venezuela, and Zimbabwe). The UN Secretary-General submitted the report of the UN Headquarters Board of Inquiry that was established to investigate the humanitarian convoy incident in Urum al-Kubra on 19 September 2016., which stated that there is no enough evidence to conclude that the convoy was deliberately attacked. - On December 22, the Syrian army announced its full control over Aleppo, after the evacuations of the remaining rebel fighters. Evacuations had faced many delays because of Iran's demands to evacuate 1500 individuals from the opposition-besieged towns of Zabadani and Madaya. On the following day, the Russian military deployed a battalion to clear the city from improvised explosive devices. - On December 23, USG Stephen O'brien briefed the Security Council, upon the request of France, "on the modalities of the evacuation of civilians and delivery of humanitarian aid in East Aleppo." Meanwhile, Syrian government forces bombed the water pumping station during its raid on opposition-held Wadi Barada, disrupting water supply to Damascus. - On December 26, Kazakhstan accepted the Russian proposal to host peace negotiations between the Syrian government and opposition forces to find a solution to the Syrian crisis, in January 2017. - On December 27, the Russian and Turkish foreign ministers agreed to implement a nationwide ceasefire in Syria, separate moderate opposition groups from UN designated terrorist groups, and prepare for the Astana talks. - On December 28-30, the DFNS met in the city of Rmeilan to approve the draft constitution, known as the social contract, which was adopted on January 29, 2014 to form its administrative system and prepare for elections. Kurdish leaders voted to drop the word "Rojava" from the official name to include other ethnic and religious components in northern Syria. - On December 29, Russia and Turkey submitted the countrywide ceasefire plan to the warring parties, which had taken effect at midnight on 30 December 2016 Damascus time. - On December 31, the UN Security Council adopted resolution 2336 in support of the Russian- Turkish agreement and the meeting to be held in Astana on 23 January 2017. January 2017: - On January 2, the Russian and Turkish air raids targeted IS militants in northern Syrian city of al-Bab; while 10 rebel factions threatened they would suspend talks regarding Astana until the ceasefire is fully implemented because of "major and frequent violations" in the rebel-held areas of Wadi Barada and Eastern Ghouta near Damascus. - On January 5, the SE welcomed the nationwide ceasefire, and the Security Council resolutions on Aleppo and Astana talks, in a press briefing after the weekly HTF meeting. Jan Egeland Advisor to the Special Envoy for Syria, voiced disappointment over the government's denied aid access to 5 out 21 locations including places in Rural Damascus, Homs and Hama. - On January 6, the Russian military started to cut down on its presence in Syria, Military Chief Valery Gerasimov mentioned that the aircraft carrier Admiral Kuznetsov would be the first to withdraw from the Mediterranean. - On January 8, Syrian government airstrikes resumed on Wadi Barada after failing to reach an agreement with opposition groups to repair the damaged water springs. Later on January 14th, the retired army officer Ahmad al-Ghadban who negotiated the deal to restore the water was killed amid heavy clashes between rebels and pro-regime forces. Both sides accused each other. - On January 12, the US imposed sanctions on 18 senior Syrian officials who were connected to the development and use of chemical weapons including chlorine gas against civilians. It marked the first time the US sanctioned Syrian military officials. While Russia and Turkey signed an agreement to coordinate their airstrikes against terrorists in Syria. - On January 13, the Syrian state television accused Israel of targeting Mezzeh Airbase outside of Damascus. - On January 14, IS launched a major offensive against pro-regime forces (Hezboallah) in Deir al-Zor Province, cutting the communication between the military base and the city. - On January 16, the High Representative/Vice-President Federica Mogherini will host an international conference on the future of Syria in Brussels, which "aims to identify with regional partners common ground on the post-conflict arrangements and examine the scope for reconsciliation and reconstruction of Syria." - On January 19, an agreement was reached in Wadi Barada, allowing regime maintenance teams to enter the area to fix the water pipes and grant rebels amnesty or safe passage to opposition-held Idlib. - On January 20, IS militants destroyed Palmyra's Tetrapylon with only four of sixteen columns still standing, and the facade of its Roman Theatre. The UNESCO condemned the act as a new war crime. - Russia and Syria concluded a bilateral agreement on expanding and modernizing of the Russian Naval Facility in Tartus. The agreement extends the current lease for the next forty-nine years with automatic extensions and permits the simultaneous deployment of up to eleven warships to the port. - On January 23-24, indirect talks between the Syrian government and opposition were held in Astana; the delegations refused to sign the joint declaration issued by Russia, Turkey and Iran, on setting up a "trilateral mechanism" to monitor and enforce the ceasefire. The new US administration was invited, despite Iran's objection, and was represented by its ambassador to Kazakhstan. The UN SE was present, and hoped Astana talks would support the intra-Syrian negotiations to be held in Geneva in February. - On January 24, the Russian delegation shared its draft of the Syrian Constitution with the Syrian delegations, and advocated the creation of a Constitutional Committee consisting of members of both delegations. - On January 23-24, Finland and UN agencies hosted the Helsinki Conference on Supporting Syrians and the Region, which launched the 2017-2018 Regional Refugee and Resilience Plan (3RP). - On January 25, the US President Donald Trump called for establishing safe zones for refugees in Syria, after suspending visas for Syrians and other middle eastern states. President Trump later held telephone conversations with Saudi King Salman bin Abdul-Aziz and United Arab Emirates Armed Forces Deputy Supreme Commander Mohammed bin Zayed on January 29 to seek their support for his unidentified initiative. - On January 28-30, 1100 opposition fighters and 750 civilians evacuated Wadi Barada to Idlib Province, after reaching a reconciliation deal with pro-regime forces. The Syrian Forces reached Ain Fijeh spring to restore water to Damascus. - On January 30, the US delivered armored vehicles, medium and heavy weapons to SDF, in an attempt to isolate IS in al-Raqqa City. - On January 31, the SE briefed the Security Council in a closed session on the outcomes of the Astana talks and the upcoming intra-Syrian talks in Geneva, which was pushed to February 20. He mentioned if the Syrian opposition could not form an inclusive delegation by 8 February, he would select its representatives himself. The Council members welcomed the International Meeting on Syria in Astana, in a press statement. February 2017: - On February 6, high-level experts from Russia, Iran, Turkey, Jordan and the UN held their first technical meeting in Astana to discuss the implementation of the ceasefire mechanism, and cooperation on humanitarian issues; they agreed on the Concept Paper on the Joint Group. The Joint Group held its first meeting and managed to identify all areas controlled by IS and Jabhat Fatah al-Sham; the participants received two draft documents prepared by the Russians to be discussed in future Joint Group meetings, which are the Protocol to the Agreement on the mechanism to record violations of the cessation of hostilities in Syria announced on December 30, 2016 and the Procedure for imposing sanctions on violators, as well as the Regulation on Reconciled Areas. - On February 7, Amnesty International released its report (attached) on mass executions of as many as 13,000 detainees at Saydnaya Military Prison. Syrian authorities rejected the accusations. - On February 9, Russian airstrikes mistakenly kill three Turkish soldiers and injured eleven others near al-Bab city held by Turkish Armed Forces as part of Operation Euphrates Shield. Both sides agreed to strengthen their coordination. - On February 10-11, the HNC met in Riyadh and formed a delegation of 21 members, headed by Nasr al-Hariri; it included one representative each from the Cairo and Moscow groups. The HNC stated (Arabic statement attached) that the goal of the negotiations was a political transition under U.N. auspices in which Assad had no role in the future of the country. - On February 12, Turkish President Recep Erdogan stressed that the Operation Euphrates Shield aims to establish a five-thousand square kilometer 'safe zone' that includes Al-Bab, Manbij, and al-Raqqa City in Northern Syria. The safe zone would require the implementation of a no-fly zone, mentioning that he had discussed the issue with both the U.S. and Russia. - On February 13, the SE sent out invitations to the Syrian delegations for the intra-Syrian negotiations set to begin on February 23. - On February 15-16, the second round of talks took place in Astana a day later than scheduled; the opposition delegation was represented by only 9 armed groups from 14 groups which attended the first meeting; no direct meetings between the Syrian delegations were held and it ended without a final statement. The three guarantor states agreed to the Concept Paper on the Joint Group of the trilateral mechanism to observe the ceasefire, share information regarding the investigation of violations and promote confidence-building measures such as the release of detainees and abductees. - On February 17, a meeting between the "like-minded" states on Syria was held on the margins of the Bonn G20 Summit, and discussed Syria peace talks in Geneva. - On February 18, Turkey offered the US two proposals for an offensive against IS in al-Raqqa City that excludes the YPG. The preferred proposal calls for the insertion of opposition groups backed by Turkey into Tel Abyad in Northern al-Raqqa Province in order to advance against al- Raqqa City through a twelve-mile-wide corridor through terrain currently held by the SDF. The second proposal calls for opposition groups in Operation Euphrates Shield to advance more than one hundred miles from Northern Aleppo Province to Western al-Raqqa Province. - On February 21, the US CIA froze assistance to the FSA and its affiliated factions fighting in Northwestern Syria, after they came under an attack from Hay'at Tahrir al-sham HTS (successor of Jabhat Fateh al-Sham) in January. The aid included salaries, training, ammunition and in some cases guided anti-tank missiles. - On February 23, a fourth round of the intra-Syrian talks commenced in Geneva with no expectations of a breakthrough; the SE reiterated that that resolution 2254 sets the framework of the negotiations, which calls for the establishment of credible, inclusive and non-sectarian governance, and sets a timeline for drafting a new constitution and holding free and fair elections within 18 months. A day before in the ISSG Ceasefire Task Force meeting (CTF), Russia had called on the Syrian Government to halt aerial bombings during the discussions. - The Opposition groups backed by the Operation Euphrates Shield fully seized al-Bab in Northern Aleppo Province, after three months of clashes. - On February 24, the SE shared a paper on procedural issues, in bilateral meetings with the Syrian parties. The HNC held the Cairo and Moscow platforms responsible for the delay of direct talks, as they participated separately. - While Iraq conducted its first cross-border airstrikes against IS in Deir ez-Zour Province on the Syrian-Iraqi Border. The F-16 airstrikes were coordinated with the Syrian Government through a joint intelligence-sharing unit in Baghdad that includes Iraq, Syria, Russia, and Iran. Also, The U.S. provided intelligence in support of the operation. - On February 25, HTS claimed responsibility of a suicide attack on the State Security and Military Intelligence Offices in Homs City, killing at least forty pro-regime officers including Military Intelligence Branch Chief Brig. Gen. Hassan Dabul, so as to undermine the ongoing peace talks. The attacks prompted heavy airstrikes on al-Waer District, the Opposition's last strong-hold in the city. The HNC condemned the terrorist attack as per the Government's ultimatum. - On February 28, the UN Security Council voted on the French-British draft resolution which sought to ban the sale or supply of helicopters to the Syrian Government, and to blacklist 10 government and related entities involved in the production of chemical weapons. Nine countries voted in favor; Bolivia voted against the text, while Ethiopia, Egypt and Kazakhstan abstained. Russia casted its sixth veto backed by China. Britain and France had circulated the text in mid- December 2016, in response to the OPCW report findings proving government use of chlorine gas in three cases of the nine investigated cases. It was put on hold to asses US policy on Syria, the US later became a co-penholder after its unilateral sanctions on 18 Syrian senior officials on January 12. March 2017: - On March 1, the Independent Commission of Inquiry on Syria issued its report on the violations committed by warring parties in the last battle of eastern Aleppo, and considered the targeting of vital civilian infrastructure, withholding the distribution of humanitarian aid, and the use of civilians as human shields and forced evacuation agreements amount to war crimes. - On March 2, the Syrian forces backed by Russian airstrikes and Shi'a militias recaptured the city of Palmyra for the second time after heavy clashes. - On March 3, the fourth round of talks concluded with a political agenda for the upcoming round, which comprises of three baskets addressing the establishment of credible, inclusive and non-sectarian governance, drafting a new constitution, and holding free and fair elections within 18 months. A fourth basket was added upon the request of the Syrian Government to address "strategies of counter terrorism, security, governance and also medium-term confidence building measures." - On March 6, Russia announced a ceasefire in Eastern Ghouta until March 20, despite the continuation of airstrikes and mutual shelling. - On March 7, the US-allied SDF agreed to handover six villages near Manbij, on the frontline with Turkey-backed rebels to Syrian government control, under a Russian-brokered deal, in an attempt to stop further Turkish incursion. - On March 8, the SE de Mistura briefed the Security Council on the course of the talks, which aims to address the aforementioned baskets in parallel, and concluded that "nothing is agreed until everything is agreed unless the sides decide otherwise." The Syrian groups are invited to resume talks on March 23. - Meanwhile, Russian, US, Turkish high-level military officials met in Antalya to discuss additional coordination measures and "operational de-confliction of military operations" in northern Syria. - On March 13, a Russian-brokered agreement was reached to evacuate rebel fighters from Homs city, which would be carried out within six to eight weeks, between 10,000-15,000 people were expected to leave Homs in weekly batches. The neighborhood was besieged by regime forces since 2013. - On March 14, the EU unveiled its plan in Syria "in contributing to a lasting political solution under the existing UN-agreed framework and in helping to build resilience and stability in the country, as well as supporting post-agreement reconstruction once a credible political transition is underway." - On March 14-15, the third round of talks was held in Astana, even though the AOGs had called for the postponement of the meeting to assess the commitment to the declared ceasefire in Eastern Ghouta. Invitations were sent to the United Nations, the United States and Jordan. On March 14, preliminary consultations were held while a plenary meeting was due on March 15. The results of the intra-Syrian consultations were expected to be discussed. Talks failed to reach any significant agreement, and the three guarantor states issued a joint statement, and scheduled the next high-level meeting in Astana on May 3-4, 2017 and agreed to hold preliminary expert consultations on April 18-19, 2017 in Tehran. - On March 15, two suicide bombs targeted Damascus on the sixth war anniversary; one of them hit the main judicial building, and both killed 74 people and wounding a hundred other. It was later claimed by Fateh al-Sham Front. - On March 18, rebels began to evacuate al-Waer neighborhood in Homs City, to the opposition-held northern town of Jarablus on the borders with Turkey. - On March 20, the EU imposed sanctions against four Syrian high-ranked military officials related to the use of chemical weapons. The ban includes assets freeze and travel ban, and it is considered the first time the EU blacklists military officials. - On March 21, the US-led coalition dropped the SDF fighters on the southern side of the Euphrates to to cut the Aleppo - al-Raqqa Highway. the SDF launched an operation to seize the Tabqa Dam west of al-Raqqa City on March 22 with extensive support from the US. - On March 22, a US-led coalition strike on a center for displaced families in al-Mansoura town held by ISIL in northern Raqqa, killed 33 people. Earlier this month, the coalition declared that its raids in Syria and Iraq unintentionally killed at least 220 civilians. - On March 23-31, the fifth round of talks in Geneva was held despite of the escalation of fighting in Damascus and Hama; the SE shared non-papers with all Syrian sides with some political principles reached during the five rounds, and received their comments and amendments. - On March 24, Russia proposed a draft resolution on the use of chemical weapons in Syria and Iraq, that was reviewed in April 2016 and the UN Security Council did not support it. It was co-authored by China and Russia. Meanwhile, the Human Rights Council adopted a resolution condemning the indiscriminate attacks against civilians, forced displacement of populations, and called to hold all those responsible to account. - On March 27, the second phase of evacuations from al-Waer neighborhood took place, moving 466 citizens and 129 fighters. Meanwhile, the UN SE briefed the LAS Ministerial Council on the recent developments of the Geneva intra-Syrian talks and the Astana process. - On March 28, Russia condemned the US-led coalition airstrikes on the Tabqa Dam, and accused it of trying to "completely destroy critical infrastructure in Syria and complicate post-war reconstruction as much as possible." It further claimed that the coalition destroyed four bridges over the Euphrates river. - On March 29, the UN Secretary-General Antonio Guterres addressed the annual Arab Summit, which was held in the Dead Sea, Jordan. He appealed to the Arab leaders to set aside differences and end the Syrian war. - An agreement was brokered by Iran and Qatar to swap Shi'ite citizens from the two pro-government towns of al-Foua and Kafraya, in the northwestern province of Idlib besieged by rebel fighters, with Sunni fighters and their families from the opposition-held towns of Zabadani and Madaya besieged by pro-government forces. The agreement was due to start on April 4 and would last 60 days; it included a ceasefire in the areas south of Damascus, aid deliveries, and the release of 1,500 prisoners held by the government. - On March 31, U.S. Secretary of State Rex Tillerson disclosed during his visit to Ankara that "longer-term status of President Assad will be decided by the Syrian people" and defeating ISIL is its priority, while U.S. Ambassador to the UN Nikki Haley said the priority was no longer "getting Assad out"; it was later reiterated by the White House Press Secretary Sean Spicer's briefing. April 2017: - On April 3, the European Foreign Affairs Council chaired by the EU High Representative for Foreign Affairs and Security Policy Federica Mogherini took place in Luxembourg, and adopted the EU Strategy on Syria. It held the Syrian regime responsible for the violations against human rights, and reaffirmed that "there can be no lasting peace in Syria under the current regime." - On April 4-5, the EU and its co-sponsors hosted the Brussels Conference on Supporting the future of Syria and the region. The co-chairs declaration took note of UN appeals requesting $8 billion in 2017 to cover the required needs inside Syria and its neighboring countries, and announced pledges raised worth about $11 billion for humanitarian aid programs. - On April 4, an alleged chemical attack on Khan Shaykhun in the province of Idlib was carried out during a Syrian government air raid on the city, which claimed the lives of at least 72 civilians. Russia denied its responsibility and claimed that Syrian airstrikes targeted a rebel chemical weapons warehouse which leaked poisonous gas. While the implementation of the evacuation deal of 30,000 people from the four towns of Kafraya, al-Foua, Madaya and Zabadani was delayed because of reservations of their residents. All 16,000 residents of al-Foua and Kafraya are expected to leave under the deal. - On April 5, the UN Security Council was briefed on the attack by the Acting High Representative for Disarmament Affairs Kim Won-soo on the reported use of chemical weapons in Khan Shaykhun. The US, UK and France had informally circulated a draft resolution which demands that the Syrian government must provide the JIM and the FFM with flight plans and logs of April 4, the names of all helicopter squadron commanders and provide access to air bases where investigators believe chemical attacks may have been launched. Russia criticized the text, and produced its own draft; it did not condemn neither the attack nor the Syrian government, but rather expressed deep concern over the alleged "incident with chemical weapons" and called for a full-scale investigation. Later on April 6, the ten elected members (E10) of the Security Council met at ambassador level to express their frustration for not being included in the negotiating process and discussed an alternative text which would substitute language in the P3 draft on the Syrian government's obligation to provide information on its activities with agreed language from resolution 2118. Neither resolution were tabled for a vote. - On April 6, the US waged retaliatory airstrikes against al-Shayrat airbase outside of Homs, where the chemical attack was launched. 59 Tomahawk cruise missiles had hit the airfield in Syria. The missiles were aimed at Syrian fighter jets and other infrastructure. - On April 7, Bolivia called for a Security Council briefing after the US airstrikes, and Russia announced its suspension of "the Memorandum of Understanding on Prevention of Flight Safety Incidents in the course of operations in Syria signed with the US." - On April 11, the White House released a declassified report drawn up by the National Security Council which confirmed that the Assad regime used sarin gas on its own people, and accused Russia for shielding for its allies. - On April 12, the Security Council held a meeting to vote on the P3 revised draft resolution (4th draft), which incorporated the language from resolution 2118 proposed in the E10 draft; after the SE had provided the council with his monthly briefing on the assessment of the intra-Syrian talks held in Geneva. Ten members voted in favor of the text, China, Ethiopia and Kazakhstan abstained, while Bolivia joined Russia in voting against it. It is Russia's eighth veto against a Syria-related resolution. - On April 14, the evacuation of residents from the Shi'ite towns of al-Foua and Kafraya (besieged by opposition groups) began and their convoys headed towards the government-held Aleppo; meanwhile rebel fighters and their families left the town of Madaya (besieged by government forces) and headed towards Idlib. While the evacuation from Zabadani was delayed and expected to begin later the day. The four towns agreement began with the exchange of thirty prisoners and nine bodies on April 12. The evacuations resumed after a suicide attack that targeted a government loyalties convoy killing some hundred people including women, children and rebel fighters on April 15. - On April 19-20, over 2000 opposition fighters and civilians were evacuated from the besieged towns of Zabadani and Madaya in exchange for the evacuation of nearly 8000 pro-regime fighters and civilians from the besieged towns of al-Foua and Kafraya in Idlib Province. - On April 24, the US sanctioned 271 Syrians employed by the Syrian Scientific Studies and Research Center, related to the development of chemical weapons. The sanction froze the individuals' assets and prohibited US companies to conduct business with them. May 2017: - On May 3-4, military experts from the three guarantors held technical consultations ahead of the two-day fourth round of the Astana process, with the participation of the Director of the UN Mine Action Service Agnes Marcaillou. The SE de Mistura and Nawaf Uasfi Tel, Political Adviser to Jordan's Foreign Minister attended as observers, and the US was represented at a higher-level (for the first time) by US Assistant Secretary of State for Middle East Affairs Stuart Jones. - Despite the Syrian Opposition delegation suspended their participation in opposition to the ongoing bombardments across Syria, the three guarantors signed the Memorandum on the creation of de-escalation areas in Syria, setting up four "de-escalation zones" in Idlib, parts of Homs, Eastern Ghouta, and parts of Deraa and al-Quneitra provinces in southern Syria. The Syrian government welcomed the Russian initiative while the Opposition rejected Iran's involvement as a guarantor. - On May 5, Russia sought UN endorsement to the agreement reached in Astana, and circulated a draft resolution calling on member states to contribute to the implementation of the Memorandum on the creation of de-escalation zones in Syria. The resolution failed to pass for a vote on May 8, as western member states had reservations on the draft. - On May 6, Riad Seif was elected as the sixth president of the SOC, beating Khaled Khoja with 58 votes from the 102 member coalition. He would replace the current head Anas al-Abdeh, who was elected in March 2016. Also, Abdulrahman Mustafa and Salwa Ktaw were elected as vice presidents. - On May 8, the evacuation process of the government-besieged Damascus suburb of Barzeh began, around 1,022 people, including 568 rebels, headed towards Idlib and northern town of Jarablus near the Turkish borders; the second convoy of 700 rebels moved on May 12. While Walid al-Muallem, the Syrian Foreign Minister, rejected any international forces under UN supervision to monitor the de-escalation zones deal. Meanwhile, the White House approved providing arms to Kurdish fighters as support to their operation to retake al-Raqqa City, despite Turkey's strong opposition. - On May 16, the FFM's report confirmed the use of sulfur mustard in the attack on Aleppo on Sept. 16, 2016, and was made public. The report was raised to the UN Security Council on May 5. The FFM, also, confirmed in its report, regarding its investigation of the April 4 attack on Khan Shaykhun, the use of sarin-gas or a sarin-like substance. The FFM is only mandated for indicating whether chemical weapons were used, while the JIM is mandated to determine responsibility for the attacks. - While the US Department of the Treasury's Office of Foreign Assets Control sanctioned ten additional entities for providing support to the Syrian regime. - On May 16-19, the UN SE held the sixth round of the Intra-Syrian talks in Geneva, which ended without covering the four baskets of the agenda, only focusing on the constitutional issues. The SE shared a proposal with the parties to establish "a Technical Consultative Mechanism on Constitutional and Legal Issues;" the proposal would identify "options for the process of constitutional drafting, and for the conduct of a national conference/national dialogue, and identify for review specific options for ensuring a sound constitutional and legal basis for any framework agreed in Geneva embodying a package and including providing for credible, all-inclusive, non-sectarian governance," and that is through UN-facilitated expert-level meetings with both Syrian sides. - On May 18, while the EU Parliament adopted a resolution pertaining the EU Strategy on Syria, which the European Council for Foreign Affairs had passed on 3 April 2017; the US-led coalition's airstrikes destroyed a pro-Syrian regime convoy of the Iraqi Shi'ite militia of Kata'ib Imam Ali, that advanced along the Damascus-Baghdad Highway towards al-Tanf base (where the US, UK and Jordan train fighters of Jaysh Mughawir al-Thawra against IS in Eastern Syria). - On May 20-21, the evacuation of nearly 3000 people, some 700 fighters and their families, was completed from al-Waer district, the last opposition-held district in the province of Homs. According to Talal Barazi, Governor of Homs, more than 14,000 people had left al-Waer in several phases since the "reconciliation deal" began to be implemented in March. Among them were some 3,700 rebels, allowed to leave with their light weapons. Russia later deployed 50 to 150 Military Police into the district. - On May 22, the SE briefed the Security Council on the latest developments, and on the last round of the Intra-Syrian talks. He commended the Astana process for the reduction of violence in the agreed de-escalation areas, and urged its guarantors to finalize their agreement addressing the subjects of detainees, abductees and humanitarian demining. The SE asserted that the rounds' focus on legal and constitutional issues does not rule out "the principle of parallelism" in addressing the agenda, and that a new consultative process at a technical level was introduced to discuss relevant constitutional and legal matters. - On May 25, NATO leaders agreed in Brussels to become full members of the Global Coalition against ISIS; the organization would not engage in combat operations, but would provide air refueling to the Coalition's aircrafts, capacity building through the deployment of special forces to train local partners, and would establish an intelligence information cell to ensure information-sharing on foreign fighters. - On May 29, the final convoy of fighters and their families moved from the opposition-held besieged district of Barzeh in Damascus to Idlib Province; estimately more than 4000 fighters and civilians were evacuated from Barzeh and Eastern Ghouta under the Russian-brokered deal. - On May 30, the US delivered its first shipment of arms to the Kurdish-led SDF, which had advanced against IS in the eastern outskirts of al-Raqqa, seizing eight villages and taking control over the Ba'ath Dam. - On May 31, Russia's Grigorovich-Class Frigate Admiral Essen and Kilo-Class Submarine Krasnodar launched four cruise missiles targeting IS near Palmyra; it targetted arms depots of fighters relocating from al-Raqqa to Eastern Homs. Russia had notified the US, Turkey, and Israel of the strikes-On June 2, EU High Representative Federica Mogherini met with newly-elected President of the Syrian Opposition Council (SOC), Riad Seif, and Syrian Interim Government (SIG) Prime Minister, Jawad Abou Hatab, to discuss the political process and EU support for Syrian resilience. Both parties reiterated their commitment to the UN-led Geneva process. June 2017: -On June 4, pro-government forces gained control of Maskanah city, the last remaining ISIS stronghold in Aleppo governorate. The advances brought pro-government forces within 10 km of Raqqa's provincial border. -US-backed SDF captured a hydroelectric facility (Baath Dam) from ISIS militants, securing the final of three major dams along the Euphrates river. -On June 5, pro-government forces captured the areas of al-Alb, Bir Dahlon and Sharot Dahlon in Eastern Homs governorate, reportedly capturing over 6,000 sq km of ISIS-held territory. -On June 6, US-backed SDF announced the launch of the fifth phase of the campaign to capture Raqqa, ISIS' self-declared capital, with forces advancing from the north, east and west and the US-led Coalition supporting the offensive with air and artillery strikes. - The US-led Coalition conducted airstrikes against pro-government forces advancing near al- Tanf, a de-confliction zone in southeastern Syria. This marks the second strike in the area in less than a month, amid escalating tensions between the US and Iran-backed forces over control of Syria's southeastern frontier. - On June 8, Russian Foreign Minister Sergei Lavrov met with the UNSE de Mistura in Moscow to discuss "the consolidation of the cessation of hostilities, the fight against terrorism, the continuation of the political settlement on the basis of UN Security Council Resolution 2254," according to the Russian Presidential Envoy for the Middle East and North Africa and Deputy Foreign Minister Mikhail Bogdanov. The consultations were held prior to the fifth round of the Astana Process, which was set to take place in June, but was later postponed till the month of July. -On June 9, during a press briefing in Geneva at the conclusion of a meeting of the humanitarian task force set up by the International Syria Support Group (ISSG), the SE declared that the time was not right to resume the UN-led intra-Syrian talks. -On June 13, the WFP delivered food to more than 80,000 displaced people in seven hard-to-reach areas in Raqqa and Deir Ezzor governorates in northern Syria, where regular deliveries of humanitarian assistance had been suspended for over three years. -On June 14, Chairman of the CoI, Paulo Pinheiro, expressed concern for the "staggering loss of civilian life" caused by US-led Coalition airstrikes as part of the Raqqa campaign, stating that airstrikes had led to the displacement of 160,000 civilians. He also stressed that the Astana agreement had led to a reduction in violence in just one of the four zones outlined in the memorandum. -On June 15, during a briefing to Council members, UN High Representative for Disarmament Affairs, Izumi Nakamitsu, noted that "some progress" had been made in the implementation of resolution 2118 (2013) on the elimination of chemical weapons in Syria. However, she highlighted the continued lack of safe access to two above-ground stationary facilities scheduled for destruction under OPCW supervision. -Pro-government forces targeted the opposition-held neighborhoods of Jobar and Eastern Ghouta in the first major attack since the announcement of four "de-escalation zones" at the Astana talks in May. Syrian Armed Forces seized the Arak gas field in the region of Badiya, which had been captured by IS since 2015; the SAF declared that it recaptured 20 percent of the Badiya region. -On June 16, the Office of the Special Envoy for Syria declared that it had facilitated a meeting of technical experts from three opposition groups: the High Negotiating Committee, the Cairo Platform and the Moscow Platform as part of a technical consultation process announced at the end of the sixth round of intra-Syrian talks. The meetings focused on the timeline and process for drafting a new constitution. -On June 17, the SE announced that the seventh round of intra-Syrian talks would begin in Geneva on July 10, with further rounds tentatively planned for August and September. -The Syrian government declared a 48-hour ceasefire in the southern city of Daraa. The agreement, reportedly brokered by Russia, the US and Jordan, comes after an escalation in violence between pro-government forces and AOGs in Daraa. -On June 18, US-led coalition forces shot down a piloted Syrian government aircraft in southern Raqqa province. According to the Coalition statement, the aircraft was downed after it displayed hostile intent and advanced on coalition forces. The Russian Ministry of Defense (MOD) released a statement following the incident claiming that the US shot down the Syrian jet while it was conducting an offensive against ISIS, and accusing the US of failing to use the "de-confliction channel". The MOD statement announced that Russia was cutting off participation in the de-confliction channel pending an investigation and that all kinds of airborne vehicles operating in combat mission zones west of the Euphrates River would be tracked by Russia as air targets. -Iran launched several ballistic missiles targeting ISIS positions in eastern Syria, reportedly carried out in retaliation for a terrorist attack in Tehran two weeks prior. This was Iran's first missile attack abroad in 15 years and its first in the Syrian conflict, representing an escalation of its role. -On June 19, the Syria Institute and PAX published the Sixth Quarterly Siege Watch Report, covering events from February to April 2017. -On June 20, an American fighter jet downed an "Iranian-made" armed drone in southern Syria after it "displayed hostile intent" when it approached coalition forces stationed at a base located in a de-escalation zone. It marked the second time in a month that the US had shot down an armed drone near Tanf camp. -On June 21, after opening a new front to the south of Raqqa, US-backed Syrian Democratic Forces (SDF) came within several kilometers of fully encircling the city after having already surrounded Raqqa to the north, east and west. - Turkey deployed reinforcements to the towns of Azaz and Marea in northern Syria, held by turkey-backed Syrian opposition forces, in preparation of anticipated battles with its rival Kurdish forces. - French President Emmanuel Macron, contradicting previous French policy, that France sees "no legitimate successor" to Assad and no longer considers his departure as a precondition to resolve the ongoing conflict. On July 5, the president met with Riad Hijab, Head of the HNC, to reiterate France's support to the Syrian Opposition. -On June 22, Turkish and Russian troops were deployed to Syria's northern Idlib province as part of a de-escalation agreement brokered by Russia, Turkey and Iran in May. - WFP announced that the first aid convoy had reached 15000 civilians in the city of Qamishli by land route, since it had been inaccessible in 2015, and humanitarian aid was sent through air drops instead. -On June 24, the Syrian government released 672 detainees in a move it said was aimed at bolstering the reconciliation process. -On June 27, the SE briefed the Council on the situation in Syria, expressing his readiness to facilitate direct talks between the Syrian government and opposition either at a formal or technical level. -On June 28, OPCW-JIM published its sixth report updating the SC on the status of its review of two cases identified by the FFM concerning incidents reported in Umm Hawsh in Aleppo Governorate in September 2016 and Khan Shaykhun in Idlib Governorate on April 4, 2017. -On June 29, OCHA head Stephen O'brien briefed the Council on the humanitarian situation in Syria, noting that despite a reduction in violence in some areas of the country, humanitarian convoys remained unable to reach civilians in besieged and hard-to-reach places due to bureaucratic restrictions. O'brien also detailed the Secretary-General's monthly report on the situation in Syria, released June 23, that highlighted the Astana memorandum signed by Iran, Russia and Turkey in May and the escalation of anti-ISIS operations in Syria. -The OPCW released a report on progress in the elimination of the Syrian chemical weapons program, verifying the destruction of 25 of the 27 chemical weapons production facilities previously declared by the Syrian government. However, the OPCW continues to express consideration that the initial declaration was incomplete. July 2017: -On July 1, Israeli Defense Forces (IDF) launched a strike against pro-government positions near al-Baath in Quneitra governorate in response to two stray artillery shells fired from Syria that landed in the Golan Heights. This is the fifth Israeli strike on pro-government positions near the area of al-Baath within a week. -On July 3, the UNSC appointed Catherine Marchi-Uhel to head the International, Impartial and Independent Mechanism, the UN legal team tasked with collecting and preserving evidence of the most serious crimes committed in Syria since 2011 to be used by national courts or an international tribunal. The Mechanism was established by the General Assembly on December 21, 2016 despite fierce resistance from Russia, which had previously used its veto status to block criminal investigations into the conflict. -The Syrian Army announced the suspension of all combat operations in the southern governorates of Daraa, Suweida and Quneitra for four days ahead of upcoming peace talks in Astana, Kazakhstan. It is the second unilateral ceasefire by the Syrian Army; it had announced a ceasefire in Daraa along the border with Israel on June 17. -On July 4-5, the fifth round of Astana talks co-sponsored by Russia, Iran and Turkey, convened in the Kazakh capital. The talks failed to finalize details on the boundaries and monitoring mechanisms of the four safe zones agreed to during the fourth round of Astana talks in May. In a joint statement, the guarantors welcomed the establishment of an expert-level joint working group tasked with finalizing the operational and technical parameters of the de-escalation zones, and scheduled the next Joint Working Group meeting in Tehran, on August 1-2. -On July 6, Edmond Mulet, head of the three-member leadership panel of the OPCW-JIM briefed Security Council members on the June 28 report of its investigations into the culpability for chemical attacks in Syria and urged the international community to allow the Mechanism to conduct its work in an independent and impartial manner. -On July 7, the United States, Russia and Jordan reached a ceasefire and "de-escalation" agreement for southwestern Syria to take effect July 9. The specificities of an enforcement mechanism and the precise boundaries of the ceasefire zone. Russian Foreign Minister Sergey Lavrov stated that the ceasefire would cover the areas of Daraa, al-Suweida and Quneitra governorates without providing exact boundaries. The ceasefire agreement in southwestern Syria is separate from the Astana memorandum, and was reached during the meeting between US President Trump and Russian President Vladimir Putin on the sidelines of the G20 Summit in Hamburg. The SG welcomed the ceasefire announcement, calling it a significant step towards reducing violence and humanitarian access in Syria; while Israel voiced its objections on the deal. -On July 10, the seventh round of UN-led intra-Syrian talks convened in Geneva. The UN-sponsored talks were scheduled to focus on four points: drafting a new constitution, combating terrorism, governance and elections. Russian Foreign Minister Sergey Lavrov expressed hope that the talks would help solidify de-escalation zones created through the Astana process. The SE stated that de-escalation zones can be beneficial but must only be interim measure to avoid the partition of Syria. The Geneva talks ended July 14 with no apparent progress. Representatives of the HNC accused the Syrian government of refusing to enter into serious negotiations. The SE noted that there had been "no breakthrough, no breakdown" during the talks and expressed hope that recent international momentum would push the parties face-to-face for substantive discussions. -On July 11, SOHR reported that it had "confirmed information" that ISIS leader Abu Bakr al- Baghdadi had been killed in the eastern province of Deir Ezzor. US-led Coalition Spokesperson Colonel Ryan Dillon could not confirm the report, nor could various media sources or Iraqi or Kurdish officials. -On July 12, following the opening of a land route connecting Aleppo to Hasakah governorate, WFP announced that it had successfully delivered food aid to two locations in the Raqqa governorate for the first time in three years. -On July 13, Brett McGurk, US Special Envoy for the Global Coalition fighting ISIS, revealed that Russia had expressed willingness to deploy military police to monitor compliance and prevent violations of the recently implemented ceasefire in southwestern Syria. -On July 14, Russia's parliament approved an agreement between Russian and Syrian officials that provides for the long-term deployment of Russian aircraft and personnel to Syria. Defense Minister Nikolay Pankov said the deal will help legalize Russia's military activities in Syria "within an international framework". -France proposed the creation of a contact group comprised of permanent members of the UN Security Council and regional actors to support UN efforts to formulate a political road map after the conflict ends. -On July 17, the EU added 16 scientists and military officials to the list of those targeted by sanctions against the Syrian regime due to their suspected involvement in a chemical attack against civilians in April. - The Syrian army, backed by Iranian-militias managed to seize oil fields of Wahab, al Fahd, Dbaysan, al-Qseer, Abu al Qatat and Abu Qatash and several other villages in the southwest of Raqqa province, while Russian strikes targeted the town of Sukhna, the gateway to Deir ez-zour. - The Turkish state-run Andalou Agency exposed ten US military locations in northern Syria, giving exact numbers of US and French special forces stationed there. The US-led Coalition against ISIS condemned Turkey for "leaking sensitive military information shared between two allies." -On July 19, it was made public that President Donald Trump ended a covert CIA program that provided arms and training to Syrian rebel groups. The program was a central feature of the Obama Administration's policy in Syria. -On July 20, 150 fighters from the Turkey-backed Euphrates Shield operation had crossed from Turkey through Bab alhawa to support Ahrar al-Sham in its fight against Hayat Tahrir al-Sham (HTS), dominated by the Fateh al-Sham faction formerly known as Jabhat al-Nusra, in Idlib. -On July 21, the SG submitted to the Security Council the forty first report on the humanitarian situation in Syria for the period from 1 to 30 June 2017, highlighting the approximately 20,000 people displaced across northeast Syria in June due to the Raqqa offensive. According to the report, the Syrian government removed medical supplies sufficient for more than 84,000 treatments. -Hezbollah and the Syrian Army launched a joint offensive against militant groups in the town of Arsal and the western Qalamoun mountain range along the Lebanon-Syrian border, an area purported to hold over 3,000 militants, including al-Qaeda-linked insurgents and members of ISIS. -On July 24, 14 heads of mission in Geneva signed a letter addressed to Security Council President, Chinese Ambassador Liu Jieyi, raising "serious concerns" about the implementation of seven Security Council resolutions on humanitarian access and urging Liu to raise the issue at the upcoming Council meeting. The signatories include the United States, Saudi Arabia, Britain, France Turkey, Qatar, Japan, Australia, the European Union, Germany, Spain, the Netherlands, Canada and Italy. -General Sergei Rudskoi, chief of the Russian General Staff, announced the deployment of Russian military police to monitor compliance after a ceasefire, mediated by the Egyptian government, was declared in the Eastern Ghouta area of Damascus on July 22. Despite the reported ceasefire, part of the four proposed "de-escalation zones" outlined in the Astana memorandum, Syrian government forces continued to attack several towns in Eastern Ghouta. -On July 26, fighting on the Syrian-Lebanese border near the town of Arsal halted after a ceasefire agreement was reached between Hezbollah and HTS. The cessation of hostilities ended a six-day campaign to drive al-Qaeda-linked militants from the border region, which is also home to tens of thousands of refugees. The agreement included the evacuation of some 1000 HTS fighters, along with more than 6000 Syrians (in nearby refugee camps) from the Lebanese border town of Arsal to rebel-controlled Idlib province, as well as exchange of prisoners between Hezboallah, HTS and the Lebanese Armed Forces, which later took place on August 1. -On July 27, Ursula Mueller, Assistant Secretary-General for Humanitarian Affairs and Deputy Emergency Relief Coordinator in the Office for the Coordination of Humanitarian Affairs, briefed Council members on the humanitarian situation in Syria, noting that despite reduced violence, there had not been a noticeable increase in areas reached for aid delivery. -The Syrian Ministry of Foreign Affairs and Expatriates addressed two letters to the UNSG and the Security Council calling for immediate action in the militant-besieged towns of Kefraya and al-Foua. -The US-led coalition fighting ISIS told its local Syrian allies that they must exclusively fight ISIS, a directive that prompted Shohada al-Quartyan to depart a joint coalition base in Southern Syria to carry out independent operations against Syrian regime forces. -On July 28, the OPCW released its monthly report, noting that the security situation now allows safe access to confirm the condition of the final two above-ground facilities with planning underway to verify their destruction. -On July 30, for the first time in five years, UN aid was delivered to almost 7,2000 people in besieged al-Nashabiye located in Eastern Ghouta, a rebel-held area on the outskirts of Damascus. August 2017: -On August 2, the evacuation of at least 7,000 people, including al-Qaeda-linked fighters and refugees, from Lebanese border enclave of Arsal for rebel-controlled Idlib province commenced. The transfer agreement, the largest formal repatriation of refugees to Syria since 2011, was carried out without the involvement of aid groups generating concern about the welfare of the refugees. -On August 3, the Russian Ministry of Defense announced a ceasefire in northern Homs and southern Hama, in what is being billed as the third of four planned ceasefires agreed to under the Astana memorandum. Russia deployed police military to several checkpoints in northern Homs, later on August 4. Opposition groups called for a guarantor role for Turkey. According to SOHR, the ceasefire, which covered territory populated by more than 147,000 people, held for the first 10 hours before experiencing repeated violations by pro-government and rebel forces. -The Independent International Commission of Inquiry on Syria of the Human Rights Council (CoI) called on the international community to recognize the crime of genocide being committed against the Yazidis in Iraq. -On August 8, experts from the guarantor states met in Tehran to discuss ways to strengthen the de-escalation zones and determine the agenda for the upcoming sixth round of Astana talks. -On August 8-11, twenty-four FSA-affiliated groups formed new group "Liwa Tahrir Deir ez- Zour" to liberate the province of Deir ez-Zour from IS; the new faction welcomed any cooperation with local and international parties, ruling out the SDF. -On August 9, OCHA expressed concern about the safety and protection of an estimated 10,000- 25,000 people trapped inside Raqqa without access to safe drinking water for 48 days. Due to the fighting on the ground, the UN has currently no access to Raqqa city. - Russian Permanent Representative to the UN Vasily Nebenzya briefed the Security Council on the progress of establishing de-escalated zones in Syria, behind closed doors, and called on the UN to facilitate the delivery of humanitarian assistance in those areas. -On August 10, SDF US-backed forces encircled ISIS militants in central Raqqa, effectively cutting off ISIS' last remaining route to the Euphrates. -On August 12, the Syrian government captured al-Sukhna, the final ISIS stronghold in Homs governorate, as part of its multi-pronged campaign to take eastern Syria. The recent gains position the pro-government coalition 50 km (30 miles) away from Deir ez-Zour province, the last major ISIS foothold in Syria. -On August 14, approximately 300 FSA-affiliated Saraya Ahl al-Sham fighters and 3,000 refugees began evacuating the Lebanese border town of Arsal as part of a repatriation agreement brokered in early August between Lebanese and Syrian officials. Lebanon's Maj. Gen. Abbas Ibrahim, who is overseeing the transfer, said that civilians will head to the government held area of Assal al-Ward. The rebel fighters and their families are destined for the rebel-held town of al- Ruhaiba in the Eastern Qalamoun region where, according to Hezbollah's Al-Manar TV, they have been granted amnesty by the Syrian government. Their departure leaves the Islamic State as the last militant force straddling the border near Arsal. -Nearly 50,000 people remain stranded on the Jordanian border, in an area known as the berm, and are facing an increasing scarcity of food, healthcare and other basic services. The UN stressed that it will continue to support Jordanian authorities in the protection of affected Syrians. -On August 17, the UNSC adopted a presidential statement, read by Council President for August and Ambassador of Nigeria, Joy Ogwu, in support of a political transition process in Syria in accordance with the principles of the Geneva Communique. The adoption of the text signals, for the first time in two years, the consensus of the Council and its five permanent members on the need to establish a transitional government. -On August 17-20, Damascus hosted the 59th International Trade Fair, for the first time since 2011, and involved hundreds of delegations and private companies from at least forty-three states including Russia, Iran, China, and Egypt. -On August 20, President Assad announced in a speech before Syrian diplomats that Syria would not work with any Western nations until they ended their support for opposition and insurgent groups. -On August 21, UN experts launched an investigation into purported weapons deals between Syria and North Korea after two shipments to a Syrian government agency responsible for its chemical weapons program, the Syrian Scientific Studies and Research Center (SSRC), were intercepted. -Saudi-based High Negotiations Committee (HNC) met with delegations from the moderate Cairo and Moscow camps in Riyadh in an effort to establish a unified front for upcoming peace talks. Despite pressure from international allies calling for a more pragmatic approach, the HNC refused to accept a transition scenario in which Assad retained power. -On August 22, the next round of Astana talks was pushed back from late August to mid- September to allow the guarantor states to hold a technical meeting to set the meeting agenda. -On 23 August, a joint monitoring center was established in Amman for the southwestern de-escalation zone, which is located in the provinces of Daraa and Quneitra. The center is tasked with ensuring ceasefire compliance, ensuring humanitarian access and other forms of civilian assistance. -On August 24, the UN called for a humanitarian pause in US-led Coalition airstrikes on Raqqa to permit civilians to leave the city. This comes after the release of an Amnesty International report calling for greater protection efforts for the estimated 20,000 remaining civilians in Raqqa. -On August 25, the Russian army announced that it had dismantled the two remaining Syrian chemical weapons facilities targeted for destruction by OPCW. The OPCW has not confirmed the Russian report. -On August 28, hundreds of ISIS fighters and their families were evacuated from the Lebanese- Syrian border to militant-held eastern Syria following simultaneous Lebanese army and Hezbollah campaigns against ISIS positions. The transfer marks the first time ISIS agreed to a forced evacuation from territory it held in Syria. - The Secretary-General presented his monthly report on the situation in Syria, highlighting the recent efforts to reduce violence through de-escalation agreements and expressing hope that the Astana guarantors will reach an agreement on the finalization of operational and technical modalities for all de-escalation areas. -On August 30, Special Envoy Staffan de Mistura briefed the Security Council on the political path forward which includes a new round of Astana and Geneva talks. The SE highlighted the important role Syrian opposition allies stand to play in fostering cohesion and unity among the AOGs. - In his final address to the Council after two years as Under-Secretary-General for Humanitarian Affairs and Emergency Relief Coordinator, Stephen O'Brien appealed to members of the Council to take action to end the civil war in the name of common humanity, calling for a referral to the International Criminal Court. -On August 31, UN High Commissioner for Human Rights Zeid Ra'ad Al Hussein, stressed that the protection and assistance of citizens must take priority before defeating the Islamic State, citing reports of heavy civilian casualties in Raqqa as evidence of the threat the remaining 20,000 civilians face. -US airstrikes stalled a convoy of 300 ISIS fighters and their families in a government-controlled part of the Syrian desert in an effort to prevent their advancement into ISIS-held territory near the Iraqi border. The convoy was traveling from the Syrian-Lebanese border to Syria's eastern province as part of an evacuation deal brokered between ISIS, Hezbollah and the Syrian Army. -Pro-government forces captured strategic al-Bishri mountain overlooking ISIS-controlled Deir Ezzor province, bringing government coalition forces within close range of ISIS positions. September 2017: On September 1, French Foreign Minister Jean-Yves Le Drian rejected a role for Assad in a political transition in Syria. -The Syrian Islamic Council called for Syria's AOGs to end their fragmentation and unite as one armed body under the Ministry of Defense in the Syrian Interim Government. Ahrar al-Sham, Failaq al-Sham, Liwa Ansar al-Sunnah and Jabha al-Shamiya supported the initiative. -SDF spokesperson, Jihan Ahmad, announced that the SDF had gained control over an estimated 65 percent of Raqqa city after capturing the Old City, the Great Mosque and al-Dariya neighborhood. SOHR reported that the SDF were still fighting to gain control over pockets of the Old City but added that the US-backed opposition forces held more than 90 percent of the surrounding area. -On September 2, Russian Aerospace Forces reported they had destroyed a convoy of 12 ISIS trucks carrying ammunition and weapons in Deir Ezzor province. -It was made public that the British Ministry of Defense had quietly halted its FSA training program and called back its training forces from Syria in late June 2017. -On September 3, pro-government coalition forces gained control of the remaining ISIS stronghold in Hama Governorate after capturing the town of Uqayribat and its surrounding areas. -On September 4, Syrian Interim Government Prime Minister Jawad Abu Hatab was appointed interim Defense Minister as part of a unification initiative launched by the Syrian Islamic Council in early September. Free Syrian Army factions formed a committee to select a Chief of Staff in consultation with the Prime Minister. -On September 5, the Secretary-General submitted the OPCW's forty seventh monthly report on the progress to eliminate chemical weapons in Syria to the Security Council. The report highlighted the preparations underway to confirm the status of the two remaining stationary above-ground facilities now that the security situation allows safe access and the upcoming high- level consultations with Syrian Deputy Foreign Minister, Dr. Faisal Mekdad, to clarify outstanding issues regarding the Syrian government's initial declaration. -Pro-government coalition forces reached the western perimeter of Deir Ezzor city, breaking a three-year ISIS siege of the government-held areas that had impacted 93,500 people. In support of the offensive, a Russian warship located in the Mediterranean Sea launched cruise missiles at ISIS positions near Deir Ezzor. -On September 6, SE Mistura said he expects a national ceasefire to follow shortly after ISIS has been pushed from its strongholds in Raqqa and Deir Ezzor. Although he stressed that the government "cannot announce victory", he called on opposition forces to accept defeat and focus on winning the peace through negotiations in October. -The UN Commission of Inquiry on Syria released a report on the major human rights and humanitarian law violations committed between March and July 2017. The Commission accused the Syrian government of using sarin gas in the April 4 Khan Sheikhoun attack and found US forces culpable of not taking "all feasible precautions" to protect civilians in the March 16 attack on al-Jinah Mosque. -According to Russian Foreign Minister, Sergey Lavrov, experts from Russia, Iran and Turkey made progress towards an agreement "on the parameters, configuration and methods of ensuring security in the de-escalation zone in the Idlib province" in Syria. -On September 7, Israel conducted airstrikes on the Scientific Studies and Research Center, a facility believed to house a chemical weapons manufacturing center, and a military base storing surface-to-surface missiles near government-stronghold Masyaf in Hama province. The Syrian Foreign Ministry called on the Security Council to denounce the airstrikes. -US-led coalition forces fighting ISIS announced that airstrikes had killed two ISIS leaders near Mayadin in the Deir Ezzor province on September 4, 2017. -The Head of the High Negotiations Committee, Riyad Hijab, rejected the SE Mistura's call for the opposition to accept defeat, declaring the UN mediation process a failure and calling on Syrians to demonstrate in support of the continuation of the revolution. On September 8, a convoy of 42 trucks carrying humanitarian aid for 80,000 people reached Deir Ezzor for the first time by land in three years. -US-led coalition surveillance aircraft departed its position monitoring an 11-bus convoy of ISIS fighters and their families after attempting to prevent its advance into ISIS-held territory in Deir Ezzor since August 29. The surveillance aircraft departed the airspace at the request of Russian military officials who were conducting an operation with pro-government forces close to the convoy's position. -The Syrian National Coalition (NCSRF) condemned calls from "regional and external parties" for Western-backed opposition groups Ahmed Al-Abdu and Ussoud Al-Sharqiya to cease fighting government forces in southeastern Syria and withdraw to Jordan. Both groups refused the request. -On September 9, pro-government forces broke a years-long siege of Deir Ezzor airbase and captured the Damascus-Deir Ezzor highway from ISIS. -SDF launched Operation Jazeera Storm to liberate Deir Ezzor province from ISIS. -On September 10, SDF reached the industrial zone to the east of Deir Ezzor city putting the US-backed coalition within 15 km (10 miles) of pro-government forces positioned to the west of the Euphrates river. -On September 11, the Jordanian Foreign Minister, Ayman Safadi, and Russian Foreign Minister, Sergey Lavrov, declared the ceasefire brokered by Jordan, Russia and the United States in the southern Syrian provinces of Daraa, Quneitra and Suweida on July 9 a success and reiterated their commitment to the establishment a de-escalation zone in the area as a step towards achieving a comprehensive cessation of hostilities and a political solution to the crisis. On September 12, pro-government coalition forces continued their push into ISIS-held territory in Deir Ezzor city. Russia and Syria warplanes conduct heavy bombardment in support, killing an estimated 69 people over the course of 72 hours. -Hezbollah leader, Sayyed Hassan Nasrallah, declared the war in Syria over, referring to the remaining fighting as "scattered battles". -ISIS defectors have massed in Syria's Idlib province with many planning to cross into Turkey before continuing to other parts of the Middle East, North Africa and Europe. -Iran and Syria sign a memorandum of understanding on cooperation in Syria's electricity sector. The arrangement, part of a series of bilateral deals formalizing Iran's role in Syria's reconstruction process, provides for the establishment of a new power generation station in Latakia and the rehabilitation of gas units and power generating plants in Damascus, Aleppo, Deir Ezzo and Homs. -On September 13, the remaining buses of the convoy of ISIS fighters and their families stranded for over two weeks in the Syrian desert reportedly reached Mayadin, in militant-held Deir Ezzor province, following the withdrawal of US surveillance aircraft on September 8 in respect of de-confliction arrangements with Russia. -The Russian Defense Ministry claimed that pro-government coalition forces controlled 85 percent of Syrian territory. SOHR disputed the claim, saying government forces held 48 percent of Syria. -Experts from Russia, Iran and Turkey met ahead of the sixth round of talks in Astana, Kazakhstan to "lay the groundwork" for negotiations on the establishment of de-escalation zone in Idlib province. -On September 14, Col. Ryan Dillon, spokesperson for the US-led coalition fighting ISIS, said SDF forces will not enter Deir Ezzor city, and will instead focus operations on areas south of the city along the Euphrates river. He also said US-backed SDF was in control of 63 percent of Raqqa city. -On September 15, Ahmad Abu Khawla, commander of the SDF-affiliated Deir Ezzor Military Council, declared that it will not allow government forces to cross to the eastern banks of the Euphrates river. -Representatives from Russia, Iran and Turkey reached an agreement on the delineation and monitoring mechanism for the implementation of a de-escalation zone in Idlib province and agreed to position observers in "safe zones". Russia circulated a draft resolution among the permanent members of the Council to welcome the outcome of the Astana talks. -On September 16, the SDF and US Coalition officials accused pro-government forces of attacking one of their positions in the industrial zone east of Deir Ezzor city, injuring 6 SDF fighters. According to US Coalition sources, Russia conducted the airstrike after the United States had denied its request to target the area. Russian Defense Ministry spokesperson Maj. Gen. Igor Konashenkov rejected the allegations, saying warplanes carried out "pinpoint strikes only on Islamic State targets that have been observed and confirmed through several channels." -High-level consultations commenced between the Syrian government and the OPCW aimed at clarifying all outstanding issues regarding Syria's initial declaration of its chemical weapons facilities. -On September 17, a convoy of 80 Turkish military vehicles deployed to Turkey's southern border, close to the Bab Al-Hawa and Rihaniyah crossings with Syria's Idlib Governorate, ahead of the implementation of a de-escalation zone agreement brokered at the recent Astana talks. -On September 18, pro-government coalition forces crossed to the eastern bank of the Euphrates river to within five kilometers of SDF positions. In the first sign of direct contact between the SDF and the pro-government forces, US-led coalition spokesperson Col. Ryan Dillon said "open lines" of communication were being maintained to prevent clashes between the two forces as they converge on ISIS positions. -After capturing the Deir Ezzor Military Airporst from ISIS fighters, pro-government forces began operating combat and supply missions from the airport. -The World Food Programme (WFP) reached formerly besieged parts of Deir Ezzor city by land for the first time since May 2014. WFP has discontinued its high-altitude airdrop operations in favor of road deliveries which will allow for more affordable, sustainable humanitarian access. -In a meeting on the sidelines of the UN General Assembly, Members of the "Friends of Syria" Group agreed they will not support reconstruction in Syria until there is a political transition "away from Assad." -During its 36th session, the Human Rights Council held an interactive dialogue with the Independent International Commission of Inquiry on Syria to discuss the continued targeting of civilians and the use of chemical weapons in the conflict, appealing to all parties to redouble their efforts to protect civilians and preserve civilian infrastructure. -On September 19, AOGs led by Hayat Tahrir Al-Sham (HTS), the Turkistan Islamic Party and Free Syrian Army affiliates launched an offensive against pro-government forces in northern Hama province in an effort to dismantle the de-escalation zone agreement on Idlib province brokered at the recent Astana talks. The offensive sparked intense Russian and Syrian bombardment of opposition-held territory in Hama and Idlib Governorates. Syrian government forces claimed the airstrikes targeted "terrorist supply lines" but SOHR alleged the strikes hit hospitals and towns, killing civilians. -The Syrian government asserted it will not accept Turkish forces on Syrian soil, effectively contradicting

Issue 9.2 of the Review for Religious, 1950. ; MARGH° 15, 1950 Diocesan or PonHfical ? 'Joseph F. Galle. 'Virtue of Faith . John M~hews Oh'Controversy . ~. Gera[~Kelly Works:of God Manifest . .Dominic Hughes (;)uesHons and Answers Book Reviews Communications Report to Rome VOLUME IX NUMBER 2 Ri::VII::W FOR RI:::LI IOUS VOLUME IX MARCH, 1950 NUMBER 2 CONTENTS DIOCESAN OR PONTIFICAL ?--Joseph F. Gallen, S.J . 57 THE VIRTUE OF FAITH IN THE SPIRITUAL LIFE-- John Matthews, S.J . 69 OUR CONTRIBUTORS . 72 ON CONTROVERSY~ (An Editorial)--Gerald Kelly, S.J . 73 SEARCHLIGHTING ~URSELVES . 77 WORKS OF GOD MADE MANIFEST--Dominic Hughes, O.P. . 78 FATHER ELLARD'S REPLY . 91 COMMUNICATIONS . 95 SUMMER SESSION . 96 BOOK REVIEWS-- The Mother of the Savior and Our Interior Life; Ignatlan Methods of Prayer; Little Catechism of Prayer . ~ . 97 BOOK NOTICES . " . 100 BOOK ANNOUNCEMENTS . 101 QUESTIONS AND ANSWERS-- 7. Abandoned Wife Entering Religion . 104 8. Extending Postulancy, Novitiate, etc . 105 9. Postulancy outside Novitiate . 106 I0. Dowry When Transferring to Contemplative Order . 106 11. Sick Religious and Daily Communion . 107 12. Genuflections in,Chapel . 108 REPORT TO ROME . 108 THOUGHTS ON ST. JOSEPH . 112 IN MEMORIAM (Alf'red F. Schneider, S.J.) . 1 12 REVIEW FOR RELIGIOUS, March, 1950. Vol. IX, No. 2. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine Ellard, S.J., Gerald Kelly. 8.J. Copyright, 1950, by Adam C. Ellis. Permission is hereby granted for quotations of reasonable length, provided due credit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S. A. Before wrltln9 to us, please cons,,It notice on Inside back cover. Diocesan or Pont:ific l? ¯Joseph F. Gallen, S.J. THE following pages constitute ~in effqrt to answer two practical canonical' questions: (1) should a diocesan congregation "Con-fine' itself to the diocese of origin? (2) should a' diocesa'n congregation become pontifical? These are very. important questions for many institutes. They are also questions to which angwers can. be given that are based solely on personal knowledge and espe'ciallT on personal preference. Such knowledge can be inadequate and the preference can be very subjective. Therefore, I l~ave tried to avoid mere.personal opinion and to base the answers primarily on the mind and 'v~ill of the Holy See and secondarily on the opinions that com-monly exist in the Church as found in approved authors. ~" I. DiSti~'~tion of Defi'nition between a Pontifical and a "" Diocesan Congregatiqn~ . . :,~., It is by no means unusual to encounter the mistaken opiniqfi.th, a~ a, diocesan religious institute is one that. is confined to a particul.ar. diocese and a pontifical institute one that has houses in seve.ral di0,- ceses. These false definitions are deafly excluded by canon 488, 3°: "'institute app~ou.ed bg the Hqlg See. (Religio iuris pontifical), ~every institute which has obtained from. the Apostolic S~e either ~p~r.o.-'.~ ba~ion'~o~'i.a.t, leas.t.the decree of commendation (decretur~,'l~udis)t;i Diocesan Institute, an institute erected by Ordinaries, which ~has ~not y~.t:.o."bthined this" decre~ ofcommendation.". Thu's the diStinCtiOn between a pontifical and a diocesan congregation has in itself nothing Whatever to do with territorial diffusion; it is based sblely on the p~es.ende or'absbnce of approval by the Holy See. We shall see tha~ a diocesan institute is also destined to spread to many dioceses, and d~ffu~ion~ to'. rrian~r diocese~ is only an ordinary, not ari absolfitel prerequisite for obtaifiing papal opproyal. In actual fact there are diocesan;. congregati6ns in the United 'States that haCce spread to several dioceses., It is equally true that some pontifical congregation~ in~thi~ c6dh~ry are confined to one diocese. ~All religious orders are pontifical institutes, since the approbation of 'an order is reserved to the Ho!y See. Ther?fore, institutes such as those of the Carmelite Nuns, Dominican Nuns, Poor Clares, Sacra-mentirie'Nuns, and Visithndines are pontifical. A religi0ds order is 57 JOSEPH F. GA'LLEN Review for Religious ¯ an institute whose particular law pr~scribes that at least some of the subjects at least should take solemn vows (can. 488, 2°). The hope of clarifying this o'ften misunderstood definitio'n is the justificat.for the tautology. It is not required that all of the members of the institute, but it is s~f~cient that only some of these, should either actually take solemn vows or be obliged to do so by the law of the institute. An institute can also be an order even if none of the mem-bers actually take solemn vows. It is sufficient that some should do so from the particular law of the institute.1 Solemn vows are not taken in mo~t of the monasteries of nuns in the United States, yet all of these institutes are orders since at least some of the members should take solemn vows in virtue of the particular law of the institute.2 A religious congregation is an institute in which all the members actually take simple vows, whether perpetual or temporary, and in which none of the members should take solemn vows in virtue of the law of the institute (canon 488, 2°). No religious institute can exist in the Church that has not been approved by legitimate ecclesi-astical authority. The foundation of a religious institute may certai.nly be approved by the Roman Pontiff, but in practice it is approved by the ordinary of the diocese of foundation. This approval of the local ordinary makes the congregation a diocesan institute. ~For example, article 37 of the Constitutions of the Ursuline Nuns of the Congre-gation of Paris, Pittsburgh, Pennsylvania. reads as follows: "By tight, these vows are solemn vows, as they were so approved by holy Church at the beginning: but, in fact, in this country, by disposition of the Holy See, they are only simple vows." Article 641 of the Constitutions of Dominican Nuns reads: "Those Nuns of our Order whose vows are, by constitution, solemn but who because of circumstances of time (cgn. 488, 70), by prescription of the Apostolic See, make only. simple VOWS . " -°In 1864 the Holy See declared the following monasteries of Visitation Nuns in the United States had solemn vows: Washington, (Georgetown), Baltimore (Roland Park), Mobile, St. Louis, and Kaskaskia. The last-mentioned later united with its daughter community in St. Louis. Mo. Since 1864 the monasteries that follow have received a rescript from the Holy See granting solemn vows. The year of the rescript is put in parentheses. Carmelite Nuns of the Ancient Observance: Allentown (1931): Discalced Carmelite Nuns: Philadelphia (1902, but solemn vows were first taken in 1925), Wheeling (1925), Bettendorf (1949), Louisville (1930), Morristown (1926), Loretto (1932), Rochester (1930), Mobile (1943), New Brunswick (1948): Dominican Nuns: Detroit (1929, Menlo Park (1929), West Springfield, Mass, (1928): Dominican Nuns of the Perpetual Rosary: Buffalo (1944), Camden (1947), Syracuse (1947): Poor Clare Nuns: Cleveland (1946); Franciscan Nuns of the Most Blessed Sacrament: Cleveland (1912), Canton (1925, but solemn vows were first taken in 1950): Nuns of Perpetual Adoration of the Blessed Sacrament (Spanish speaking) : E1 Paso (1930) : Visita-tion Nuns: Elfindale, Springfield, Mo. (1888). Solemn vows are taken in the Oriental Order of St. Basil the Great. Four other monasteries have applied for solemn vows¯ 58 March, 1950 DIOCESAN OR DONTIFICAL? After an initial period of growth the congregation usually peti-tidns the Holy See for papal approval. The attainment of papal approval makes the congregation a pontifical institute. It is sufficient that the Holy See approve either the institute or the constitutions. The present ordinary practice of the Holy See is to approve both. In answer to the first petition of the congregation for papal approval, the Holy See gives its first approval to the" institute by what is called a decree of praise or commendation. At the same time the Holy See gives a temporary and experimental approval to the.constitutions for a determined period of time, which now is usually seven years. At the end of this time the congregation sends another petition to Rome. The Holy See then gives a final approbation to the constitutions and, frequently at least, a definitive approbation to the institute.3 The practice of the Holy See can vary in many matters, and it has varied in the present case of the approval of religious congrega-tions. It is possible to find congregations that have long possessed papal approval and yet discern that the constitutions alone were approved by the Holy See. A doubt could and did arise as to the sufficiency of an approval of the constitutions alone, since the Code definition of a pontifical institute appears to be confined to a decree of~ praise or approbation of the institute. However, the presumption always is that a canon agrees with the pre-'Code law, and Leo XIII had originally defined pontifical institutes as those "in which in addi-tion the sentence of the Roman Pontiff has intervened, either by approval of their laws and statutes or also by the granting of praise or approbation.TM In this definition the approval of the constitu-tions is not only sufficient but apparently primary. All doubt was removed by a reply of the Sacred Congregation of Religious that the Sisters of Mercy, founded by Mother McAuley, were pontifical, whether it was a question of the independent communities or of the unions that had been established with the approval of the Holy See.5 3For the present practice of the Holy See, cf. P. Cosmas Sartori, O.F.M., duris-prudentiae Ecclesiasticae Elernenta (Romae: Pontif. Athenaeum Antonianum, 1946)~ p. 74. 4Leo XIII, Const. "'Conditae a Christo,'" 8 dec. 1900, Codicis luris Canonici Fontes III. p. 562. The same definition is repeated twice in the constitution. Cf., pp. 563, 564. nThis particular reply of Nov. 24, 1925, undoubtedly because of its general import, was published in the Acta Apostolicae Sedis, XVIII (1926), 14. It can be found in English in Bouscaren, Canon Law Digest, I, pp. 269-270. Valuable commen-taries on the reply have been written by. Maroto, Cornrnentariurn Pro Religiosis, VII (1926), 83-92: and Vermeersch, Periodica, XV (1927), 52-53. To any-one unaware of this reply the distinctive constitutions of the independent com-munities can' cause difficulty as to their pontifical character. 59 .JOSEPH F. GALLEN Review foF Religious The constitutions alone of the Sisters of Mercy were approved by the Holy See in 1841. The same thing is apt to be true of any.congrer gation of religious women approved before 1850, because of the varying practice of the Holy See in approving religious congregations. Therefore, a congregation is made pontifical by any one or m6re of the following.four approvals: approval of the institute by either a decree of praise or of definitive approbation; approval of the con-stitutions either experimentally or finally. To all congregations that have received any one of these approvals are equally applied" the rights, laws, and obligations of pontifical institutes. II. Should a Diocesan Congregation Confine Itself to the Diocese of Origin? 1. The Code of Cation Lau;.--Canon 495, § 1 reads: "A dioce-san religious congregation cannot establish houses in another diocese without the consent of both Ordinaries, namely: the Ordinary of the place where the motherhouse is situated and the Ordinary of' the place where it is desired to make the new foundation, but the Ordi- .nary of the place of delSarture, shall not without a grave reason refuse his, consent." For the first house to be erected by a dlocesan.institt~te in anothe~ diocese, this canon requires the permission not only of the ordinary of~the new house but also of the ordinary of the mother-house. We can s.ee in this law of the Code an implicit affirmation of the closer guardianship, of the greater interest, supervision, and direc-tion that the ordinary of the diocese of origin is to exercise over a diocesan congregation in the early years of its existence. The same canon explicitly forbids the ordinary of the mother? house to refuse permission for the erection of a house in another diocese unless he has not merely a. reasonable or a just reason but a serious reason for the refusal. The .Code of Canon Law, therefore, implicitly states that it is the or~linary thing for a diocesan institute to spr,ead to other dioceses and that this diffusion can be prevented only by reason of a serious obstacle. It cannot be held that thi~ seri-ous obstacle is ordinarily tO be fouiad in diocesan institutes.' If this-were factually tr.ue, there would be little sense in the law of the Code that forbids the ordinary'of the motherhouse to refuse the permissi?n, and the law would rather read: "and the Ordinary of the mother~ house may grant this permission in extraordinary cases.',Y Therefore, the" law 'of the Code is that confinement to one" dioces~ sli'~.uld ble restricted to the early years of the existence-of.a, diocesan dongrega:- fi0n wl~en the institute is a.c.qujri, ng strength rand:.sta,,~:ilit.~.: .~T.h.!.s. 60 March, 1950" DIOCESAN OR PONTIFICAL? period should not be excessively prolonged. Diffusion to other dioceses is a usual prerequisite for obtaining papal approval, but the Holy See stated before the Code of Canon Law that ten or fifteen years from the time of the foun'dation of the first house of theinsti-tute could suffice for the presentation of a petition for papal approval.6 2. Documents of the Holy See.--The Holy See both before and after the Code of Canon Law has issued norms that are to guide the local ordinaries in the erection of new institutes. One of the most important of these norms is that the ordinary, rather than found a n~w congregation, is to invite and admit into his diocese a congrega-tion already approved that has the purpose desired by the ordinary. In speaking of these congregations already approved the Holy See makes no distinction between pontifical and diocesan congregations.) Therefore, the Holy See again positively implies that diocesan insti-tutes are not to be confined to the diocese of origin. 3. Doctrine of authors.--Two authors, Fogliassos and Muzza-relli, 9 have recently made detailed studies into the juridical nature of diocesan congregations. Fogliasso states: "Certainly a diocesan con-gregation, even though it consists of only one house, unlike a mon-astery of nuns, is an organism that bg its verst nature tends to uni-versality . The purpose of the disposition of canon 495, § 1 is to prevent the local ordinary of the motherhouse from impeding the ordered diffusion of a new congregation. This diffusion together with spiritual fruits is required for the granting of a decree of praise. Furthermore, recourse can always be made to the Holy See against the arbitrary opposition of this ordinary. Therefore, the norm of canon 495, § I, while it immediately, furthers the fundamental liberty of a new congregation, which is the attainment of its own increase, paves the way for the congregation to reach the prescribed condition by which, through means of a decree of praise, it may take its place 6Normae Secundum Quas 8. Congr. Episcoporum et Regulariura Procedere Sofet in Approbandis Novis lnstitutis Votorurn Simpliciurn, 28 iun. 1901, n. 9. ~Leo XII][, Const. "'Conditae a Christo,'" § 1, III, C. I. C. Fontes, III, p. 563; Pius X, Motu Propr. "Dei providentis,'" 15 iul. 1906, C. I. C. Fontes, III, p. 675; S. C. de Prop. Fide, Instr., "'De Congregationibus Religiosis lndigenis Condendis,'° 19 mart. 1937, n. 1, AAS XXIX (1937), 276. SAemilius Fogliasso, S.D.B., lntroductio in Vigentem Disciplinara de luridicis Re-lationibus inter Religiones et Ordinarium Loci (Augustae Taur[norum: Schola T}'pographica Salesiana, 1948). 9Fridericus MuzzareIli, S.S.P., Tractatus Canonicus de Congregationibus luris Di-oecesani (Romae: apud Piam Societatem a S. Pau[o Aposto[o, 1943). 61 JOSEPH F. GALLEN Review for Religious among pontifical institutes.''~° Muzzarelli expresses the same doctrine: "The nature of a diocesan congregation precisely as diocesan is universal only in potency and capacity . . . indeed the mind of "the Holy See with regard to these congregations is not that from their foundation they should be aSso-lutely confined within the boundaries of one diocese. They are rather considered as the first stage, the first phase of juridical et~olution. When this evolution is completed they become pontifical and uni-versal in fact and in law . Hence it generally happens that these congregations become multidiocesan in a short time and l~hus are uni-versal in fact . If the ordinary (of the motherhouse) should refuse his consent, recourse is always open to the Holy See.''11 Father Vidal, S.J., whose eminence as a canonist and years of service as a consultor of various Roman Congregations should qualify him to know the mind and prac.tice of the Holy See, affirms: ". the ordinary of the place of dephrture is forbidden to refuse his " consent except for a serious reason (canon 495, § 1) ; and recourse against an unreasonable refusal would always be open to the Sacred Congregation, which will usually lend a ready ear to such a recourse, unless there is question of an institute that is faring badly and is destined rather for extinction.''x~ The doctrine that a diocesan institute should at least ordinarily spread to other dioceses is held implicitly by many of the authors mentioned below, who teach that diocesan congregations should ¯ become pontifical, since diffusion to other dioceses is in the practice of the Holy See an ordinary prerequisite for obtaining papal approval. 4. Diffusion does not imply separation.--Diffusion to other dioceses is the second phase of the natural growth of a diocesan con-gregation to the juridical maturity of a pontifical congregation. Evidently diffusion does not impiy but excludes separation from the houses of the diocese of origin. Canon 495, § 1 is speaking of the spread of the same institute to other dioceses, not of the erection of. new institutes in other dioceses. The fear of separation, however, can exist. The diffusion of diocesan and even of pontifical congrega-tions to other dioceses of the United States in the last century very frequently was followed by a separation from the houses of the diocese of origin (and the same thing occurred in other countries). ~-0Fogliasso, op. cir., 160-161. The italics in this and subsequent citations are mine. XlMuzzarelli, op. cir., nn. 51, 123. xZWernz-Vidal, Ius Canonicum, III, "De Religiosis,'" n. 61. 62 March, 1950 DIOCESAN OR PONTIFICAL Fortunately, many of these separated congregations have ultimately at least prospered in vocations and in the extent and excellence of their lives and work. These happy consequences have not always been verified. Some of these congregations are still small in number of subjects, and they toil in vain for increase in the rocky territories of few Catholics and few vocations. It would obviously .have been much better if they had remained.united to houses located in dioceses that are more fertile in vocations and also financially. Furthermore, such separations were not of their nature conducive to a progressive improvement in the spiritual and intellectual formation of subjects. These separations may not be effected now without the permission of the Holy See, since the separation would involve at least the erec-tion of a new institute and also the passing of professed religious from one institute to another, both of which require recourse to the Holy See (canons 492, § 1; 632). III. Should a Diocesan Congregation become Pontifical? 1. The Code of Canon Latv.--To Father Arcadio Larra-ona, C.M.F., the present undersecretary of the Sacred Congregation of Religious, we are especially indebted for evolving the answer from the Code of Canon Law. Father Larraona calls attention to the definition in the Code of a diocesan congregation, which is not described as one that has been approved by a local ordinary or as one that does not possess or has not obtained a decree of commendation but as one, "that has not yet (nondum) obtained this decree of com-mendation (canon 488, 3°).'' Thus the very definition of a dioce-san congregation in the Code of Canon Law manifests that it is only in an initial and transitory state and in the first phase of a juridical evolution that is to terminate in the attainment of pontifical approval,la Larraona could have derived the same conclusion from canon 492, § 2. The argument is clearer in the translation of Woywood- Smith, although it can also be d~duced from the Vatican translation. This canon reads: "A diocesan congregation retains that character though it has in the course of time spread to several dioceses, and it remains completely under the jurisdiction of the bishops, until it has obtained from the Holy See approval or, at least, the decree of praise." The Vatican translation of this last and pertinent clause is: "as long as it is without pontifical approval or the decree of commendation." The Code here again does not consider a diocesan congregation to be laLarraona, Cornmentarium Pro Religiosis, II (192 I), 284. 63 JOSEPH F. GALLEN Review for Religious . in a definitive but only in an initial and temporary state. 2. The initiative of bishops.--The most°manifest testimony of the i.nspiration, encouragement, and support of bishops to diocesan congregations becoming pontifical is the vast number of congr.egations that ha~e been approved by the Holy See. This support of bishops wa~ evident at an early date in the era of pontifical approval of congregations of Sisters. The Provinci.al Council of Avignon, held in 1849, enacted the following norm for the bishops of the province: "That [Sisters] may conform their lives to that prescribed by the rule they have professed and observe their constitutions and praiseworthy customs, that the constitutions also may have a greater authority, the bishops are to take care as' soon as possible that these be approved by the Holy See,. if they have not already been approved.''14 The bishops of the Plenary Council of Latin America, celebrated in 1899, established a similar law: "Since in congregations that have spread into several dioceses and whose constitutions have not as yet been submitted to the examination, correction, and approbation of the Holy See, here and there things have been done in good faith that are contrary to the laws and mind of the Hoist See, we decree that, the prescriptions of law being observed, such congregations which, in the judgment of the bishops, increase and give good expectations to the Church shall submit their statutes to the judgment of and petition the approval of the Holy See.''1~ 3. The doctrine of authors. Especially in this important ques-tion authors are cited primarily to manifest the mind and the will of the Holy See and also to give the answer that is generally held in the Church. Greater attention should clearly be given to the canonists who are acknowledged specialists in the field of canon law for religious. LARRAONA: This author has been engaged since 1920 in writing an exhaustive explanation of the canons on religious in the Cormnentariurn Pro Religiosis. The greatest tribute to his authority is the frequency and respect with which he is generally cited by other authors. Writing of pontifical and diocesan congregations before the Code of Canon Law, he states that diocesan congregations were not considered "as something fixed and stable but as incomplete entities, tending by their nature to juridical perfection, which in the second 14Concilium Provinciae Avenionensis, Collectio Lacensi#, tom. IV, col. 351, n. 2. l~Acta et Decreta Con¢ilii Plenarii Americae Latinae (Roinae: Typis Vaticanis, 1902), n. 324. 64 March, 1950 DIOCESAN OR PONTIFICAL? category, that is, in pontifical congregations, alone appeared to be found.''10 This same doctrine, although not with the same urgency, he later applies to diocesan congregations after the Code of Canon Law.17 He likewise affirms: ".-. the constitution of a di6cesan congregation is not very conducive to the internal unity, strength and liberty of diffusion of the institute. The result is that diocesan con-gregations have scarcely begun to evolve and to be diffused when they are borne along almost by their own weight to become pontifical, which corresponds completely to the mind of the Holy See.''~s He styles the diocesan state of a congregation as the novitiate of the insti-tute and says of this novitiate: ". the Sacred Congregation has tended and now tends to surround this [diocesan state] with suffi-cient protection and to affirm it as transitory by representing this state to the eyes of both the bishops and the congregation as a period of probation, which should not be prolonged longer than is necessary to test the spirit and stability of the.congregation and for it to obtain some diffusion. When this test has been surpassed, it is undoubtedly the mind of the Hol~l See that a decree of commendation should be requested.''1° He continues: "Unless congregations become pontifical when they reach the above maturity, experience certainly proves that they can scarcely preserve their unity of spirit, of ministries, and of government. Consequently the.i.r internal force and solidity is almost necessarily exposed to positive dangers, or at least the congre-gation is uselessly hindered and its tendency for diffusion and expan-sion impeded.''u° In another work he reaffirms the same principle: "From the nature of the case a unity of government is scarcely pos-sible if the government itself is practically divided into as many parts as there are dioceses in which the institute has houses.''~ Other passages could be cited from this outstanding author to confirm the doctrine he states above that the diocesan state of a congregation is of its very nature transitory and the mind of the Holy See is that such congregations should seek papal approval after the initial period of probation and diffusion. 16Larraona, 17Larraona, lSLarraona, 10Larraona, 20Larraona, Commentariura Pro Religiosis, I (1920), 137. ibid., II (1921)', 284. ibid., II (1921), 284. ibid., V (1924), 146. ibid., V (1924), 146. ~aLarraona, Acta Congressus luridici Internationalis, IV, "'De Potestate Dorainativa Publica in lure Canon&o," p. 153, nota 17. JOSEPH F: GALLEN Reoieto [or Religious FOGLIASSO22 and. MUZZARELLIz~ accept and assert the doc-trine of Larraona, but the latter adds: ". especially when a con-gregation has spread to distant territories a practical necessity exists of asking for a decree of praise and approval of the con'stitutions from the Holy See, if one wishes to provide for the security, unity, and becoming expansion of the entire institute.''24 BASTIEN, who is a most eminent authority on the canon law for institutes of simple vows, states in the editions of his book pub-lished both before and after the Code of Canon Law: "The condi-tion of a diocesan congregation, as described in the preceding pages, is rather precarious; spread in different dioceses, they are dependent upon various bishops, without a sufficiently strong central authority. No wonder, then, that the. Holg See desires them to leave this initial stage, and exhorts them to present their constitutions [or its ap-proval."~ 5 BATTANDIER, who is of equal authority on institutes of simple vows, states in the same editions of his hook: "But the,dioce-san institute can naturally have the desire to attach itself more closely to the Apostolic See, which will give more authority to its govern-ment, more stability to its laws, and will permit it to be assured of the future.''~° Among the authors who have expressed their opinion less strongly are the following: CREUSEN-ELLIS: "When the new institute shall have devel-oped sufficiently and shall have shown by the test of time the value of its religious spirit and its unity, it may ask of the Holy See a posi-tive approbation.''27 "The Code does not provide for the erection of provinces in an institute which is purely diocesan. When it has arrived at this importance, it should ask for approbation from Rome, which will make its life and its government more autonomous.''2s 22Fogliasso, op. cir., 160-161. Z3Muzzarelli, op. cit., nn. 51, 102. ~4Muzzarelli, op. cir., n. 102. ~SDom Pierre Bastien, O.S.B., Directoire Canonique a l'usage des Congrdgations ~ Voeux Simples (lst edit., 1904, Abbaye de Maredsous), n. 22; (4th edit., 1933. Bruges: Ch. Beyaert), n. 70. The translation is that of D. I. Lanslots, O.S.B., Handbook of Canon Law (New York: Pustet, 1931), n. 19. Lanslot's d!gest is based on Bastien. ~OMgr. Albert Battandier, Guide Canonique Pour Les Constitutions des Instituts Voeux Simples (Paris: Librairie Victor Lecoffre), 4th edit., 1908, n. 19; 6th edit., 1923, n. 20. :tTCreusen-Ellis, Religious Men and Women in the Code (Milwaukee: The .Bruce Publishing Company, 3rd English edition, 1940), n. 27. ~SCreusen-Ellis. ibid., n. 30. 66 March, 19 5 0 DIOCESAN OR PONTIFICAL? BOUSCAREN-ELLIS: "'It is the mind ot: the Church that after a diocesan congregation has developed its membership and spread to other dioceses, and has given satisfaction in its pursuit of good works, it may apply to the Holy See for pontifical approbation and thus become a po.ntifical institute.''2~ REGATILLO: "Diocesan congregations are not accustomed to be divided into provinces because when they are sufficiently diffused they become pontifical.''~° RAMSTEIN: "Since every religion of diocesan law normally entertains the hope of acquiring in time the status of a religion of papal approval . JOMBART: "A congregation spread into several dioceses and flourishing generally desires to become pontifical.''z2 "A multidioce-san and large congregation desires almost always to become pon-tifical, the better to safeguard its unity.''3~ Doctorate dissertations in canon law of the Catholic University of America have expressed similar opinions: ORTH: "The great difference that exists between episcopal and papal approbation is well known and, since the papal dxcels the epis-copal in extent, being wider and greater in effects and giving assur-ance of an unerring guidance, it is not in the least surprising that from the start, a new religious congregation will have this in view, to obtain a favorable decision'concerning itself from the Holy See. In its early stages a new community is still in an imperfect condition. Though entirely an autonomous society, yet it is subject to many restrictions on the part of the bishop. Besides formerly if it should chance to spread into other dioceses many things militated~ against unity which is a prime requisite in order that the institute preserve its original nature and purpose. In this respect nowadays it is welI pro-tected by the Code. The aim of the new society will be to have firmness and stability, to be enriched with all the privileges and favors of Mother Church, which aim will not be fully obtained unless it has received the seal of definite approbation from the Head of all christendom.''34 "The spread to other dioceses is considered ~t0Bouscaren-Ellis, Canon Law (Milwaukee: The Bruce Publishing Company, 1946), p. 234. Z0Regatillo, lnstitutiones luris Canonici (Santander: Sal Terrae, 1946), I, n. 650. 81Ramstein, A Manual of Canon Law (Hoboken: Terminal Printing ~ Publishing Co., 1947), p. 299. a22ombart, Traitd de Droit Canonique (Paris: Letouzey et Ane, 1946) I, n. 810, 2. 33Jombarr, ibid. 8'~C. R. Orth, O.M.C., The Approbation of Religious Institutes (Washington: The Catholic University of America, 193.1), p. 131. 67 JOSEPH 1::. GALLEN the best reason for asking the approbation of the Holy See, because in that case there would be as many heads as there are bishops of the places where the community is established and this multiplied gov-ernment is not conducive to unity.''s5 FARRELL: "When a congregation has received pontifical appro-bation many phases of its subjection are withdrawn from the local Ordinaries in whose territory the congregation exists, and this juris-diction is supplanted by direct subjection to the Holy See. Thus, unfettered by the divergencies of the multiplicity of diocesan juris-dictions, the congregation achieves an extensive opportunity to exer-cise in a wider way the autonomy of moral personality, affording a unity of purpose through the various ramifications of its internal government to accomplish more effectively the work and purpose of its foundation.''s° IV. Conclusion The reader is now in a position to give his own answers to the questions of this article. These answers should be based primarily on the mind and will of the Holy See and on the common opinion in the Church. If the will of the Holy See is evident with regard to any action, arguments in favor of or contrary to that action are simply a matter of indifference. The intrinsic arguments for seeking papal approval emphasized by the authors cited above are: (1) the government and the constitu-tions of the institute receive a greater authority; (2-) the central and internal government becomes stronger; (3) the unity of govern-ment, spirit, and ministries of the institute is preserved;. (4) the in-stitute is endowed with a greater stability and is thus better able to preserve its original nature-and accomplish its original purpose: (5) the life and government of the institute become more autono-mous; (6) the institute has a greater liberty of diffusion and thus of increase. To these can be added (7) the more autonomous character of the institute naturally begets a greater internal initiative; (8) the immediate subjection to the Head of all Christendom and the wider diffusion of the institute are more apt to engender the universal view-point of the Holy See; (9) the constitutions approved by the Holy See and examined and corrected by specialists will very likely possess a greater excellence and utility. s~Orth, ibid., p. 145. SOB. F. Farrell, The Rights and Duties of the Local Ordinary Regarding Congrega-tions, o[ Women Religious o[ Pontifical Approval (Washington: The Catholic Uni-versity of America Press, 194~1), p. 56. 68 The Vir :ue of F:ait:h in :he Spiri :ual Life ~lohn Matthews, S.~I. BY ITS BAPTISMAL BIRTH man's soul receives divine life for the first time. It takes on a wholly, new and higher life. A second life comes into the soul and into its powers of mind and will. While sanctifying grace lifts the soul to a divine way of life, the virtues of faith, hope, and charity fill man's mind and will with the strength he needs to live his higher life. Thus grace thrbugh faith, hope, and charity makes us new men with new minds and wills. But what is faith? Life means power; faith is a God-given power of our grace-life. Life means lasting power; on this earth the holy person always possesses faith. This faith is a virtue, a power to take God at His word. By faith in action we believe God just because it is God who has spoken. In faith we bend our minds to the authority of God, of God's Son 3esus Christ and of God's Church. Man has a duty of bowing his whole self before God; through faith be subjects his mind to God. Thus faith is belief in God because He knows and tells the truth; those who enjoy such faith we call the faithful. In our Christian life this virtue is absolutely necessary. ~¢ usually comes through baptism and is lost only by mortal sins against faith such as heresy and apostasy. So the grown-up without faith lives in serious sin and has turned himself away from both God and heaven. "But without faith it is impossible to please God" (Heb. 11:6)--in the way God wants to be pleased, honored, adored, loved and obeyed, i.e., in the supernatural way of life. Again, we need faith because it enters into every deed of our grace-life. In all these works faith is at least implicit. Lastly, as souls born of God, we must have faith. For, as the child must be able to take his parents at their word, so we must be able to believe our heavenly Father: and we do this by faith~ "For you are a11 the children of God by faith" (Gal, 3:26). This important virtue of which we speak is a supernatural gift. It forms part of the equipment by which holy souls live and grow in the divine life. With this faith we know truths man could never know of himself. All the genius of Aristotle, Shakespeare, and 69 JOHN MATTHEWS Review [orReligious Edison could never figure them out; all the power of all men's minds could, never guess them. For by faith we know divine truths in a divine way. We see with certainty what God has told men through Christ and the, Church;; we take a .deeper look into God's teachings; we view everything with a sight and understanding far beyond the human. Through faith, furthermore, we possess the mind of Christ. "But we have the mind of Christ" (1 Cot. 2 : 16). This is the new mind we receive along with the new life of grace. No longer do we think and plan in a merely human{ way but we think as Christ did, we plan as Christ planned, we value what Christ valued. We think holy thoughts; we know the truths Christ knew and chose to tell us; we accept His judgments and values on everything, e.g., on the world, on race and color, on the human soul. With the new mind of faith the supernatural man looks on all things in their relation to God and to his own salvation. This is faith at work--a living active fruitful faith: The virtue of faith, while itself interior, produces acts of faith both interior and exterior. Indeed, the faith of God's children must be a working faith. Such is the message of St. James in his Epistle. "For even as the body without the spirit is dead, so also faith without works is dead" (James 2:26). Possessing the mind of Christ, we must use that mind to live our divine life. For faith is the rock-foundation of our morals, our devotions, and our liturgy. Hence our holy deeds must be rooted in and must spring from faith in action. The "man of God must live by faith, and this he does when he bows his mind to divine truth on God's authority and when he guides his actions by that truth. Faith guides our actions by entering into there. It underlies and penetrates all our virtuous acts. The Catholic can hope for heaven only after faith tells him heaven exists. The faithful obey Christ's Church because faith assures them it is the true. church. Penitents by approaching the confessional bear witness to their faith that God's priest has power to forgive sins. In his belief that bap-tism is necessary for salvation, the Catholic father bears his child to the font of eternal life. Confirmed in faith, God's children adore the Eucharistic Christ, receive Holy Communion, and offer the Holy Sacrifice. As another instance of how faith penetrates.our life of holiness, let us consider charity. This latter virtue shows .itself in many diverse acts (1 Cot. 13:~r-8). There is the love of God above all 70 March, 1950 VIRTUE OF FAITH else, which we must practice in order to continue living the divine life. There are the works ofmercy, compassion' for one's fellow men, perfect contrition, almsgiying, the love of our neighbor in Christ, th~ expending of self for God's sake and for others. The reason why holy souls do these charitable deeds is the love of God in Himself and of men in God. But this infinite lovableness of God they know through.faith, which teaches them that God deserves to receive our purest love. Thus faith enters into our works of charity by supplying a supernatural reason for doing them. So too in all the circumstances of life does faith play its divinely assigned part. The truths we believe have power to overcome our human fear, weakness, and distrust of seIf. How often Our Savior spoke these words: "thy faith hath made thee whole" (Matt. 9:29; 15:28; Luke 8:48; 17:19). In the face of temptation, sickness, evil habits, poverty, andpersecution our faith gives us grounds for confidence that we can overcome all hardships in a Christlike man-ner. "This is the victory which overcometh the world, our faith" (1 dohn 5:4). In. order to see further the force and value of Catholic belief in the soul, let us view two men-~one with and the other without faith. On the death of a relative the latter can give only human sympathy, cannot help the deceased, can only send flowers and'can-not comfort the bereaved very'greatly. The real Catholic through his faith speaks words of divine sympathy. He helps both his dead relative and bereaved kinsfolk--by his comforting words, by his prayers and Masses and virtuous deeds. The soul without faith grieves as those "who have no hope" (I Thess. 4:13); the faithful soul sees in death God's will, entertains the hope of eternal happi-ness for his dear deceased, and offers his pain at bereavement to help his relative into heaven. Again the work of faith appears when these same men yisit a Catholic church. To the faithless person the church is a structure--perhaps, a thing of beauty; to the faithful, it is a home, a holy place, the house of God. For the former the stained-glass windows may be works of art; for the Catholic they serve to recall the mysteries of his religion and to hold his mind in prayer. In the opinion of the man without faith the baptismal font, confes-sional, and altar rail are the ordinary furnishings of a church; the child of God esteems them as sources of divine life in his soul. To his mind the tabernacle is no mere happening but the abode of Christ in the Eucharist; the altar is no chance property but the place of daily sacrifice, the bne thing withoutt which no building can be a church: 71 JOHN MATTHEWS the sactuary lamp is not just an adornment but a sign to the faithful that Jesus is at home, waiting for their visit. In the Catholic church the person who has not faitl-J is a stranger and sight-seer, the man of faith is at home with Jesus in His Father's house. So vast is the difference between the person without faith and the man whose actions are wholly penetrated by tiis Catholic faith! Let us sum up now the work of faith in the divine life of our soul. The virtue of faith gives us a new mind, enlightened with the new truths of Our Lord's Testament. A grown-up receiving the virtue of faith, may seem the same after his conversion as before-- ¯ but he is not. He has new thoughts; he knows God's new com-mands; all events in his life take on a divine meaning for eternity: his belief gives a heavenly purpose to his actions: he will soon show by his outward deeds of virtue the inward change within his mind. "For with the heart we believe unto justice: but with the mouth confession is made unto salvation" (Rum. 10:10). Moreover, to live the life of grace we must 1ire a life of faith. This virtue must influence' a11 our actions. Hence our every deed must be an act "of faith, must bear witness that we choose~ to be amongst God's faithful, must be a profession of our belief. Our religion, which is our .faith, must underlie all the circumstances of our lives and give them a Catholic tone and value. That is the work ¯ of faith. Thus by living a life of faith we actively live our grace-life. "The just man liveth by faith" (Rum. 1:17). Indeed, our faith and our divine life grow step by step together. For every holy deed we do God gives us this reward: our grace-life grows fuller and at the same time our virtue of faith is so deepened and enriched that it becomes stronger against temptation, that we are more Christ-minded, that we can make greater acts of faith. In this manner faith plays its important part in the growth of our divine life. OUR CONTRIBUTORS JOSEPH F. GALLEN and JOHN MATTHEW8 are members of the faculty at Woodstock College, Woodstock, Maryland. DOMINIC HUGHES is a member of the Pontifical Faculty of Theology, Dominican House of Studies, Washington, D. C. 72 On Controversy WE HAVE RECEIVED certain c,r, iticisms for publishing "Thd Three Ages o~f the Interior Life, by G.'Augustine Ellard, S.3". (Cf. REVIEW FOR RELIGIOUS, VIII, 297-317.) One criti-cism is that the "theological erudition" of Father Ellard's article "takes advantage of readers who lack the technical preparation neces- Sary to measure its true weight." (Cf. IX, 42~-43.) Another criti-cism, not sent for publication, is that Father Ellard's article contains controversial matter, and that a magazine like ours should keep clear of controversy. It seems advisable to explain our position. Father Ellard's article was a book review; and the work he reviewed (The Three Ages of the Interior Life, by Father R. Garri-gou- Lagrange, OIP.) is decidedly theological. It is difficult to see how a v~ork of this kind could be reviewed without using theological erudition. Moreover, The Three Ages is intended, as least partly, for just such people as our readers; hence it seems that the theological erudition used in reviewing the work would no more take advantage of readers than would the work itself. It might be added here that one of the precise purposes for founding this REVIEW was tO present sound theology without the technical accompaniments that are usu-ally found in a strictly theological journal. As for controversy, we have always tried assiduously to avoid controversial topics or at least to avoid taking sides in any theologi-cal debate. Less than a year ago, when we published "Mystical Life--Mystical Prayer," by M. Raymond, O.C.S.O., we were care-ful to prefix to the article an editorial note indicating that Father Raymond's view was only one of three legitimately defended opin-ions on the normal development of the spiritual life. We expressed no preference for any of the opinions. (Cf. VIII, 121,) No one objected to our calling attention to the controversial nature of Father Raymond's article. Why, therefore, should anyone object to Father Ellard's pointing out that certain basic questions in The Three Ages are subjects of legitimate controversy? It would be naive to imply that, in publishing Father Ellard's .article, we did not expect contrary reactions. Since the author of The Three Ages has many admirers, it was quite likely that some of 73 ON CONTROVERSY Review for Religious them would come to his defense. It is clear, then, that in publishing the book review, we had to run the risk of controversy. The only ways oi~ avoiding it would be to refuse to review the work, or to publish an insincere review, or to print a sincere review without allowing a rebuttal. None of these procedures was or is desirable. Hence, we have some controversy, and perhaps it may continue for a time. We trust that our readers will find it both interesting and profitable. In this issue we present an article by Father Dominic Hughes, O.P., in rebuttal to Father Ellard, together with a brief reply by Father Ellard and a communication defending his position. Other'expres-sions of opinion on either side will be accepted. However, lest this subject .matter consume disproportionate space in the REVIEW, it seems necessary to limit further contributions to communications. Conditions for acceptance of these communications will be found on page 96. Now a word about Father Hughes's article. In some aspects it differs from our usual editorial policy; yet it seemed better, under the circumstances, to waive insistence on policy. What he says, however, about doctrinal authority in the Church, especially the authority of Doctors of the Church in general and of St. Thomas Aquinas in particular, calls for special editorial comment. For the most part this comment will simply agree with him and emphasize the truth of what he says; in one point it will at least qualify one of his views if not express a complete difference of opinion. Father Hughes rightly observes that the highest doctrinal author-ity in this world is the teaching Church. And this truth needs emphasizing in our times, even in the case of many devout laymen. This teaching Church is composed of the Pope himself, and of the bishops of the world united with tbe Pope, whether in a general council or ~in their respective dioceses. Theologians graphically and reverently style the~e successors to the Apostles theVioum Magisterium (the living teaching body) or simply the Ecclesia Docens (the teaching Church). It is a wonderful thing, this living teaching Church; it pos-sesses not only the great truths of revelation with which Christ and the Holy Spirit endowed the Apostles but also all the wisdom of the succeeding centuries which has been used in the exploration and explanation of the original endowment (the Deposit of Faith,. as it is. called), The Doctors and other theologians have authority only in so far as they express either the doctrine of this living .Church or 74 March, 1950 ON CONTROVERSY speculations which are in conformity with that doctrine. The revelation confided to the Church is a limitless treasure; and our knowledge of the doctrine and its implications is subject to con-stant growth. In this process 9f growth through the centuries there have always been questions that were not clear, that needed further exploration and illumination. Consequently, there have been and are divergent opinions, with abIe scholars defending contrasting views, without remonstrance and even with encouragement from the Church. The interesting question thus arises: how is the theologian of today to align himself in such controversies? Thd first duty of the true theologian is to judge the reasons of the respective sides in the light of already established principles and doctrines. Finding the reasons lacking sufficient cogency to win his preference, he might then inspect the authorities holding the different views. Suppose that in a debated question such as I have just outlined, a Doctor of the Church would be the principal defendant of one opinion. Should he, by the very fact that-he is a Doctor, win the theologian's intellectual preference? I get the impression from Father Hughes's article that he would answer this question in the affirma-tive. If this impression is correct, there is room here for a difference of opinion. The title of Doctor of the Church includes an official declaration of eminence in theological learning, but not necessarily pre-eminence over all uncanonized scholars. The eminence of some of these uncanonized theologians is attested by the constant use of their works in theological schools and even by the great, confidence placed in them by the Church while they were still living. Father Hughes suggests that in the canonized Doctor there is the added con-sideration of supernatural wisdom. But this wisdom is not limited to the canonized; it accompanies grace and virtue, not canonization. And history attests that many of the uncanonized scholars were men of lofty virtue. For example, speaking for Benedict-XV, Cardinal Gasparri styled Scotus a "most holy man,"; and speaking for himself Leo XIII referred to eminent Jesuit scholars (none of whom .were then Doctors of the Church) as men of "extraordinary virtue." So much for the authority of Doctors of the Church in general. As for St. Thomas Aquinas in particular, it is unquestionable that the Church's esteem for him is unique. Canon 1366, § 2, directs that professors of philosophy and theology should treat these subjects after the method, doctrine, and principles of the Angelic Doctor, and ¯ should hold these as sacred. An examination of the many documents 75 ON CONTROVERSY Review for Reliflious referred to in the sources of this' canon shows that it is but a capsule formulation of the insistent injunctions and directives of Leo XIII, Plus X, and Benedict XV. These Popes considered him not merely as an individual but also as the representative of all the great Scho-lastics of his time because in his works the best of their teaching is most perfectly embodied. Six years after the promulgation of the Code of Canon Law, Plus XI reaffirmed the praise and injunctions of his predecessors in an encyclical letter (Studiorum Ducem, June 29, 1923) which is rightly called a papal commentary on canon 1366, § 2. Finally; just a few months after he became Supreme Pontiff, Plus XII, in an address to clerical students in Rome, .recalled and approved all these directives (June 24, 1939). Obviously, therefore, the Church wants professors and students of philosophy and theology to follow St. Thomas. Ye~ it is not to be a slavish following which, in the words of Benedict XV, "would clip the wings of genius with consequent injury to the deeper study of theology," (Spoken in an audience granted to the Jesuit General and his Assistants, Feb. 17, 19.15.) 'This is not the place to try to indicate precisely the legitimate limitations to the following of St. Thomas; but it may be well to show, through the words of the Popes themselves, that the~e are some limits. Speaking of the "wisdom of Aquinas," Leo XIII insisted that he did not wish to propose to our age for imitation "anything which does not duly agree with the proved findings of a later age;" or any-thing "which does not hax~e its measure of probability." (Cf. the encyclical Aeterni Patrfs, in Fontes Codicis, III, p. 149.) Benedict XV declared in a letter to the Jesuit General (Mar. 19, 1917) that the Roman Pontiffs "have invariably held that St. Thomas must be regarded as the guide and master in the study of theology and phi-losophy,, although everyone retains full freedom to argue for either side of those questions which can be and are wont to be disputed." Pius XI, having enjoined the strict observance of canon 1366, § 2, added: "But let no one require of others more than is required of all by the Church herself who is the teacher and mother of all; for in those matters in which there is division of opinion among the best authors in Catholic schools, no one is forbidden to follow that opinion which seems to him to be nearer to the truth." (AAS, XV, 324.) Finally, in the address previously referred to, Pius XII said: "At the same time we make Our own the warnings of these same Predecessors, whereby they sought to protect genuine progress in sci- 76 ON CONTROVERSY ence and lawful liberty of research. We thoroughly approve and recommend that the ancient wisdom be brought into accord, if need be, with the new discoveries of scholarship; that there be free discus-sion of points on which reputable students of the Angelic Doctor commonly argue; that fresh resources be drawn from history for the better understanding of the text of St.Thomas." (AAS, XXX; 246-47.) Some people, hazily cognizant of historical disagreements on certain profound questions, seem to think that Dominicans and Jesuits are always on opposite sides of a theological debate and that Jesuits are not followers of St. Thomas. The impression is false. And it may be informative to add here that St. Ignatius enjoined the study of the "Scholastic doctrine of St. Thomas," and that this rather general prescription of our constitutions was made very definite by our Fifth General Congregation (1594), which legislated that Jesuits must consider St. Thomas as their own special doctor. The words of Leo XIII are witness to the fidelity of Jesuits in carrying out this command. Speaking of eminent Jesuit theologians, the Pope said that "being as they were, men of extraordinary virtue and talent, and applying themselves assiduously to the works of the Angelic Doctor, with certain arguments they expounded his tenets in a manner full and excellent,, they adorned his doctrine with the rich trappings of erudition, they made many keen and practical deduc-tions therefrom for the refutation of new errors, adding besides what-ever declarations or more exact decrees had since that time been made by the Church in this same field. The fruits of their industry no one in truth can spurn without loss to himself." (Apostolic Letter Gravissirne Nos to the Jesuit General, 1892.) --GERALD KELLY, S.J. SEARCHLIGHTING OURSELVES Many shrewd observations for retreats and tridua are found in Searchlighting Ourselues, the Retreat Notes of Father Timothy Brosnahan, S.J., edited by Francis P. LeBuffe, S.J. The book contains notes on the various meditations of The Spir-itual Exercises, several conferences on basic points of the spiritual life, and a number of special meditations, notably a series on the Beatitudes, for use during tridua. Jesuit Seminary and Mission Bureau, 51 East 83rd St., New York 28, N.Y. 77 Works of Made/v anit:es!: Dominic Hughes, O.P. CHARITY and solicitude for souls moved .Father Ellard (RE-VIEW FOR RELIGIOUS, November, 1949) to lay several stric-tures upon Father Garrigou-Lagrange's Three A~es of the Interior Life. That same charity now prompts a staying hand. Petulance or truculence cannot rise to defend either side in chari-table controversy. Neither party can reprove the sincere expression of an opinion any more than either can approve indefiniteness in doc-trine or ineptness in expression. Rather both must call upon charity's constant companion, wisdom, whose "abode is in the full assembly of the saints" (Ecclesiasticus 24: 16). However unqualified writers or readers may be in matters secu-larly or sacredly scientific, their judgment from wisdom will partake of that calm and certitude of those aware that "If anyone desires to do His will, he will know of the teaching whether it is from God" (,John 7:17). Even in these controversies about subsidiary doc-trines and their suitable expression something of the clarity and security of a truly wise appraisal is attainable, "for the spiritual man judges all" (I Corinthians 2 : 15). The judgment of the spiritual man is based on neither caprice nor allegiance, but solely upon wisdom. "It pertains to wisdom," --St. Thomas, the Common Doctor, expressed the common doc-trine--" to consider the highest causes through which it may judge of other things with the greatest certitude and according to which it should order other things" (Summa Tbeolo~qica, II-Ilae. q.45, a.1). Wisdom, then, has one main product and two by-products. The primary product of any habit of wisdom is a "consideration of the highest causes." In the different orders of reality and knowl-edge, various highest causes attract the attention of divers kinds of wise men. In any case, however, the object of wisdom's considera-tion is the ultimate, in words as in works. In works the absolute ultimate in no way ordered to anything further, and the measure of all, are the works of God made manifest in the works of Christ. Relatively ultimate, first and last in a particular line, and the measure of that group, are the works, for example, of a founder of a religious society, so that St. Ignatius would be the measure of the accomplish-ments as Jesuits of his followers, even of the glorious achievements 78 March, 1950 WORKS OF GOD MADE MANIFEST of St. Francis Xavier and St. Robert Bellarmine. In words, the absolute and unassailable ultimate is the voice of the Church and Sacred Scripture. Relative ultimates, too, are found in various writings: .those of St. Thomas for the whole of theology, those of St. Alphonsus Liguori for practice in moral problems, and those of St. 3ohn of the Cross inmatters mystical. Upon the basis of this "consideration of highest causes" wisdom has as one of its by-pr0ducts a judgment of things other than the highest cause itself "with the greatest certitude." The maximum of security in judgment is not invariable, but will change according as the highest cause is either absolutely or only relatively ultimate. In matters in which the Voice of God has not yet been heard---or may never be--the certitude attainable cannot be as unqualified as when the Church has spoken. Yet various other causes may be given a limited but appreciable certitude as they more or less cogently elimi-nate any worthy fear of contradiction. Moreover, some considera-tions within the scope of wisdom's judgment, metaphysics for example, need admit of no exceptions. Moral judgments, of which the mystical is a phase, however, can attain a certitude about human actions only "as they most often happen." "For it is the mark of the educated man to look for certitude in each class of things just so far as the nature of the subject admits" (Aristotle, I Ethics, c. 3). In this spirit, St. Augustine, who was well aware that no case was finished until Rome had spoken, expressed a wise certitude: "I do not wish my reader to be bound down to me, so I do not wish my corrector to be bound down to himself. Let not the former love me more than the Catholic faith, let not the latter love himself more than the Catholic verity . Do not be willing to amend my writings by thine own opinion or disputation, but from the divine text or by unanswerable reasons." (On the Trinity, Bk. III, Preface.) The mere possibility of an unwarranted contradiction because his every word was not inspired or even uncontested--was not enough to unsettle the mind of St. Augustine, even about what he himself had written. Certainly others reading his words so often approved by the Church can reach the "greatest certitude." Like-wise, concerning a wide variety of matters, even without a decision of the Church or a consensus of theologians, certitude can be had upon the basis of either the arguments proposed or auth6rities cited. The citing of authorities is not a matter of number but of weight. The weight of one Doctor of the Church can overbalance toward 79 DOMINIC HUGHES Review [or Religious certitude any dispute, despite the contradictions of a multitude of theological scribes. Weighing such authority is the second by-product of wisdom. From a catalog of opinions or an enumeration of members of various schools a deep appreciation of human limita-tions may be derived, but scarcely a wise judgment. Wisdom, in addition to considering the highest causes and judging other things with the greatest certitude, orders other things .acgording to the highest cause, either in any particular grouping or according to the absolute ultimate itself. It does not gather a crowd but establishes a hierarchy. Not how many authors may be found who differ from one another, but how they are arranged relative to the primary master of the subject, e.g., ~lohn of the Cross~such is the judgment of wisdom. This wise ordering of authors, moreover, avoids two extremes. Spiritual atavism is inclined to bow so low and so often before the ancestral authority of a father, either of the Church or even of a particular spiritual family, that little opportunity is afforded for examining or explaining doctrinal implications or making practical applications. The other extreme to be shunned, more a tendency than a tenet, is a mollified "modernism." Those affected by it are disposed to judge the latest as the best, the more contemporary as the, more commendable. The foundation for avoiding both extremes, too much of the past, too much of the.present, and of formulating a truly wise judgment is an ordering, not according to.personal prefer-ences but according to principles. The principles of wise judgment are not personal but the peren-nial preferences and special approbation of the Church. When the Popes have praised and so often used particular authorities, e.g., St. Augustine or St. Thomas, as the highest, though not the exclusive causes for engendering certitude in the judgments of the faithful, there is little fear of worthy contradiction in following their example. In that case, other theological or spiritual writers, as they more or less approach and approximate the doctrines of these highest causes of the greatest possible certitude will take their place in the estimate and esteem of wisdom. The impressiveneses of such considerations as numbers, either of authors or copies of their works sold, avail-ability in English, or other such shavings of certitude is, for wisdom, negligible compared to the arguments or authority of but a single Doctor of the Church. These teachers of the "mind of Christ" offer principles at once profound and practical. The highest in heaven always seem the most down-to-earth. None realized more than they how each soul 80 March, 1950 WORKS OF GOD MADE MANIFEST must budget its talents, using a few well-coined principles through- Out its spiritual life to make both ends meet---in God. Prodigality in principles and in words, they were sure, would contribute to neither practicality nor profundity. With but little, and all of that Christ's, they sought and saw the deep things of God and the deep things of each soul on its way towards Him. The profundity and practicality of other spiritual writers can be wisely appraised only as it more or less approaches what is found in the Doctors both in their wisdom by infusion and their Wisdom by 'industry. Together in a single act these fountainheads of truth converged to give the saintly doctors their certitude. In others--so often what is united in superiors is divided in inferiors--an actual judgment is the result of either one or tlSe other, either of wisdom by infusion or of wisdom by industry. Wisdom by infusion, the science of the saints, as a Gift of the Holy Ghost judgeswith certainty and orderliness, not through metaphysical discourse, but by a loving accord with its object--"by tasting and seeing that the Lord is sweet." Wisdom by industry, the science of theology, on the other hand, secure though it is in the principles of faith, suffers the labors and infirmities of all human effort. Yet,. at times, wisdom by infusion must appeal to wisdom by industry to corroborate its expressions and to co-ordinate its findings; the mystics and spiritual writers must submit divine truth to the scribes in theology for a test in human terms. Wisdom's test, in human terms, concerning the charitable contro-versy over the divergent views of Father Garrigou-La~range and Father Ellard involves two major considerations: doctrine and method. The points of doctrinal divergence most worthy of mention con-cern the Gifts of the Holy Ghost: contemplation: its place and kinds; and the unity of the interior life. The methodological differences arise either positively from the stress or emphasis of one doctrine more than another, or negatively through the omission of detail by some considered as integral to any spiritual treatise. WISDOM IN WORDS: DOCTRINE The points controverted concerning the Gifts of the Holy Ghost are their necessity, nature, function, and number. " Concerning each of these points separately, and cumulatively, too, Father Ellard brings forth his hobgoblin--uncertainty. Upo'n how little might be said with certainty there can be found only the sole small voice of scholarly research, Father DeBlic, who 81 DOMINIC HUGHES Review [or R'eligious minimizes w.hat even Father De Guibert, S.J., thought .an irredu-cible denominator. Many Dominican theologians, are cited as recog-nizing a.controversy upon the matter, but the conclusions of each do not seem worthy of mention by Father Ellard. If thi~. process were pushed to its principle, it would imply that as soon as a point is questioned it immediately becomes questionable, and as soon as doubted, doubtful. Such can. scarcely be a moving principle to wis-dom which has ordered authorities according .to the highest among them and thus attained the "greatest certitude." To corroborate the general judgment of wisdom, however, each subordinate point which has come under scrutiny may well be examined. The necessity of the Gifts, as explained by St. Thomas, seems to have suffered the least from the minimizing tendencies of later and lesser theologians. None of the mystics, moreover, have found them a luxury. They are vital to the life of divine grace; "the just man," Leo XIII testified in his Encyclical Dioinum illud munus (May 9, 1897), "has need of these seven gifts." Because of the overwhelming testimony in tradition to the intimate association of the state of grace and presence of the Gifts, even the doughtiest opponent of Thomistic doctrine on the Gifts must treat the denial of this point as negligible. The nature of the Gifts, however, is quite another matter. "They make us docile to the Holy Ghost," according to a formula suffi-ciently broad to embrace all'variants, but not to preclude precisions. While all would agree that docility to the Holy Ghost is of the essence of the Gifts, as Father Ellard triumphantly pointed out to drive in the wedge of uncertainty, "not all" would ,concur with St. Thomas in finding them distinct habits in the soul. The words of Sacred Scripture itself give warrant for St. Thomas's doctrine, inasmuch as they imply a unique divine influx. This,doctrine of St. Thomas cannot lightly be set aside. His reason cannot be dis-proved, his authority no one can gainsay. Although obviously not of Faith, his doctrine has an approbation by the Church incompar-ably above any i~f those proposed by Father Ellard as competitors for our certain allegiance. Ordinary permission to teach or publish thisis only a faint resemblance to the abundant approval given to Doctors of the Church. In them, because of their sanctity and the special scrutiny of their works, the Church recognizes unique wit-nesses and guardians of her patrimony, the doctrine of Christ. Over and above the acclamations usually given to a Doctor, St. Thomas has received frequent and unique marks of esteem from the Church. Pope Pius V referred to him as "the most certain rule of Christian 82 March, 1950 X~rORKS OF GOD MADE MANIFEST doctrine," and Pope Clement VIII was sure that he could be "fol-lowed without any danger of error." These" and many other state-ments by successive Popes are not private hyperbole but public declarations, normative if not mandatory in Faith. Against this weight of certitude from St. Thomas, Father Ellard proposes (p. 305) a theologian described, in a citation from clerical students, as the."Subtle Doctor." Of the su.btlet~r of'Scotus there is no doubt; but of the tebm "Doctor" as applied to him there is con-siderable reason for hesitance. No more of a' Doctor of the Church than so many others who have taught in her schools throughout the centuries, Scotus has neithe~ the approval of his sanctity nor of his doctrine that is required of a Doctor. His opinion is, therefore, of an entirely other brder in certitude from that of St. Thomas. It is on a plane "with that of Suarez, who could not concur with St. Thomas in the matter of grace but could affirm against Scotus that he appreciated the importance of distinguishing between the virtues and the Gifts. The allegiance, moreover, of St. Francis de Sales to the doctrine of Scotus cannot be alleged'with certitude. The Gifts are, in the words cited by Father Ellard' (p. 306), "the virtues, properties and qualities of charity." (Cf. The Looe or: God, XI, 15.) "Speaking precisely," as St. Francis assured us he was doing, all these entities are distinct from the essence, although perhaps inseparable from it. In like manner, although the Gifts and charity are always together, they do not merge into one habit, otherwise the same might be said of St. Francis de Sales' doctrine of the relation of charity and the other infused virtues. Charity would not then be the "gift of gifts" (XI, 19), but the one gift, n6t the essence or bond of perfection, but the whole of the spiritual organism. There is nothing suffi-ciently explicit in the words of St. Francis de Sales to indicate an approval of the Scotistic opinion or the disapproval of the doctrine of St. Thomas. Even if a rivalry were established between these two Doctors of the Church, inasmuch as the matter is one of theological principles, the preponderance of authority would easily go to St. Thomas. To St. Thomas, then, and not to Father Garrigou-Lagrange, wisdom looks for its "highest cause" according to which it might order other opinions and thus attain the "greatest certitude" possible concerning the nature" of the Gifts. Obviously, Pohle-Preuss, Forget; Van der Meersch, and legions of other writers who subscribe to what is least as what is safest, are far from disturbing the certitude of 'a 83 DOMINIC HUGHES Reoiew for Religious soul in which wisdom dwells. The judgment of wisdom appre-ciates the authority and approves the arguments, the sublimity and certainty, of the doctrine on the Gifts proposed without equivoca-tion by St. Thomas. Allegedly based upon St. Thomas and employing his authority is the more recent confection of two different modes of the Gifts in life. The gesture with which Father Ellard includes Cardinal Billot among Thomists is so expansive that it would embrace all who, for one point or another, approximate the teaching of the Angelic Doc-tor, whose method, doctrine, and principles are to be held by all teachers as sacred according to the mandate of the Church (Code of Canon Law, canon 1366, § 2). Moreover, the contemporary pro-ponent of the theory qf two modes of the Gifts in this life, one ordi-nary, the other extraordinary, was immediately and unhesitatingly denounced as having mistaken and misquoted St. Thomas by Fathers R. Dalbiez (l~tudes Carm$litaines, April 1933, pp. 250ff.) and P. P~rinelle (Revue des sciences philosophiques et theologiques, No~ember 1932, p. 692), as well as by Father Garrigou-Lagrange (La Vie spirituelle, November 1932, suppl, pp. [ 77 ] if). Such total misinterpretation of St. Thomas cannot be a "form of modern Thomistic theory on the Gifts," as Father Ellard would have it (p. 310), but rather a warning against making St. Thomas a wit-ness to any elaboration prejudicial to his principles. Certain, partly because it is "seamless," Thomistic doctrine preserves its purity and integrity by faithful adherence to the "method, doctrine, and prin-ciples" in the text of St.' Thomas, particularly in the question of the nature of the Gifts. The number of the Gifts is likewise clearly and authoritatively determined in the text of St. Thomas. As always, he is in full accord with the texts of Sacred Scripture which the Church and the best exegetes c~ansider most reliable, as well as the sense of the Church in the hymn Veni, Sancte Spiritus, and the Catechism of the Coun-cil of Trent. St. Augustine is of the same mind (cf. On Christian Doctrine, II, 7), and St. Francis de Sales refers to the "seven Gifts of the Holy Ghost" (The Love of God, XI, 19) in a text otherwise considered probative by Father Ellard (p. 306). To introduce and perhaps induce a doubt in the traditional enumerhtion as taxative or "limitative," Father Ellard cites (p. 309) an author who would amplify the number as by "an infinite variety of shades." This plethora, seven is a "plenitude," the same author affirms is the intention of the sacred authors, "as we know." How we are to know, 84 March, 1950 WORKS OF GOD MADE MANIFEST however, is not indicated. Either a private revelation or some extremely adroit exegesis would be necessary to belie the authority of Doctors of the Church, who, so close to the primary author of Sacred Scripture--the Holy Ghost--have considered the Gifts as numeri-cally determined. Determination by the Doctors on one point may leave still another undetermined with exactly the same cogency and certitude. St. Thomas himself, having given, on the authority of another, a general schema of the functions of the various gifts, found it neces-sary to reconsider one of its aspects. "Who will assure us that the . last is perfect?" Father EIIard quotes (p. 309) a scholar who has studied the point. Who, on the other hand, will be temerarious enough to.insist that the last is imperfect or.less perfec~ than any other proposed? A distinction and argument which, after long thought, had clarity and cogency for St. Thomas has the added note of authority for those who wisely appraise both the change and the conclusion. In making his schema, St. Thomas realized he was establishing an appropriate parallel, an educative device, an argu-. ment of convenience. Neither he nor St. Augustine--nor Father Garrigou-Lagrange--attributes the same probative force to a schema as to a syllogism. Indeed, The Three Ages evidences an admirable conformity to the doctrine of St. Thomas, and his classical commen-tator, John of St. Thomas, in the substance and schema for the functioning of the various Gifts. The final point concerning what Father Ellard chooses rather ungraciously to call "the present-day Thomistic hypothesis" of the Gifts is their association with the doctrine that some graces are intrinsically efficacious. A larger issue is involved here than the .mat-ter of the Gifts and it should not be treated by innuendo. If at this juncture "many people pause," as Father Ellard expects (p. 310), because the common pre-Reformation doctrine on the efficacy of grace and the nature of the Gifts are "indissolubly bound" in doctrinal integrity, will it be to neglect an assured and consistent teaching for one that is hopelessly entangled in affirmations, denials, and com-promises? Those who demur at the doctrine of grace as expounded by St. Thomas cannot fail to deny his teaching on the Gifts. Only a compromise could enable Suarez to affirm the doctrine of St. Thomas on the nature of the Gifts and deny his doctrine on grace. Such compromises are always uncertain, as the doctrinally internecine con-flict among Molinists and Congruists amply testifies. Somewhat as a summary of his consideration of the .Gifts, 85 DOMINIC HUGHES Review [or Religious Father. Ellard implies (p. 311) that because leading Thomists are aware of controversies they themselves are subject to uncertainty. Nothing could be further from the truth, unless that Catholics by their cognizance of heresy diminish their faith. Moreover, because the teaching of The Three Ages is based upon what "the great majority of theologians hold with St.Thomas," a wise judgment would con-cede Father Ellard but poor pleasure in having ferreted out an admission that "'not all [italics his] theologians agree on this par-ticular fundamental point." Upon such minimal evidence and defensive techniques only an artificial uncertainty and imprudent reservation or suspension of judgment can be built. Father Ellard-emphasizes complexity ;ind confusion, Father Garrigou-Lagfange the "certitude of the great directive principles that illuminate all spirituality (cf. p. 311)." In the matter of the Gifts, their neces-sity, nature, number, and fufiction, .not St. Thomas' and Father Garrigou-Lagrange's unassailable doctrine, but Father Ellard's unre-solved doubts lead to "'disillusionment and discouragement" which all are so solicitous to avoid. Another complex question in need of "great directive principles" is that of contemplation. Concerning the exposition of contempla-tion in The Three Ages, Father Ellard seems to find two points of difficulty: the presence of acquired contemplation; the place of the infused. With regard to acquired contemplation, Father Ellard finds reason for criticism in the fact that Father Garrigou-.Lagrange gives it "hardly any place" in his s'ynthesis of the entire interior life,, while the Carmelite Father Gabriel of St. Mary Magdalen devoted "half his work, St. dohn of the Cross" to justifying its place in Carmelite theology. The same Carmelite, however, gives as his wise and orderly conclusion (pp. 199-200) that "the central thesis of the Thomistic spiritual synthesis is supported by the doctrine of actlx;e contemplation." Even if Father Ellard, in the Three Ages, would replace "hardly" with "half" to suit his preferences, the wise ordering of part to whole in both Carmelite and Dominican is obvious. Moreover, "St. Theresa never speaks of any other than infused contemplation.,"~ Father Gabriel states categorically (p. 111), while he and others can find only equivalents of the term in St. John of the Cross. Both the problem of terminology and the point of doc-trine concerning the "beginning of contemplation" (Dark Night, I, 9) and the "acquired prayer of recollection" receive ample and appropriate treatment in the chapter on "Contemplative Prayer" in The Three Ages. More would.make a part into a polemic. 86 March, 1950 WORKS OF GOD MADE MANIFEST If others disagree with Father Garrigou-Lagrange in this matter it should not be surprising. The harmony he has indicated between St. Thomas and St. John of the Cross is well-founded in the best Carmelite and Dominican authorities. If a dissident attitude arises from the outside and even seeps within, the foundations, of accord in the Theresian and Thomistic teachings are not tragically undermined. Without mentioning either the Common or the Mystical Doctor, Father Ellard has assembled a variety of authorities (p. 303) to indicate a confusion on the place of infused contemplation. The teachings of Msgr. Saudreau, Tanquerey, Crisogono, and Naval-- all but the last two differing from one another--are arrayed against that of The Three Ages. No mention is made, however, of which of all in the field more closely conforms to the doctrine of the Doctor of Contemplation, St. John of the Cross. Tanquerey, Crisogono, and Naval are not even close. Msgr. Saudreau confines contempla-tion to the unitive way. With "a great difference indeed" (p. 303) Father Garrigou-Lagrange conforms exactly to the doctrine of St. John by placing infused contemplation in both the unitive way and--to use St. John's own words--"the way of proficients, which is also called the illuminative way, or the way of infused contempla-tion" (Dark Night, I, 14). This explicit testimony of the "highest cause" in matters of contemplation and Father Garrigou-Lagrange's strict conformity to it, leaves but one judgment ~or wisdom-- "greatest certitude" for the doctrine on the place of infused con-templa. tion in The Three Ages. Moreover, when it is a question of the relationship between the Gifts and contemplation, Father Ellard's strictures are utterly con-fused. His use as an argument from omission of inappropriate texts from St. Francis de Sales and St. Alphonsus "who would have advocated for all a form of mental prayer that is full of inspirations from the Holy Spirit" is pitiably feeble. Fantastic, nothing less, is his assertion that "although in their process nothing has been said about infused contemplation," persons have been canonized, and hence "we can safely conclude" from no mention, let alone non-manifestation, to the non-existence of interior intellectual movements of the Holy Ghost in their souls. Father Garrigou-Lagrange clearly indicates (I, 81) saints and situations in which the activity of the intellectual Gifts are "diffuse." In them the practical Gifts of coun-sel, fortitude, or fear are more apparent, yet all the gifts will be "highly developed" and wisdom will [egulate all. Since the highest of mystical experiences is within the scope of a moral consideration, 87 DOMINIC HUGHES Ret~ieto for Religious judgments must be wisely formed" of them "as they most often hap-pen." Exceptions corroborate, not corrupt, certitude in morals, "for the man educated to expect them." Neither the fact that "various exceptions" are admitted to the doctrine of the predominance of infused contemplation, nor its "being so closely associated with a questionable theory of the gifts (p. 312)" is ground for asserting that the Theresian-Thomistic position in the Three Ages "suffers" a loss of certitude. Only those who are con-stantly looking for some "phenomenon in consciousness" which is "humanly noticeable" (p. 31'~) complain of dangers of disillusion-ment because the truth of mystical experience did not fit into their preconceived patterns. From the doctrines on the Gifts and contemplation flows the final point of difficulty: the normality of infused contemplation or the unity of the interior life. To Father Ellard's wonderment, The Three Ages "embodies no great new discovery nor corrects any old error" (p. 311). His observation is remarkably exact. The discovery is old, the error is new. Until the seventeenth century no one lost sight of the unity of the interior life and no arbitrary and artificial cleavage between ascetical and mystical theology was introduced. With the publica-tion of Scaramelli's Ascetical Directory an.d Mystical Director~l, how-ever the division and its tragic consequences were popularized. Since things ascetical were conceived as ordinary and the mystical, i.e., infused contemplation, as extraordinary, humility became the motive for the humdrum, and many souls apt for contemplation were forced to excruciating torments on the treadmill of discursive meditation. This new error bade fair to destroy an old discovery. To Father Garrigou-Lagtange is due sincere tribute as one of the vanguard leading souls to an appreciation of the traditional teaching on the unity of the interior life, its contemplative graces and gifts. Those only need fear disillusionment or discouragement in his leadership whose limited ideals or faint heart stultify their wisdom. WISDOM AT WORK: METHOD Wisdom governs not only the principles of the interior life but their presentation. In The Three Ages, Father EIlatd finds its doc-trinal stress and seeming omissions particularly distressing. Father Garrigou-Lagrange's stress upon the Gifts of the Holy Ghost is indeed a strain for Father Ellard. For him, "The whole vast construction presented in these two large volumes stands or fails with the special doctrine on the Gifts of the Holy Spirit which 88 March, 1950 WORKS OF GOD MADE MANIFEST forms as it were the supporting framework for it" (p. 305). Yet Father Ellard himself declared (p. 297) that "degrees of virtues, the functions of the Gifts of the Holy Ghost, various purifications, arid the grades of prayer are assigned to each of the three ages." Perhaps the mere presence of the Gifts gives them too much prominence for Father Ellard. On~ of his authorities (p. 313), and a confrere, Father Poulain, apparently not a theologian, however proficient a psychologist, in his extensive work, The Graces of Interior Prayer, somehow manages to avoid any treatment of the Gifts. To anyone acquainted with their importance in traditional spiritual writers, the exposition of The Three Ages will seem the mere summary it was intended to be (I, 66). On the other hand, the omissi~)ns Father Ellard finds so lamen-table are more nominal than real. If the part;.cular examination deals with the predominant fault, a chapter on that subject should satisfy Father Ellard's justification of it as "one of the major tech-nique. s in modern Catholic asceticism." When "for the general examination no precise method is suggested," it need not be a strange omission.Once the "Sins to be Avoided" are mentioned, as Father Garrigou-Lagrange does in a chapter by that name (I, 299), the remainder is left to the individual conscience', even in the Spiritual Exercises, since of its five acts in this matter two are a preface, two an epilogue of prayers. Again in the case of mental prayer, concrete details appeal to Father Ellard as the source of certitude. As a mat-ter of fact, the opposite is true. The more particularized is the treat-ment, the more it is subject to doubt. The devious details of these devices for praying, whose security for some is largely in their famili-arity, are better consciously omitted by anyone who writes with the "certitude of the great directive principles of all spirituality" (cf. p. 311). The method of The Three Ages, moreover, cannot rather "stress theory than practice" (p. 302) if its principal excellence is "its inspiratio:lal value," and if "a reader feels his heart warmed and his enthusiasm enkindled" (p. 301). It can scarcely be labeled as more given to "metaphysics than psychology" (p. 302) when the author keeps reminding his readers of the grand dogmas of Christianity, their "infinite elevation," their implications for our "affective and practical lives" (p. 301). WORDS AT WORK FOR THE WISE For the wise, who are so either by industry in theology or by 89 DOMINIC HUGHES infusion .with God's love, a word of conclusion is sufficient. A wise word may not have rhetorical flair, but it cannot be faltering or fal-lacious. As an expression of the judgment of the "highest causes" with the "greatest certitude" and other things in an orderly manner, it is not an assembly of facts, but an appraisal of values. The relative values of both content and method between what Father Garrigou-Lagrange and Father Ellard offer for its appraisal leave wisdom no doubt whatever. In points of doctrine Father Ellard seems to be without the solid foundation of a man whos~ theological industry has made him wise. Despite his erudition-- sometimes amid the most trivial sources-~-his analysis lacks pro-fundity. Its practicality, too, since it fails in its calculated effect, is open to question. In the face" of an artificially imposed order, Father Ellard's thoughts ramble and lose themselves in details. When his conclusions are declarative, they waver over a "whatever" (p. 314) or a "whether or not" (p. 316), and when they are an interrogative they are most uncertain. His precision in labelling the doctrines of others he suddenly loses when he lets "Catholic" and "Church" slip into sentences containing ideas he favors (p. 302). All of this gives his article the appearance of a somewhat gauche polemic rather than of a sincere and solicitous appraisal. On the other hand, the mag-nificent proportions of The Three Ages are not often met with in contemporary spiritual writing. Because it presents so well the "great dogmas of Christianity" as well as "their implications for our affective and practical lives," each reader feels his "heart warmed and his enthusiasm enkindled for these great truths" (p. 301). Wisdom's final word concerning the providential purpose of this and other discordant notes in the harmony of the teachings in the Church on the interior life is after the Model of Wisdom Him-self. When the Apostles saw the man born blind, they balanced-- unknowingl~, perhaps--one rabbinical opinion against another: "this man or his parents?" They were forced to suspend judgment, because seeing only alternatives and not an order to a Highest Cause, they remained uncertain. When they appealed to Christ, He gave them an answer many rabbis would not have considered scientific or satisfying "in terms of human experience."" Yet it was sublime and secure. Wisdom Himself replied to the Apostles, and reassures all in the present instance: supernatural security and salvation are accom-plished through suffering and the triumph of wisdom--"because the works of God were to be made manifest . " (John 9:3). 90 March, 1950 FATHER ELLARD'S REPLY FATHER ELLARD'S REPLY In his inspiring introductory remarks on wisdom Father Hughes proposes a restricted, relative, and special sense of "certain." " If'we accept that, th~n really there hardly seems to be any necessity of my saying more. He' has virtually conceded the great cardinal point of my whole criticism, namely, that Father Garrigou-Lagrange's doc-trine on the gifts and the corresponding thesis on infused ~ontempla-tion insofar.as this depends on that doctrine, are not, in the plain and ordinary sense of the term, certain. Certaint~ , in this sense, espe-cially when predicated of a doctrine that is theological and specu-lative, is opposed not only to probability, bfit even to greater prob-ablity. Similarly, if the langu.age of The Three Ages is to be under-stood as expressing doctrine t~at is certain only in a limited and relative sense, I. was deceived, and my labor was in vain. Perhaps also some other readers will be misled too. It seems sufficient, therefore, to notice 'very briefly only what in Father Hughes's reply is most relevant to my four principal criti-cisms, and not to say more about certain matters in which he' has mistaken my meaning. Nor shall I advert further to several expres-. sions suggestive of what I would disclaim. Those four contentions were: "'The Three Ages is theoretical rather 'than practical; it is one-sided and narrow; an essential part of it, namely, its doctrine of the gifts of the Holy Spirit, is uncertain; and its main thesis is not after all really so significant" (p. 302). I shall follow the order in which Father Hughes deals with them. First, the gifts. As a simple and practical way of ending this ¯ particular argument, I will give to Father Hughes, if he wishes, a list of all the leading theologians of the twentieth century with their works and the appropriate references to what they teach on the giftsl Then he can see at once in black and white whether Catholic theo-logians agree in proposing as certain, in the usual sense, any such elaborate theory of them as that in The Three Ages. These theo-logians will embody, in varying degrees and ways of course, the present mind of the Church; they will be quite conversant with the altogether unique authority of St. Thomas, and they will be aware also of whatever else is pertinent. In [hem, considered adequately and properly, not merely arithmetically, will be found accumulated Catholic theological wisdom in its most mature and authoritative form. When the theologians, who are the most competent to judge in a question of this kind, are as greatly divided and as uncertain as 91 FATHER ELLARD'8 REPLY Review for Religious they actually are, on what evidence could particular persons come to certain knowledge in the matter? Possibly they can; but indeed it seems most unlikely. When the authorities disagree or "are not posi-tive, it would seem wise for individual persons to suspend judgment. If, as Father Hughes seems to agree, the two Thomistic doctrines on the efficacy of grace and the nature of the gifts stand or fall together, then most emphatically are theologians divided. As for the Doctors' of the. Church, the Augustinians claimed St. Augustine for their view on grace; and both Dominicans and Jesuits appealed to St. Augustine and St. Thomas. "Among the more modern Doctors, St. Alphonsus de' Liguori is cited for a modified version of the Augustinian theory; and St. Robert Bellarmine for the Jesuits. According to Von Pastor, St. Francis de Sales declared, in a memo-randum written for Pope Paul V, "that on the whole he shared the view of the Jesuits; and he added that he had made an exhaustive study of the subject, and that he saw considerable difficulties in either opinion, He did not think the time had come for deciding a question on which so many able scholars were unable to agree." (History oF the Popes, XXV, 240.) These facts concerning the controversy on grace are given, not with any intention of arguing such a matter in these pages, but simply to show that, if Father Garrigou-Lagrange's teaching on the gifts is logically involved in this highly disputed sub-ject, surely it cannot be called certain. Father Hughes writes: "Many Dominican theologians are cited as recognizing a controversy upon the matter [of the gifts], but the conclusions of each do not seem worthyof mention by Father Ellard" (p. 82). In the writings referred to I have not noticed any con-clusions contradictory either to the statements quoted from them or to the proposition in substantiation of which the citations were made. If Father Hughes should point out any such conclusion, I shall be glad to acknowledge it. Of course the same five theologians can be quoted in favor of the Thomistic theory of the gifts, and two of them for the certainty of it, for example, Gardeil in th~ Dictionnaire de Theolo~Tie, IV-2, 1776, 1777, and Garrigou-Lagrange himself, in PerFection Chretienne et Contemplation, II, [88-91]; neverthe-less, they witness the fact of disagreement among theologians and admit that others do not share their own view. Secondly, I said of The Three Aoes that it is one-sided and nar-row. Father Hughes replies that it is in accord, if not with lesser lights, at least with St. John of the Cross, the great and ultimate 92 March, 1950 FATHER ELLARD'S REPLY (relative) norm in this matter. But the same agreement is claimed by other authors also, among them tw6 Carmelite spokesmen. In other words, there is more than one interpretation of St. John among orthodox Catholics. ."But Father Garrigou-Lagrange has the right one." Perhaps he has; but we might be better, convinced if he would give us a chance to judge for ourselves. Could he not at least give us fair notice of dissenting opinions?. A fresh sample of div.ergenc~ is furnished by Father Gabriel of St. Mar.y Magdalen in his new book, St. Teresa o~: desus. Although he writes, "'For all that, it can be shown in fact that this teaching of the Teresian school is not irreconcilable with the modern Thomist synthesis of the spiritual life" (p. 44), yet repeatedly throughout - the book he contradicts Father Garrigou-Lagrange on the necessity of infused contemplation. The first point in my criticism reads: "'Tile Three Ages is theo-retical rather than practical." Of all, this was the least important, especially as instruction and inspiration are also in their own way most practical. Father Hughes objects: "The method of The Three Ages cannot rather 'stress theory than practice' if its principal excel-lence is 'its inspirational value,' and if 'a reader feels his heart warmed and his enthusiasm enkindled.' " Why not? In this respect the work resembles treatises on dogmatic theology which are preoccu-pied with doctrine rather than practice and which can at least be bigh.~y inspiring. Again my critic writes: The book "can scarcely be labeled as more given to 'metaphysics than psychology' when the author keeps reminding his readers of the grand" dogmas of Christianity, their 'infinite elevation,' their implications for our 'affective and practical lives.' " The answer is. simple. When a book contains dogmatic, metaphysical, and psychological elements, why cannot it accentuate them in just that order? As a matter of fact, The Three Ages does. I cannot imagine how Father Hughes can say: "In the case of mental prayer, concrete details appeal to Father Ellard as the source of certitude." My final contention was that the main thesis of The Three A~Tes, namely, that infused contemplation comes within the normal devel-opment of the interior life, is not after all very significant. It would be pregnant with meaning and significance if according to the mind of its author it were intended to im'ply that mystical contemplation in the full and obvious sense as described by St. Teresa in The 93 FATHER ELLARD'S REPLY Review/or Religious Interior Castle is normally to be expected. St. Teresa's terminology is used and one anticipates sbmething very wonderful. But then one finds out that only "what is essential" is promised us, and that seems much less indeed. Such language is surely apt to deceive the less wary. On this point, the climax of everything, Father Hughes has sur-prisingly little. I was careful not to deny the thesis of the nor-mality of mystical contemplation, or the unity of the interior life, or even to call them in question, except insofar as the thesis is pre-sented as a corollary from the theory of the gifts. Of course I am not suggesting that the tiniest bit of infused con-templation is not a most precious grace. It is, by all means. Rather, the question is whether the mysticism which Father Garrigou- Lagra~nge holds out in prospect for us is the same as the substantive sublime graces depicted in St. Teresa's Mansions and in St. 3ohn's Spiritual Canticle and The Living Flame. It seems highly fitting that I should add a word on two personal references that some readers will resent. I used a quotation in which Scotus was called '~the Subtle Doctor." There appears to be no reason for the depreciatory language which my critic uses. Scotus was one of the most influential of all Scholastic philosophers and theologians; for centuries innumerable times he has been referred to as "the Subtle Doctor" in more or less the same way that St. Thomas is termed "the Angelic Doctor." There was no suggestion at all that he is a Doctor of the Church; yet he is great enough to have been the theologian to whom above all others under the providence of God the Church owes the dogma of the Immaculate Conception. Likewise it seems inexplicable that Poulain, the author of The Graces of Interior Prayer, A Treatise on Mystical Theology, should be referred to with these words: "apparently not a theologian, how-ever proficient a psychologist" (p. 89). True, Poulain was not a dogmatic theologian, and his design in writing on mystical the-ology was different from that of Father Garrigou-Lagrange, but his work is in certain respects, especially for an account of the facts of mysticism and for practical help in direction, of first-class worth and thus far unsurpassed. To conclude: if I am right in taking Father Hughes to mean that the doctrine of the gifts is to be considered certain only in a relative and limited sense, and not with the obvious and proper force of that term, then on the'chief point we are in agreement. If not, I would 94 March, 19 5 0 COMMUNICATIONS say to readers who have followed this criticism 'and countercriticism, especially if they have actually read The Three Ages, andpr.eferably against the background of Saints Teresa and 3ohn of the Cross: "I speak to men of reflection; judge for yourselves of what I say" (I Cor. 10:lS).--G. AUGUSTINE ELLARD, S.J. ommun{caldons Reverend Fathers: A few years ago in an issue of Emmanuel the reviewer of one of the books of Father Garrigou-Lagrange expressed his doubt of the truth of the characteristic doctrines of that eminent theologian, at the same time stating his hope that a more thorough criticism would be made in a lengthier review. That same doubt and hope have been felt by many who read Christian Perfection and Contemplation and The Three Ages of the Interior Life. In those works the views of the author on some points of dogmatic and of mystical theology were stated in such a way that the reader if not versed in these matters would conclude that these particular views are not seriously disputed by competent Catholic theologians. But they are disputed, and to bring out this fact, as Father Ellard has done in his review of The Three Ages of the Interior Life in your November, 1949, issue, is to render a real service to the reader of these valuable spiritual books. The truth that some of Father (3arrigou-Lagrange's theories are disputed, and are not part of Cath-olic doctrine nor the unanimous opinions of theologians will not hurt anyone. Veritas vos liberabit. In emphasizing the disputed character of .these opinions of the gifted.writer, it is not intended in any way, I am sure, to imply that he has deliberately misled his readers. But Father Garrigou-Lagrange has led the majo.r portion of his life in the midst of skilled theo-logians. He naturally and unconsciously keeps them in mind as he writes. Yet what he writes is being read by many who are n~;t versed in even the fundamentals of theology and who consequently may easily be misle.d by his statement, of his positions. For the general public a clearer statement of what is general Catholic doctrine and what. is not, is certainly desirable. May I add a personal note? After some experience in directing 95 SUMMER SESSIONS ReVietO [or Religi,,os souls who have undoubtedly received the gift of infused contempla-tion, I find it difficult.to believe that Father Garrigou-Lagrange has any real concept, of infused contemplation at all. Everything he writes leads me to believe that he is really thinking and speaking of that prayer which is variously called "acquired contemplation," "the prayer of ~implicity," etc. There is an essential distinction between this simplification of discursive prayer and infused contemplation; and that distinction, I believe, cannot be understood merely from ¯ reading the works of mystical writers or theologians. I thoroughly agree with the Benedictine' who said 'that "the conception that St. John of the Cross had of mysticism and contemplation entirely escaped" the gifted author of Tile Three Ages. No harm can come from giving testimony to the inexactitude of Father Garrigou-Lagrange's distinction between Catholic doctrine and the theories of certain theologians; nor to the incorrectness of his understanding of the fundamental nature of infused contempla-tion.-- A SECULAR PRIEST. [EDITORS' NOTE: Further communications concerning Father Ellard's appraisal.of The Three Ages will be acgepted. These communications should be kept as brief as the subject-matter permits. If at all possible, they should be neatly typed, double-spaced, with generous margin. The sender should sign his name; and the name will be printed unless the content is of a personal nature.] SUMMER SESSION The Plus X School of Liturgical Music, founded by the late Mother Georgia Stevens, will conduct its Thirty-Fourth Summer Session: June 29-Augtist 10. Registration is open to men and women, whether as students matriculated for the B.A. or B.Mus., degrees, or as non-matriculated students; resident and non-resident. Courses will be offered in Gregorian Chant, Gregorian Accompaniment, Con-ducting, Polyphony, Liturgical Singing, Vocal Production, History of Music, Keyboard Harmony,. Music Education, Counterpoint, .etc. Members of the Staff have been long trained in the traditions of Solesmes and have national and international pedagogical experience and recognition. Private lessons in organ, piano, and singing may be procured. Membership is held by the School in the National Association of Schools of Music and it enjoys the official approval of the most eminent music organizations. According to a long-established custom there will be lectures by prominent musicologists and the usual s, eries of weekly concerts. Students will be given the opportunity of~active particip.ation in the Liturgy by the congrega- 96 March, 1950 BOOK REVIEWS tional singing of Holy Mass, Vespers, Compline, and Benediction. The Very Reverend Monsignor Frederic Teller, D.D., Ph.D.,C.G.M. will teach some courses. The Ve.ry Reverend Monsignor Martin B. Hellriegel, of the Church of the Holy Cross, St. Louis, Mo., and the Reverend 3ohn 3. Dougherty, S.T.L.,S.S.D. of the Immaculate Con-ception Seminary, D~rlington, N. 3, will give daily lectures on the Liturgy throughout the Session. For further information write to: Mother Aileen Cohalan, Director, Manhattanville College of the Sacred Heart, New York 27, New York. Book Reviews THE MOTHER OF THE SAVIOR AND OUR INTERIOR LIFE. By Reginald Garrigou-Lagrange, O.P. Translated by Bernard J. Kelly, C.S.Sp. Pp. 338. B. Herder Book C;o., St. Lou~s, M~ssourL $4.00. The theological and d~votional literature about the Blessed Virgin is so extensive that .a new synthesis by a capable author is highly welcome: Father Garrigou-Eagrange published such a syn-thesis in 1941 (reprinted in 1948). The present translation from thd French makes his book available for the la.rge number of readers who have come to value his works in English versions. The book is divided into two parts. The first part, on "The Divine Maternity and the Plenitude of Grace," is doctrinal. It aims at imparting knowledge about Our Lady and her unique position, in subordination to her divine Son, at the very summit of creation and the supernatural order. The pre-eminence of the divine mater-nity, which dominates all Mariology as the source and end of all Mary's great gifts, is very clearly brought out. Here and there a line of reasoning is pursued that is not very convincing: but strictly theo-logical procedures are hardly to be expected in a work that is more devotional in spirit than scientific. The second part, on "Mary, Mother of all Men: Her Universal Mediation and our Interior Life," demonstrates Mary's activity in the plan of redemption and the important causality she exercises in our salvation and sanctification. In view of the character of the volume, the author has wisely refrained from entering into the contemporary debate among theo-logians on the precise meaning and function of Mary as co-redemp- 97 BOOK R~VlEWS Review [or Religious trix, contenting himself with general expressions that should prove acceptable to all parties in the controversy. The main source for the theological presentation is Merkelbach's well-known Mariologia. But the Fathers, the great Scholastics and their later successors, spiritual writers, orators, and Popes are called upon to yield up their treasures. Many gems have been contributed by Saints Ambrose, Sophronius, Andrew of Crete, Ephrem, and Peter Damien. Saints Bernard, Albert the Great, Bonaventure, Thomas Aquinas, Alphonsus, Grignon de Montfort, and Francis de Sales have all offered their riches. Suarez, Terrien, Dublanchy, le Bachelet, and Hugon have generously thrown open their books. And these great names represent but a sampling of the numerous sources consulted and utilized. The encyclicals of Popes Leo XIII, Pius X, Benedict XV, and Plus XI manifest the mind of the Church on recent Mariological doctrine. The Polish Dominican, Justin of Mi~chow, provides the inspiration for one of the finest chapters in the book, "Special Aspects of Mary's Queenship." The article on the Rosary sheds fresh light on that welt-loved devotion, and sug-gests a way of practicing it that will be profitable to all Catholics. The translator has done his part admirably. Comparison with the French edition shows how faithful Father Kelly has been to the orig!nal. If we did not know that the English edition is a transla-tion, we could hardly guess that fact from reading the book. And that is the supreme criterion of the translator's success. CYRIL VOLLERT, S.J. IGNATIAN METHODS OF PRAYER. By Alexandre Brou, S.J. Translated by William J. Young, S.J. Pp. xl ~ 203. The Bruce Publishing Com-pany, Milwaukee, Wisconsin, 1949. $3.00. The aim of this book is very clearly stated by the author when he tells us that he set out to discover "what exactly did St. Ignatius want to say, and what did he say" on the subject of prayer. The word "discover" is used purposely, for the many commentators on St. Ignatius have not always clarified his thought nor passed it on unadulterated to their readers. Father Brou observes: "Now it some-times happens that with'the best intentions in the World his thought has been misunderstood. Authors . . . have viewed the teachings of the Saint through a mist of commentary, and a commentator never fails to add something to his text" (p. vii). Father Brou gdes back to sdurces, the text of the Spiritual Exer-cises, and he interprets them in the light of Stl Ignatius' personal March, 1950 BOOK REVIEWS letters, supplementing his findings with. the writings of intimate con-temporaries of the Saint--St. Francis Xavier, Blessed Peter Faber, Father Nadal--to mention but three. The work is divided into four main divisions. In the first St. Ignatius' teaching on prayer and the interior life, the ,relation of prayer to the apostolate, seeking God in all things, the presence of God, and finally mystical prayer are treated. The second and third parts are devoted to the preparations for prayer and the so-called methods of prayer respectively, while the fourth part treats the coun-sels for the time during and after prayer, and tl~e rules for the dis-cernment of spirits. Two features of the teachin'g of.St. Ignatius as presented in this book are noteworthy. First is the continuity ot: practically every portion of the Ignatian teaching with a tradition of Catholic spirit-uality which he both inherited and developed into the forms found in the Exercises. The other is what we might call the compatibility of high prayer with the active life of the apostolate. Great mystic ¯ that he was, SI~. Ignatius was eminently a man of the active aposto-late, what we would call nowadays a man of affairs. He conceived the man of affairs as a man of prayer, and a life of prayer as not at all incompatible with a full daily schedule. "To St. Francis Borgia he asserts that it is more perfect to be able to find God everywhere and in all things than to have need of an oratory and long prayers to enter into union with Him" (p. 39). The book combines the excellent qualities of thoroughness and brevity. It can be r~ad and reread with profit.--T. L. McNAIR, S.J. LITTLE CATECHISM OF PRAYER. By Father Gabr;el of St. Mary Mag-dalen, O.C.D. Transla÷ed by ÷he Discalced Carmelite Nuns. Pp. 44. Monastery of Discalced Carmelites, Concord, New Hampshire, 1949. $.2S (paper). People in general who cultivate mental prayer and v.ery particu-larly all those who would like to practice it in the spirit and after the manner of the Carmelites, traditional leaders in matters of the contemplative life, will welcome this Little Catechism. In six chap-ters and eighty-nine questions it introduces one to "prayer in the contemplative life," "the methbd of mental prayer," "preparation and reading," "meditation and colloquy," "difficulties in prayer," and "the presence of God." There is nothing theoretical or learned or meticulously precise about it. Evidently it is meant, as its title suggests, to be a simple and practical primer. On the other hand 99 BOOK NOTICES Review for Religious there "are thoughts in it which would be helpful and inspiring, I should say, to almost anyone, even tb contemplatives far advanced in the ways of prayer and sanctity. For instance, from the very first page one might learn this distinction between the Christian life and the contemplative life: the good Christian "lives /:or God," whereas the contemplative soul "lives not only for God, but also with God." Likewise it is emphasized at the very beginning in a quotation from St. Teresa that to reach the higher degrees of prayer one must per-force add the practice of mortification, "because prayer and comfort do not go together."--G. AUGUSTINE ELLARD, S.,J. BOOK NOTICES BLESSED MARIA GORETTI: Martyr for Purity, by 3ohn Cart, C.SS.R., is an admirable life of the twentieth-century martyr whom the Holy Father intends to canonize in the course of the present holy year. Blessed Maria sets an ideal before modern youth who live in an atmosphere so perilous to purity. (Dublin: Clonmore ~ Reynolds, Ltd., 1949. Pp. 70. 3/6.) Father Louis I. Fanfani, O.P., an outstanding modern canonist, has published a third edition of DE IURE RELIGIOSORUM. While keeping all the good qualities of previous editions, the book has been brought up to date and considerably increased in volume. A separate chapter is devoted to the newly established Secular Institutes. Four important documents are added by way of appendices: I. The new Norrnae of 1921; II. Letter of the Sacred Congregation of. Religious of 1931 on the formation and training of religi6us for sacred orders; III. Instruction on the enclosure of nuns with solemn vows issued in 1924; and, IV. The Statutes for Extert~ Sisters of monasteries of nuns, approved by Pope Pius XI in 1929 an'd published by the Sacred Congregation of Religious two years later. These documents are given in the original Latin text. (Rovigo, Italy: .Istituto Padano di Arti Grafiche, 1949. Pp. xxxi + 810. L. 2000.) OUR ETERNAL VOCATION, written anonymously by a Carmelite nun in England, is intended for all, priests, religious, or laity, who are interested in attaining higher sanctity. Of its three main sections, the first treats of sanctity in gener.al, its meaning, its instruments, its fruits (pp. 9-135). The second is concerned with religious voca-tion in particular (pp. 135-177). The last tells about the sanctity and mission of St. Therese of Lisieux (pp. 177-207). The doctrine seems to be solid throughout and Jr'is presented palatably by a crisp style tinged With feeling and garnished with 100 March, 195 0 BOOK ANNOUNCEMENTS striking illustrations. The book contains some shrewd psychology on the value of sincerity in attaining holiness, on methods of over-coming mental depression, on the natural requisites for a religious vocation. As might be expected, the author emphasizes the "Iittle way" of St. Therese, but she does not derogate from other methods of acquiring sanctity. (Westminster, Maryland: The Newman Press, 1949. Pp. 207, $2.25.) BOOK ANNOUNCEMENTS [These notices are purely descriptive, based on a cursory examination of the books listed. Some of the books will be reviewed or will be given longer notices later. The list is complete up to Feb. 10.] CARMELITE THIRD'ORDER PRESS, 6427 Woodlawn Avenue, Chi-. cago 37. Take This Scapulart. By Carmelite Fathers and Tertiaries. Pp. 270. $2.50. Unfolds the story of Our Lady's Scapular. FRANCISCAN HERALD PRESS, 1434 W. 51st Street, Chicago. Tertiar~ Office of the Parers. Pp. 103. $.50 (30% discount for orders of 25 or more). A vest-pocket booklet of aids in reciting the office prepared especially for members of the Third Order of St. Francis. Also contains the Seraphic Office, the Office of the Pas-sion, and the Franciscan Tertiary Office with reflections. M. H. GILL ~ SON, Ltd., 50 Upper O'Connell Street, Dublin. Fair as the Moon. By Father M. Oliver, O.Cist.R. Pp. xi -b 235. 12s. 6d. A portrait of Mary, the Mother of God and "Purest of Creatures." Catherine McAule~I: The First Sister of Mercy. Pp. x ÷ 434. 15/-. "This book, the fruit of considerable research, is based largely on hitherto unpublished document's, and throws fresh light on Cath-erine McAuley's life and work." [5. HERDER BOOK COMPANY, St. Louis 2, Missouri. Ps~/cbiatq/and Asceticism. By Felix D. Duffey, C.S.C. Pp. 132. $2.00. True Stories for First Communicants. Pp. 80. $1.25. First Communion Davis. Pp. 96. $1.25. Both by a Sister of Notre Dame. True stories which should help children in preparing for their first Communion and after. The books were first printed in 1919 and 1920 respectively. The Life of Our Lord Jesus Christ. Two volumes. By Maurice 101 BOOK ANNOUNCEMENTS for Religiou* Meschler, S.J. Pp. xxii q-- 545 arid viii -b 551. $12.00 (set). Translated by Sister Mary Margaret, O.S.B. This is the fifth edi-tion of the author's well-known meditations on the life of Christ. LEMOYNE COLLEGE PRESS, LeMoyne Heights, Syracuse 3, New York. Inigo de Logola. By Pedro Leturia, S.J. Pp. xiii + 209. $4.50. The story of the early life of St. Ignatius up to and including his conversion. LIBRERIA FRANCESCO FERRARI, Via dei Cestari, 2, Kome, Italy. Manuale Tbeorico-Practicurn Tbeologiae Moralis ad Mentern D. Thomae. By Father Louis J. Fanfani, O.P. Pp. xix + 648. This is the first of a set of three volumes. It treats of man's last end, human acts, laws, conscience, the virtues, sins, and censures. It is planned to complete the set within the course of the year. LITURGICAL PRESS, St. John's Abbey, Collegeville, Minnesota. Life. and Miracles of St. Benedict. By Pope St. Gregory the Great. Translated by Odo J. Zimmermann, O.S.B., and Benedict R.Avery, O.S.B. Pp. xv q- 87. $2.00 (cloth); $.90 (paper). A translation of Book Two of the Dialogues of St. GregorY. MCLAUGHLIN ~ REILLY, 45 Franklin Street, Boston 10. When the People Sang. By Marie Pierik. Pp. 32. $.50 (paper). "A simple treatise on the Gregorian Chant, its history and use." NEWMAN PRESS, Westminster, Maryland. Treatise on Prager and Meditation. By St. Peter of Alcantara. Translated by Dominic Devas, O.F.M. Pp. xx ÷ 211. $2.50. Besides this classic treatise on prayer, the book contains an introdtic-tion and sketch of the saint's life and a complete English version of Pax Anirnae, a treatise formerly attributed to the saint. The Spiritual Life of the Priest. By M. Eugene Boylan, O.C.R. Pp. 161. $2.50. A reprint of a series of articles which first appeared in the pages of The Priest. The Holg Year of Jubilee. By Herbert Thurston, S.J. Pp. xxiv -[- 420. $4.25. An account of the history and ceremonial of the Roman jubilee. Contains many illustrations. First printed in 1900. The Wag of Divine Love. Pp. xxxvii q- 532. $4.25. A com-plete account of the revelations of the Sacred Heart as made to Sister Josefa Menendez, Coadjutrix Sister of the Society of the Sacred Heart of Jesus. There is also a short biography of the Sister and an analytical index. 102 March, 1950 BOOK ANNOUNCEMENTS Purgatorg and the Means to AvoidIt. By Martin Jugie, A.A. Pp. 203. $3.25. A doctrinal and devotional treatment of a subject that is of interest to all. The book is translated from the seventh French edition by Malachy Gerard Carroll. The Life and Revelations of Saint Gertrude: Virgin and Abbess, of the Order of St. Benedict. Pp. xlv + 570. $4.00. A reprinting of an old favorite which first appeared some eighty years ago. Prager for All Times. By Pierre Charles, S.J. Translated by Maud Monahan. Foreword by C. C. Martindale, S.J. Pp. 328. $3,50. A book on prayer designed "to mak~ smooth the ways of the spirit and to unfold the eternal message of the nearness of God." Little Catechism of the Act of Oblation of St. Th~r~se of the Child Jesus. By the Carmelites of Lisieux. Translated by Rev. Mi-chael Collins, A.M. Pp. 22. $.25. PROVINCE OF ST. JOSEPH OF THE CAPUCHIN ORDER, 1740 Mt. EI-liott Avenue, Detroit, Michigan. Meditations: Volume I: Advent to Ash Wednesday. By Bernar-dine Goebel, O.F.M.Cap. Translated from the German by Berch- "mans Bittle, O.F.M.Cap. Pp. 537. $3.50 (paper). ST. CATHARINE JUNIOR COLLEGE LIBRARY, St. Catharine, Ken-tucky. The Catholic Booklist 1950. Edited by Sister SteIla Marls, O.P., for the Catholic Library Association. Pp. 74. $.65 (paper). "An annotated bibliography, for the most part Catholic in authorship or subject matter, chosen as a guide to the recreational and instructional reading of Catholics." UNIVERSITY OF NOTRE DAME PRESS, Notre Dame, Indiana. The Christfan Vfrtues. By Charles E. Sheedy, C.S.C. Pp. xi q- 361. $3.00. A book on moral theology for college students and lay readers. God and the World of Man. By Theodore M. Hesburgh, C.S.C. Pp. viii -}- 318. $3.00. A theological text for the layman. Treat-ises on faith, God, the Trinity, creation, the elevation and fall of .man, the end of the world and man. JOSEPH F. WAGNER, INC., 53 Park Place, New York 7. --Must It be Communism? By Augustine J. Osgniach, O.S.B. Pp. x -]- 486. A philosophical inquiry into the major issues of today. The last three chapters are by Jerome L. Toner, O.S.B. 103 .uestdons and Answers We have an application from a woman who has obtained a permanent separation from her husband and now wishes to try out the religious llfe. Creusen, ReBgious Men and H/omen ~n the Code, p. 135, states: "A wife abandoned by her husband., does not need his consent to enter, rell-gion. One may see in R.C.R., 1939, under what conditions her entry into religion may be obtained." Please tell us what R.C.R. stands for, and, if convenient, give us a summary of the conditions referred to. R.C.R. refers to a review for religious published in Belgium by Father Creusen and his associates under the title Reoue des Commun-autos Religieuses (53 rue Royale, Brussels, Belgium). Here is a sum-mary of what Father Creusen wrote in the answer referred to. (1) The aspirant must not have been in any way the gravely culpable cause of the separation. (2) There must be moral certitude that she cannot be forced legally to abandon the religious life in order to resume married life. A civil divorce is the best guarantee. (For this the bishop's permission should be obtained.) (3) If the appli-cant has children, their care and support will have to be guar~inteed. (4) The superior of an institute or monastery who is willing to accept her on trial must be convinced that she has an extraordinary vocation and that there are particular reasons to anticipate her perse-verance. If all these conditions are fulfilled, the person in question may appeal to the Holy See for the necessary dispensation. She should do so personally. To this personal appeal a letter of recommenda-tion from her bishop should be added. This recommendation should be given at least regarding the good character of the person, even though the bishop does not wish to support her application for the dispensation. Finally, a letter from the religious superior who is willing to accept the candidate, stating that she believes the applicant to have an extraordinary vocation and that the community is willing to receive her on trial, will complete the official documents required. A baptismal certificate of the applicant and a copy of the decree of civil divorce ~hould be sent along with the other documents. Father Creusen concludes his answer with the following para-graph: "It must be added that the Holy See shows itself very prudent and very reserved in granting this dispensation. The utmost good will in the beginning is far, it seems, from guaranteeing perseverance 104 QuEs-r~o~s ~no ANswrRs in vocations of this kind. It is useless to encourage the application without exceptional reasons." Canon law cjrants to superiors the rlgttf #o extend: (I) the posfulancy, but not beyond six months (canon 539, § 2); (2) the time of the novif~ofe, but not beyond six months {canon 571, § 2); (3~ the period of temporary vows, but

PI'S RELIGIOSITY IN YANN MARTEL'S LIFE OF PI Yektiningtias English Literature, Art and Language Faculty, State University of Surabaya yektiningtias@gmail.com Drs. Much. Khoiri, M.Si English Literature, Art and Language Faculty, State University of Surabaya Much_choiri@yahoo.com Abstrak Agama merupakan istitusi mengenai ketuhanan. Agama berisi sekumpulan pengertian dan kebiasaan yang mengacu pada individu. Individu tersebut adalah individu yang religius, pernah religius, atau bisa jadi religius. Partisipasi dalam suatu hal yang berbau religius didefinisikan sebagai religiusitas. Individu yang memiliki religiusitas tidak berarti mereka menganut sebuah agama. Selagi mereka melakukan hal hal yang sebuah agama perintahkan terhadap para pengikutnya, seperti percaya kepada Tuhan, mencintai ciptaan Tuhan, dan melakukan tindakan religius, individu tersebut dapat dikatakan religius. Life of Pi, sebuah novel karya Yann Martel, menggambarkan religiusitas seorang anak laki –laki, Piscine Molitor Patel atau Pi. Sejalan dengan hal tersebut, tujuan dari pernelitian ini adalah untuk menggambarkan religiusitas dari Pi dalam hidupnya dan mengungkapkan faktor-faktor yang mempengaruhi religiusitas tersebut. Metode analisis secara tidak langsung berdasarkan teori psikologi remaja karya Frederick Tracy karena sebagian besar novel tersebut menyuguhkan kehidupan Pi ketika dia masih dalam masa remaja. Hasil penelitian menunjukkan bahwa Pi telah memenuhi tiga komponen religiusitas-keyakinan, perasaan, dan tindakan. Terlebih, ada lima faktor yang mempengaruhi religiusitas Pi. Faktor tersebut adalah pengaruh keluarga, pengaruh pekerja professional, kebutuhan, ketertarikan, dan rasionalitas. Kata kunci: agama, religiusitas, komponen religiusitas, remaja Abstract Religion is the institution of godness. It contains a set of meaning and behavior referring to individuals. The individuals are religious, were religious, or could be religious. The participation in religious things is defined as religiosity. Individuals who have religiosity do not mean they commit to a religion. As long as they do what a religion tells its followers to do, like believing God, loving God's creation, and doing religious action, the individuals are considered religious. Life of Pi, a novel by Yann Martel, depicts the religiosity of a boy, Piscine Molitor Patel or Pi. In line with that, the purpose of this study is to depict religiosity of Pi in his life and reveal the factors that influence it. The method of the analysis indirectly works mostly based on Frederick Tracy's psychology of adolescence theory because mostly the novel presents the life of Pi when he is in adolescent period. The result of this study shows that Pi has fulfilled three components of religiosity—knowing, feeling, and doing. Moreover, there are five factors that influence Pi's religiosity. They are family's influence, professional workers' influence, needs, interest, and rationality. Keywords: religion, religiosity, component of religiosity, adolescence INTRODUCTION Fiction, by its definition, is describing imaginary events and people. The contents of a prose literature which are included in fiction are drawn from imagination that shows creativity or original thought. An unrealistic plot like a boy who flies by a broom, talking animals, aliens, or monsters that attacks the earth often cause delusion. Thus, an author puts truths to make the work more realistic although as the mentality history, a work of art can be a manifestation of reality, critic of reality, and alternative thought of reality (Supaat, 2008: v). A modern literature has a notion that art or literature is a matter of creativity. Often the creativity is bounded with the legalistic and formalistic doctrines of religion. Thus Western societies put the religion aside from their literature. The literature is free and free from religious matters. On the contrary Y.B Mangunwijaya in Supaat (2004: 175) stated that basically all literatures are religious. T.S Elliot in Supaat (2004: 166) added that the value of literature must be seen from the ethic and religiousness. If there is an idea or agreement of a society of a religious ethic so the literature must be 'good' like the religious ethic. Religion within a fiction is based on religious ideas from the real world. The religious ideas can be included into a fictional prose because basically fictional characters are imaginary. Although the characters are made up, they still have people's same willingness, needs, and drives in the real world. What people do in real world includes seeking religious understandings. (http://altreligion. about.com/od/artandculture/a/Religion-And-Fiction.htm retrieved on March 7th 2013). Based on the explanation, art works often raises religious issues to make the story becomes more real. The issues contain the truths from real religious ideas. The authors put more understanding to the issues from the facts. A character seeks for religious understanding for some reasons. The character may find peace and satisfied feeling towards his or her life in religion. Although religion is a term for conceivable religions whether formal or informal (Ferm, 1959: 647) a character does not always practice what a particular religion that he or she commits' rules. A satisfaction is found deep inside a feeling. Because it is related to feeling, it can be related to religiosity. Stolz (2009: 347) defines religiosity as what an individual chooses, feels, believes, and acts that refer to a religion that already exists or to a self-made religion. Religion itself is a cultural symbol-system that responds to problems and possibilities that are related to a very important reality. This system influences everyday life and cannot be controlled directly. Stolz continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god while the religious symbol-system or religions are like Christianity and Islam (Stolz, 2009: 347). An author may put his understanding about religious things to his works. 'Literature going behind God' is an effort of a man in letter by his works in which nuances in religious with his total comprehension of faith , so that he could comprehend fully of his seeking of God, his Creator, and literature is a dynamic, productive, and creative media (Supaat, 2004: 176). Yann Martel puts his idea of religion and religious things into his fictional work, Life of Pi. "Pi is interested in religions: so am I. Pi is open to all faiths: so am I. Pi is comfortable in different Godhouses: so am I. There is a sociocultural component to religions. Just as there are different ways of feeding the body, there are different ways of feeding the soul. Each religion is one group of people's attempt to understand ultimate reality. I think in each one there is a portion of truth and a portion of error. So I see in all great religions the same frame of being, only seen from a different perspective." (http://abcnews.go.com/GMA/Books/story?id=124838&page=5 retrieved on March 7th 2013) Life of Pi mostly presents such unrealistic things and events. The carnivorous trees and an impossible 227 days survival of a boy together with a Bengal tiger floating on a boat in Pacific Ocean seem hard to dissolve by mind. Although these things are in some ways unrealistic, Martel puts Gods and religions ideas into this work. The Author's Note in the beginning of his novel states that the story comes up from a man named Mr. Patel. Yann Martel, the author of Life of Pi, was in India in searching for inspiration here he met a man in a café who then tells him to meet a man with great story i.e. Piscine Molitor Patel. He then says that the story will make him believe in God. Life of Pi is uniquely presenting its adventurous content with religious values and zoology. Yann Martel was intelligently put those different things into synchronized single unit. The coordination of the true story of Mr. Patel told in first person is incredible. The story begins about Mr. Patel's education and working life which serve with the fact that he was a student of religious studies and zoology. Then it shifts to his life when he was a boy, son of a zoo owner. In this part, the story provides facts about some animals' life inside the cage or out there in the wild. The story next progress is story about Pi's religious life when he was in his teen that reveals his strange religious practice. The 227 days survival in Pacific Ocean on a boat with a Bengal tiger is the next part of this incredible story and it is closed with he is survived. This novel once comes up with controversy of its originality. Some critics come up with their idea that this novel resembles Scliar's Max and the Cats, a story about a family of German zookeepers sets sail to Brazil. The ship is shipwrecked and only a young man survives after floating at sea with a wild jaguar. This issue then goes down as a discussion between Scliar and Martel done. But Martel had been firstly mentioned Scliar's name in his Author's Note part of his book. (http://www.sparknotes.com /lit/lifeofpi/context.html, retrieved on February 12th, 2013). This issue affects the outstanding content of this novel. Some critics, however, still appreciate the novel. This novel makes the reader recalls the story of Ernest Hemingway's The Old Man and the Sea Yann Martel was an author of seven awards in literature. His first book entitled The Facts Behind Helsinki Roccamatios and Other Stories was a collection of four short stories published in 1993 deals with themes like illness, the anguish of youth, grief, and loss that blend with the lunacy of 20th century history. This book achieved Journey Prize in Canada. Martel's second book, his first in the form of novel Self published in 1996. This book succeeded to win Chapters/Books in Canada First Novel Award. This novel's theme was study of sexual orientation and identity. Also Martel was the author of a collection of letters to the prime minister of Canada, What Is Stephen HarperReading? (http://Literature.britishcouncil.org/ yann-martel on 17 oct 2012) After the publication of his novel in 2001 Life of Pi, his name was widely recognized by literature world. This novel was able to win five different awards. In 2001, this novel won Governor General's Literary Award for Fiction in Canada and also Hugh MacLennan Prize for Fiction. A year later, it won Commonwealth Writers Prize in Eurasia Region as the Best Book although it won over the shortlist. Also in the same year, Life of Pi was able to get the Man Booker Prize for Fiction that made him create much of literary splash rather than with his first two books and it also won the Boeke Prize in South Africa. As the recent achievement, Life of Pi has been filmed in 2012 and achieved a great success. Martel's works have been praised seven different literary awards although his life began with various odd jobs after he graduated for a degree in philosophy in Trent University in Ontario. He ever became a tree planter, dishwasher, and security guard before he committed in writing at the age of 27. Although he began his life with various odd jobs, his decision to write books after that was a right decision. He got praised for his ability to make multi themes and problems that are not common to be bound in to one. For his ability to combine uncommon multi themes and problems, he succeeded to make Life of Pi to become a novel of great combination of religious values, zoology, and adventurous life. As the opening of the novel, it is told that the novel will make you believe in God. This story reveals Pi's journey of life since he was child until he was mature and graduated from university. This story provides about Pi's religious life which is strange and it affects his understanding about his life and God's destiny for him. The combination of religious theme and zoology of the novel is purposely done for enriching Pi's religious life portraits. Pi is kind of person with maturity in his mind to combine his understanding about God of his religions towards the objects around him although he is still young. As human life is divided into four divisions (Tracy, 1920: 10) in which the first period is the period of childhood. The second is period of youth where this is the period of procreative function to the process of self maturing. The next period is the period of manhood and the last is the period of decay that is being dead. As the character of Pi in Yann Martel's Life of Pi is in the second period of life, he experiences great things in his religious life. In his adolescence that is ranged from 12 up to 24 years of life, Tracy (1920: 187) points out that, youngsters seek for spiritual meaning in religion as well as from the objects of nature, events, and their relationship with other fellows. Piscine Molitor Patel or Pi is originally a Hindu. He lives in a Hindu neighborhood when he was kid until he is adolescence. His religious practice has become strange when he meets two religious people i.e. a priest and an imam. Thus, this introduction constructs his understanding about other religions, Christianity and Islam. His decision to commit three religions, Hinduism, Christianity, and Islam simultaneously is also influenced by Bapu Gandhi who said that the most important thing is to love God. Pi has a strong love towards God although he is still a young man. Pi is having a disliking towards his biology teacher who does not believe in God's existence. Pi sees the doubt on the important of religion and the existence of God as just a while. Every man will pass it someday and reach a happy life. Although Pi is still young, he has already experienced his deep feeling about being religious and to religion itself. The feeling creates him to experience religious flaming. This deep religious feeling or religiosity happens in his teen. His religious feeling seems have mutualism with his personality as adolescence. His life whether they are individual or cultural and social more or less influence personality and affect his decision in understanding religions as the way to love God and being a religious on his multi religions practices. This religiosity that is seen from his religion combinations stresses the importance of individual factors, including social background and personal history. Those backgrounds are to build up his mind of committing three different religions at the same time. Thus this study is to reveal the form of his religiosity in the novel and the influencing factors. RESEARCH METHOD The source of this study is taken from a novel by Yann Martel, Life of Pi reprinted and republished in New York in 2012. The data collection is by analyzing the quotations, phrases, dialogues, or monologues in which reveal thought, speech, action, and attitude that reflects the idea of religiosity of the main character, Pi, from the novel Life of Pi. This study of religiosity will be applied by the concept of religiosity with its components, modes, dimension, orientation, and changes that often experienced by people. The religiosity used to determine and explain about the main character Pi issues of religiosity. To analyze the background of his commitment, it is used psychology of adolescence concept that consists of several psychological points of view about relationship between adolescence and family and religious life of adolescence. Close reading of the novel is done first to determine the major issue of it. The major issues are collected and proposed into a topic of the study by seeing the conflict, the monologue, the dialogue in the novel. After the topic is already decided, it is tried to figure out what should be analyzed with the topic. Thus it is collected two statements of problems. There are the depiction of Pi's religiosity and the factors that influence his religiosity. The next step is searching related information about concept of the topic and to figure it out, it is used religiosity concept and theory of psychology of adolescence for the analysis and the conclusion. CONCEPT OF RELIGIOSITY Religiosity is a concept that has a bound with religion. This concept of religiosity can be defined in some definitions that relate to the religion itself. Supaat (2008: 175) defines religiosity as an aspect which lies inside the deep heart, flaming in the inner heart, personal attitudes which more or less are mystery for the other people, because are based on intimate psychology i.e. universal totality, that includes human's ratio and feeling, inside the personal being. This religious attitude is pointed on personal side of an individual toward his God, and having attitudes as what God wants. Stolz (2009: 347).continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god. Religiosity can also be defined as participation in religious rituals, various behaviors, and attitude in group or society by an individual (Theodorson, 1969: 345). Rituals are usually what a religion tells the adherents to do. Whitehouse (2004: 4) explains rituals as actions that have lack of intrinsic meanings although there are possible interpretations or symbolic motivations that may be the background of the rituals. Although these actions are lack of intrinsic meaning, the ordeals are ritualized and the speculation of their significance and meaning are still present. Focusing on implicit motivations of people doing the behaviors has some tactical merits (Whitehouse, 2004:24). The explicit religious concept that ethnographers interpret is often difficult to differentiate that the concept is the interpretation of the ethnographers or the people's actual explicit religious concepts. The other reason is from the psychological point of view, implicit concepts are better predictors of behavior. The people can also be manipulated to do the actions because they are not consciously aware and will of their response to the stimulus. This leads to explicit reason to do the behaviors instead of the real motivation of them. The explicit knowledge is likely consisting of post hoc rationalization rather than a guide of the motivation for the behavior (Whitehouse 2004: 25). On the contrary, Fazio stated in Whitehouse (2004: 25) says that the conflicts between the implicit concept and explicit concept are not always true all the time. He says that explicit belief can also be a guide to the motivation. People who do the same ritual procedures regularly results in habituation. Those automated habits can make the people to have less reflection of the symbolic meanings of the rituals (Whitehouse, 2004: 6) for example in religious speech. People can be feeling bored of the doctrinal repetition. Rituals are the main things to do in order to get merits and not being sinful. As Tracy (1920: 183) stated that religion involves man's attitudes towards the Supreme Being without age differences and the main thing is to do positive attitudes towards the Being. To support these, an adherent often does various behaviors like fasting and to behave or keeping his or her good attitude by helping other people and doing good things. God is the invisible but owns the highest power and attitudes towards the Being, as sacred and profane. Durkheim (1915: 37) states that there are two divisions of world. They are sacred in which is the one containing all and profane which is the other all. These are the distinctive characteristics of religious thought. Sacred thing is not only about the personal beings called gods and spirits but a rock, a house, a tree, or anything can be sacred. Profane is what relates to daily life experience of human beings. For example, it is about someone's attitude that results in sins or the way a religion teaches human being to have a meaningful life by giving charity and helping one another so it will result in man's goodness. The representations which express the sacred things, the virtues and powers that they have, or the relation with profane things are like beliefs, myths, dogmas, and legends (Durkheim, 1915: 37) As well as Theodorson, Tarigan (2007:11) supports that. The definition of religiosity for him is as the human attitude which comes from God's blessing. God blesses human to believe in God, to enjoy modest life, to give charity, to help other people, to be lovable, and to be friendly. Because of the participations, behaviors, and attitudes based on particular religion that an adherent must do, sometimes these will cause strain to the adherents. They may feel under pressure because if they are not doing them, there will not be merits that they will get but sins and being afraid of God. God is someone who watches you to see that you behave yourself. (Powell, 1963: 289) The concept of religiosity is also generally accepted as multidimensional phenomenon. The phenomenon happens in the society related, influenced, or caused by many dimensions. The dimensions come from cultural, social, or individual contexts. Religious as the result of practicing and believing religion is also influenced by the religion's system of beliefs, rituals, and practices. Thus, individual actions are often influenced by the religion. Because of factors like afraid of being sinful person or to be considered as a religious person, adherents may do more than what a religion tells. This actualization of excessive religious, religiosity (Concise Oxford English Dictionary Eleventh Edition), besides to show that they are religious by doing it excessively, it also can be deviated from the real doctrines. It is agreeable that religion has to do with the relationship between man and his Maker or specifically it is the relationship between man's attitudes towards whatever he believes to be the owner of the highest power in universe (Tracy, 1920: 183). Because of the existence of attitudes, it needs to differentiate religion and religiosity although they bound each other. Religiosity is something that adherents do from what a religion orders. Then, religion defines as follows A religion is a set of meanings and behaviors having reference to individuals who are or were or could be religious. (Ferm, 1959: 647) The statements means that a religion is a container of what an individual must do or must not do either the individual is religious, was religious, or could be religious. Thus, it is only a term that contains all formal or informal religions in the world (Ferm, 1959: 647). Religion is the institution of godness which is unified system of beliefs, rituals, and practices that typically involve a broader community or believers who share common definitions of the sacred and the profane. (freebook.uvu.edu/SOC1010 retrieved on 18th October 2012) Supporting Ferm, Evans (1978: 305) has a definition of religion in which also has relationship between things or power which are uneasy to explain. Because religion freely allows a man to relate himself to the outer power that cannot be explained with science, quality and intensity of man's religiosity of his religion can be low or high. A man considered himself as religious man not only because he believes on religion , he can be considered as religious without doing religion's doctrines or a man who does it but is considered as not religious one as explained as follows that it needs a deep understanding to consider a man as religious person or not. To be religious is to effect in some way and in some measure a vital adjustment (however tentative and incomplete) to whatever is reacted to or regarded implicitly or explicitly as worth of serious and ulterior concern. (Ferm, 1959: 647) Supaat (2008: 175) stated that someone who is religious is defined as human being who has serious inner heart, pious, careful, and with deep spiritual considerations. GENERAL COMPONENT OF RELIGIOSITY For the social psychologist, religion has five main facets. They are the ideological or beliefs, the ritualistic or practice, the experiential or feelings, the intellectual or knowledge and the consequential or effects (Watts and Williams, 1988: 10). These facets bound into one dimension of religiosity. On the other hand, Duke (1988) defines the general components of religiosity seen from social psychologist are knowing or cognition, feeling or affection, and doing or behavior. Knowing or cognition is abstract. Knowing about things that are related to religiosity and religions are inside every man's mind. This is an ideology. The people believe what he believes that the things are true and good for him. Because ideology is only idea in this context in idea of religious things, the only thing that can be seen from this is the realization of this belief in the real world. For example a person believes that a religion is true. People cannot see his belief but can only see how the person shows his belief true religious doings like doing rituals. The feeling or affective is the feeling dimension of religiosity towards the social situations. The social situations contain things that God has created. Human being, animals, plants, goods, or institution are the creation of God. People who have religiosity are feeling grateful of the existence of His creations. Doing or behavior is the action of showing religiosity. This action aims to get positive effect. Religious doings are the realizations of religion as ideology and the feeling towards the God and His creation in the world. The behaviors are like attending religious rituals like servings God as a duty, studying about religion as the feeling to enlarge his knowledge and religiosity to his God, doing charity as the praise for his sufficiency and love feeling towards fellow, and helping the others to tighten the fellowship. In the matter of religious behavior, cognitive scientists more or less ignored the roles of explicit religious ideas and sentiments as the motivations of people doing the religious behavior (Whitehouse, 2004: 24). Boyer stated in Whitehouse (2004: 24) says that people are feeling the compulsion to participate in rituals because the natural environment often produces contaminants so the people use the rituals as the detection of and protection against them. These specializations are actually just normal cognitive systems. Of these components of religiosity, many researchers still hopes for more developed ways to measure religiosity of someone that the participation in institutional religion because there are differences in religious attitudes and experiences between dominations and between different people with the same denomination and there are fact of the equivalency of average attendance figures (Watts and Williams, 1988: 11). Some people may define themselves as religious in some sense although they play no part in organized religion. From a survey on religious scale items from Independent Television Authority Survey stated in (Watts and Williams, 1988: 11), individuals scored high on religiosity because they classified themselves as very religious or fairly religious, are certain that having some religious beliefs lead a good life, without belief in god life is meaningless, religion helps to maintain standard and morals of society, there is God, god watches each person, are very likely to think of god when they are worried or happy, religious belief affected their everyday lives. MODES OF RELIGIOUS INVOLVEMENT Individual participation on religion consists of two modes of religious involvements. Duke, in his journal, states that the modes are personal mode and institutional mode. The personal mode is built of religious beliefs, feelings, and behaviors. These are found in personal and individualized religion. The person accepts doctrinal orthodoxy from the cultural society around (Duke: 1998). In institutional mode, the religious beliefs, feelings, and behaviors are found in formalized and institutionalized religion. This mode accepts them in which related to religious rituals and worship services like in a particular church or other religions. While Duke divides an individual involvement is a religion as personal and institutional mode, the others like Davidson stated in Duke, separates it to private and public modes. RELIGIOUS ORIENTATION People's interest toward particular religion that makes them religious depends on their own decision. It is whether they are extrinsically or intrinsically oriented (Allport, 1967: 144). Allport's point of view of extrinsic religious is caused by outer reasons or influence. The reason why an individual is committing religious acts aims in seizing mundane goals like feeling comforted and protected and also is like to get a social status and approval. To measure an individual religiosity based on extrinsic orientation is by seeing the influence given by peers, family members, or professional workers. Durkheim demonstrates how process that influence by society motivates individual action. The only source of life at which we can morally reanimate ourselves is that formed by the society of our fellow beings; the only moral forces with we can sustain and increase our own are those which we get from others. (Durkheim, 1915: 425) It is different from intrinsic orientation which assumed without achieving a mundane goal even self denying quality as the reason of religious involvement. This orientation arises from the goal of the contents of the religious tradition itself. To measure this orientation is by seeing the personality. CHANGE IN RELIGIOUS COMMITMENT AND PARTICIPATION Life events relate to religiosity. Peter Berger stated in Cornwall (1998) states that plausibility structures i.e. family, church, or voluntary organizations and conversations with the others are important and can give influence to religiosity. Because there are many life events that will influence someone's religiosity, there is chance of the change of his or her commitment and participation in religion. The changes are change in belief and activity over the life cycle, religion disaffiliation and dropping out, religious conversion and reactivation, religious change as personal development. The changing of religious belief and activity can be related to life cycle. Teens or early twenties may have less religious belief and activity than they who are in late twenties or thirties. This changing is caused by several backgrounds like family backgrounds, early socialization, and to developmental issues of adolescence and young adulthood (Albrecht and Cornwall: 1998) In religious disaffiliation and dropping out, an individual decides to not join one organization because she or he chooses to join another or decides to stop his religious involvement in the organization. Even though this is action of switching, it does not mean they loose their religious faith. They only choose the best belief for them. Religious conversion has often been defined as a rather sudden process consisting of new religious insight or experience which leads to greater religiosity on the part of individual involved (Donahue taken from Albrecht and Cornwall: 1998). Supporting Donahue, Starbuck (1900: 21) added that sudden changes of character like from evil to goodness, sinfulness to righteousness, and indifference to spiritual insight or activity. In the adolescent period, the conversion is an awakening. The conversion can happen in many motifs: conversion from private investigation of alternative ideologies to highly social, emotionally arousing experience (Lofland and Skonovd stated in Albrecht and Cornwall: 1998). Starbuck (1900: 49) states that the motives and forces behind the religious awakening is based on the nature of conversion. To study the motives and fears, the people are grouped into their likeness and differences. They are fears, other self-regarding motives, altruistic motives, following out a moral ideal, remorse and conviction for sin, response to teaching, example and imitation, urging and other forms of social pressure (Starbuck, 1900: 49) Religious development changes as the individual goes matures. This maturation process is primarily seen through psychological study without focuses on the impact of normative events like marriage, first job, child bearing, and death (Albrecht and Cornwall: 1998) PSYCHOLOGY OF ADOLESCENCE Adolescence is the second stage of human life. In this stage, adolescents will experience a period of the birth of procreative function until the full maturity of their powers (Tracy, 1920: 10). This stage is begun in the second dozen period of human life. The first dozen period is childhood, the third is manhood and the fourth or the last period is the beginning of decay of the powers until death. In other word, the adolescent period started from the age of 12 years. Supporting Tracy, Goldenson (1984: 17-18) explains further about the beginning of adolescent of girls and boys. He stated that adolescent period of girls is begun when they are 12 until 24 years. Boys have a year later the beginning of adolescence than girls, which is from 13 until 22 years. The period of adolescence is subdivided into two periods but some writers divided it into three. In the three divisions of this period, there are early, middle, and later adolescence. In this division, the beginning of adolescence happens in the four or five first year while the rest divisions follow this. In two divisions, the period of adolescence is subdivided into early and later adolescence. Both are lined when the adolescents are in their sixteen or seventeen years of life. During the period of adolescence, adolescents will experience a period of puberty. Puberty is a period when sexual life is born and it is also the beginning of procreative quality of them. Although puberty will happen to every person, the birth is varied between an adolescent to the other adolescents. This means that an adolescent can have it when he is 12 and the other may have it in his 14. Besides puberty is the birth of sexual maturity, in some civilized people, puberty is a sign of social and religious obligations of individual. … Frequently by some new emphasis on the social and religious obligations of the individual, evidently with a half-conscious recognition of the close association between the racial and the religious life. (Tracy, 1920: 17). The same thing happens to adolescents in Christian Communions. In this community, adolescents are hoped to take new step of their religiousness and begin to take their religious responsibility. This will lead them to the closer and more open relationship with their church. As well as Tracy, Goldenson (1984: 17-18) stated that during this period, adolescence will experience major various changes that have different rates one to the other. The changes include changing of sexual characteristic, body image, sexual interest, social roles, intellectual development, and self concept. Tracy (1920: 18) stated that in the matter of thought and feeling, adolescence is the period of 'deepening'. The feeling of adolescents will experience a flaming where they will find deepest meaning of things. All experiences of them will make them to interpret them deeper and bound them into a higher thought. In this case Evans (1978: 93) supports Tracy. He explained that in period of operational thinking, adolescents will not face conflict in thought process from the concrete to the abstract form. The adolescents will be aware of logical of basic things and the formulation of hypotheses (Evans, 1978: 93). Thus, they will seek for the logical reasons behind some things, conditions, or situations around them then they began to understand them as something that they have known or purposely introduced when they were kid. The mind of the adolescent reaches out to that which is implicated or involved in the presentation. In a deeper sense than ever before, the mind now takes hold upon the ideal, builds castles, lays plans, and indulges in day dreams, with all kindred psychic adventures (Tracy, 1920: 18) The feeling of adolescents will be richer than when they are children. This will also become actual. The combination of feeling, thought will result of the birth of emotion. Adolescence has primary emotions. They are love, fear, anger, and curiosity. The adolescence does not learn the emotions. The emotions are inborn. Other emotions are built on those primary emotions. Love is a feeling of strong affection or attachment. This emotion makes adolescence concerns for someone or feels delight in an object, person, or situation. This primary emotion builds some secondary emotions like affection, joy, pleasure, and delight. Adolescence will feel alone and insecure without love. Fear is an emotion which ranges from worry. Hurlock stated in Kapunan (1971: 55) categorizes fear into three: fear of material objects, like animals, airplane, elevator; fear of social relationship, like being alone, meeting people for the first time, making a speech; general fear, like poverty, death, darkness, physical incapacity, marriage. Gates and Pressey stated in Kapunan (1971: 56) say that fear has positive values. Fear causes someone to be cautious and careful, thrifty, sober, and the fear prevents one from doing wrong. But, fear also can make one from going a head and can lead to failure. There are three ways to overcome fear. They are forewarning in which the adolescence should be cautioned of something they are afraid of, assurance in which they are told that nothing is to fear, and to live the experience. Some secondary emotions of fear are moods, anxiety, and worry. Anger is an emotion from resentment to rage. This emotion is caused by inability to do or get what is wanted. It may be being teased, treated unfairly, and being bossed. The expressions of anger are like disobedience, resistance, sneers, threats, satire, gossip, or oral attack. This anger also has positive effect. This can make one accomplish more, make one pause and re-examine his practices and limitations. Curiosity is the beginning of knowledge and learning when one starts asking question. This interest or curiosity makes children being aware of the changes around them. This makes their interest aroused. The birth of emotions of adolescence makes the adolescents becoming aware of the combination of those emotions. After that, the action rises. When children's action is imitative, habitual and automatic adolescents' action will be less imitative, habitual, and automatic. It will be controlled by the will although it is not fully controlling the action. It is because their intelligence control is spasmodic and intermittent. FAMILY AND ADOLESCENCE Family condition whether it is related to the parents' attitudes influences the attitude of adolescence. Since many of attitudes or values own by children are well structured in their eight or nine years that are difficult to change, this means the home environment is the primary factor involved in structuring them. Powell (1963: 266) added that although parents have strong role of structuring children's attitudes and values, the home environment also influences them. It is including children's observation of his parent's interaction with each other and with other adults. According to Warnath in Powell (1963: 267) home is the place for children of learning developmental social skill and the desire to participate in activities related to other individuals. THE RELIGIOUS LIFE OF ADOLESCENCE Everyman is basically a religious being. They are capable of religion not at this age or that age. They are always capable of this. Although everyman's naturally religious, they are not capable of it in the same sense. It is not also the ideas and feelings towards a religion are the same in every man. An immature man does not have the same things as a mature man has of the ideas and feelings. It can be said that child's capability of religious experience is not the same in form and content as youth's and adult's. Since religion is a matter of thinking, feeling, and acting, children who are not mature, they themselves have intellectual power over their feeling and behavior (Tracy, 1920: 186). As long as they are given early introduction to God, their life is genuinely religious (Tracy, 1920: 186) as they easily absorb things around them. Thus, the character of children's religious life is based on their mental life and this progress. As everyone knows, child absorbs things around him but without the knowledge of his sense. Although the child tries to look deeper about the knowledge he gets from his surroundings, there is not larger degree of understanding that he will get. Although child may comprehend and speak bout the un-sensed for example the unseen and untouched things, there is not understanding about it. They only know that they can see the unseen if they have keener vision and where to look them. During childhood, children are told that God sees them but they cannot see God and God is near to them but they still cannot see God. They may ask such questions but without understanding. Thus, they will be satisfied to any answers given to them. Religion of child and the religion of youth have much in common but there are still features that differ one from another. The religion of youth is more subjectively personal than the religion of children. Religion of children is natural religion but the youth's is spiritual religion. Youth tries to find spiritual meaning of objects, events, and relationship of human life. Religion influences moral values as well as social attitudes not only for adults but also children and adolescents. Children know about religion early from the one closed to them like from parents. Since the children's religion is natural, as long as they are given early introduction about this, they will likely be religious. This differs to adolescent. Early introduction to concept of religion that is relationship between God and man often creates conflict in adolescence. They begin to question the concepts they have absorbed (Powell, 1963: 284) because they start to find out the hidden meaning of something, like no children. For in childhood there is a simple, direct response to the impressions of the environment, on the sensori-motor reflex plane, without the possibility of the deeper and stronger emotions, and with a minimum of logical interpretation or critical analysis. In youth this naive outlook gives way by degrees to one in which the subjective elements play a more prominent part, with the simple feelings giving place to the profounder emotions, mere sense-perception being supplemented by the more ambitious processes of cognition, and the instinctive and habitual motor reactions by deliberate choice and higher volition. (Tracy, 1920: 189) Adolescence is an important period of dedication in participation of organized religions in the world even in primitive form (Ferm, 1959: 378). Ferm also states that When the religious nurture of childhood must issue in personal commitment if significant religious maturity is to follow (Ferm, 1959: 378) Tracy (1920: 191) distincts two distinctive features of adolescence's religion. The first are the experience of intellectual doubts and difficulties whether it is accompanied by emotional tension and upheaval or not. The second is the experience known as conversion. Doubts and difficulties are related to religious questions. As children is very dogmatic which means they greatly absorbs what others say and answer based on questions that they ask, the mind of adolescence begins to criticize that. Ideas which have heretofore dwelt side by side in consciousness without any sense of clash or conflict, may now reveal to the more alert mind of youth certain incongruities and contradictions. (Tracy, 1920: 193) If the adolescence cannot deal with the idea that they have with the reality that they face, there will be conflict which leads to doubts of what they have believed. In some researches stated by Powell (1963: 286) relating to loss of religious interest with adolescent, show that young people do not loose 100 percents the interest of religion but they do not seem feeling satisfied with traditional religious belief and ritual. In this period, he added that confusion seems to happen that may lead to guilt feeling. Family environment which is included attitudes of father and mother influences the development of young people's religious attitudes, Parents often give their children with strict adherence to specific religion. This habit can make confusion to the children when they come to a more liberal home (Powell, 1963: 286). However, children with less religious even irreligious parents will make them insecure and envy of seeing their classmates involved in religious experience denied them. A better point of view of religion will be in the attitudes of children whose parents are religious and liberal. These combinations seem to make result in developing more mature religious views (Powell, 1963: 288). According to Allport cited in Powell (1963: 290) religious sentiments occur from needs, interests, temperament, rationality, and cultural response. Young people seek for new experiences, awareness of the presence of God, to be useful and unselfish, to participate responsibly, and become members of a wholesome fellowship (Powell, 1963: 291) Kuhlen and Arnold cited in Powell (1963: 289) agrees that religious beliefs become increasingly abstract with the increase of age. The more age he has, the more likely he becomes religious. For many adolescents, leaving religious practice is temporary since they will enter their adulthood that makes them likely to become affiliated with religious practice. DEPICTION OF PI'S RELIGIOSITY Three general components of religiosity are depicted by Pi. The depictions are Pi's knowing about God's existence, knowing about religion, feeling grateful of animals' existence, grateful of goods' existence, Pi's doing like serving God through personal prayer, committing three religions, loving the fellow, and loving animals. As adolescence, Pi has knowledge about the great power of God. Pi thinks that it is only a very serious disease that will kill God. What is meant by serious disease is a real serious disease that infects a human being. Pi thinks that God, the Supreme Being who has super power over all things in the world will not die or never dies because of thing like suffering disease like a man can. God is the creator of human being and all other creatures in this world. He disagrees with his teacher's opinion that God died during partition in 1947. He might also die during the war or when he was in orphanage. Pi believes and knows it so he thinks that it is an impossible thing for God to die that way like a human being does. He also thinks that if God's existence in a man's heart is dead, this condition will lead to terrible things. In other words this is a very dangerous condition. Pi states this because he does not want God disappears from every human being's heart. He compares the terrible things that will happen because of that condition with terrible disease. He attempts to say that the effect of both things towards human beings and other creatures in the world is vey dangerous. Someone who suffers a not-dangerous disease still can infect the people around him then imagine if the disease is terrible. This will have greater effect towards them. Then, if someone does not recognize his God anymore, this will make destruction. For example, if human beings are the highest God's creature compared to animals and plants do not have God inside their minds then the God's blessing like mercy towards the other will be lessen and the worst is disappearance of that. If the people do not have mercy anymore, they will damage the environment. Relating this to Pi's life that is closed to animals, Pi knows and believes that by keeping God inside his heart will make the world and its contents peaceful. Pi has a positive point of view of religion. For him religion is light. The light will guide human beings to the right way along their life's way. When Pi met his teacher, Mr. Kumar at his father's zoo, Pi was so happy to see him there. Mr. Kumar said that he often went to the zoo and thought that other people might think that it was his temple although he was indicating to the Pit of goats' and rhinos' cage. He later talked about politic that lead to religious debate between him and inside Pi's heart. Mr. Kumar thinks that the world will be peaceful if the politicians are like the goats and rhinos. But the real condition is reversed. Pi does not know anything about politics although his parents often complained about Mrs. Gandhi. He bluntly said that religion would save them. After Pi mentioned that they will be saved by religion from the political condition that was terrible, Mr. Kumar's response was not very good. He admitted that he did not believe in religion. He thought that religion is darkness. He thought that there were no grounds for believing thing like that. He only thought that religion was a superstitious bosh. He did not believe in God's existence. Hearing this Pi was only thinking that Mr. Kumar was only testing him for his knowledge of religion. He thought that he was like purposely saying that mammals lay eggs. After that Mr. Kumar is an atheist was in his mind. He was then surprised when he was told that God may have died somewhere some when. Although he was surprised of this, Pi did not hate the fact that Mr. Kumar is an atheist but Mr. Kumar's agonistic made Pi upset. Mr. Kumar spoke that God never came when he needed Him. When he was Pi's age, he was racked with polio. The God never came and saved Him but the medicine did. Pi did not respond anything about it although it was a bit much for him. Pi chooses not to argue with Mr. Kumar not because of his anger but more afraid of loosing someone he loved. The depiction of Pi's gratefulness of animals' existence is found when he was in the zoo. Pi's father was the owner of a zoo in Pondichery. He was feeling very happy of growing up in a zoo. Almost every animal in the zoo left an impression to Pi. In some case, Pi did not have to depend on his activity to the mundane thing like alarm clock for example. Pi did not have to have the clock because he could use the voice of animals around him to wake him up, to remind him for breakfast. He used the roar of a pride of lion who usually roar off between five-thirty and six every morning. The loud voice of howler monkeys punctuated his breakfast time. The animals in the zoo also give Pi a happy feeling. Besides from his mother's gaze, he also got a benevolent from bright-eyed otters, burly American bison, and also orang-utans. Pi was living his life as prince who had the fondest memories of living in a zoo because of the animals. The animals brought him advantages. From morning until dark, Pi was always welcomed by them. Every animal in the zoo has different characteristics, habits, and action. There are animals which voices are very disturbing but there are animals which are not. The habits or the actions of the animals whether they are annoying or not, has brought him to think that they are the graceful gifts from God. Seeing their action made Pi feeling as a lucky boy. Pi has always been feeling grateful of what God has given to him. Once when he is in trouble when floating on the Pacific Ocean, he finds goods that will make him survive. Although he is in trouble, he still remembers about the relationship of the goods' colour with one of the religions he has committed. In Hinduism, saffron is the most sacred color for the Hindu. This color represents fire and symbolizes purity. Wearing this color symbolizes the quest for light. If this color is related to what Pi finds in the lifeboat, this means the goods are source of light for Pi. The light is his survival from the fear. The boat makes him safe from the Pacific Ocean beneath him and the tarpaulin separates him with his Bengal tiger. At first, Pi does not think that the goods he has found will become his lifesaver. But, he then thinks that with the lid, he is separated from Richard Parker. This means he is protected from carnivore that is in the same boat with him. He is feeling grateful of that. Then if the tiger is managed to attack Pi from below, he should push the lid and it will warn him and make him fell backwards to the water. And here it is the function of the lifebuoy. The existence of the goods has caused joyful feeling for Pi. He even cannot compare them with all giving occasions that he has experienced before even the occasions bring great pleasure. Although Pi is floating on the Pacific Ocean, he still does prayers. Pi does the religious rituals adapted to the circumstances. He does all three religions rituals he commits. Pi still does the prayers because he has felt that doing prayer will bring him comfort. But, in practice, doing prayer is very hard for him. He thinks that to have faith in God is difficult. He has to have an opening up, trust, and act of love towards God. It is because he is not in a save condition. There are dangerous problems that he faces on the ocean. He sometimes fills with anger, desolation, and weariness. He is angry at the God who puts him in this kind of situation. In that kind of situation, Pi ensures himself that everything around him is God's, even the hat he is wearing, the attire, the cat, the ark, the wide acres, the ear. Pi has a very strange religious practice. Although he is still adolescence, he has already practiced three different religions. They are Hinduism, Christianity, and Islam. At the age of fourteen years old, Pi meets Jesus Christ and becomes a Christian although he was born Hindu. He is admired by the God's Son's sacrifice. He willingly sacrifices Himself for the goodness of humanity. He pays the humanity sins. The reason is because of love. Although Pi is a Hindu, he also commits to Christianity. He does both Hindu and Christian prayers even right after becoming Christian. Pi commits to Islam a year later. Again he is introduced to Islam by a professional worker. He is a Sufi who is a Muslim mystic. His name is Satish Kumar, person with the same name as his biology teacher. Pi is attracted to Islam because of the brotherhood and devotion that are told in Islam. Pi also feels good when he brings his forehead to the ground. He feels a deep religious contact then. After all those introductions to new religions, Pi practices all of them. Pi's love toward the fellow is depicted through his relationship with his biology teacher. Although Pi is born Hindu and is a well-content Hindu, he still respects anyone who does not have the same faith with him including his biology teacher, Mr. Satish Kumar. One day Pi sees Mr. Kumar in the zoo. He is a regular visitor of the zoo. When he is visiting zoo, he always reads labels and descriptive notices of every animal. He feels scientifically refreshed after visiting the zoo. In the zoo Mr. Kumar and Pi have a talk about political things in India. Mr. Kumar imagines if they have politicians like two rhinoceros and a goat, that live together in harmony that they are watching, India would not have faced many problems. Then Pi says that religion will save them. Mr. Kumar's response is out of Pi's mind. He thinks religion is darkness and God does not exist. Pi is surprised about this. Pi only thinks that he is testing him. But it is not. Mr. Kumar is an atheist, someone who does not believe in God's existence. Although Mr. Kumar's point of view about religion and God is not the same as Pi's, he still accepts this. He only thinks that anyone has doubt like Christ who ever doubts God for forsaking Him. Pi still makes Mr. Kumar as the reason he choose zoology as one of his major in university. Because he is the first atheist person that Pi meets, he is able to think that atheists are his brothers and sisters. He considers Mr. Kumar as a person of blood-relationship with him no matter what faith he has. The faith is their faith. They are free for it like Pi himself. Pi's love towards animals has made him to become a vegetarian. When Pi is in trouble finding the source of food on the boat on Pacific Ocean, he is finding many flying fish, Dorado fish, have flown into the lifeboat. He is finding this event as happy event because Richard Parker has had some food supplies to fill its hungry stomach. Pi also takes one of the fish. He covers the fish with blanket in order to not make him hurt. After that, he tries several times to kill the fish but he could not complete the action. Pi cannot make it because he feels pity of the fish. He even feels a bit responsible of the rat's death because he threw it to Richard Parker. To kill the fish, he thinks that he is between the affection feeling towards animals and the need to have meal. In his lifetime, he is a vegetarian. When Pi has been succeeded in killing the fish, the tears come down his cheeks. He cannot feel the life fighting anymore. He feels sad knowing that there is blood on the fish. Although fish is a common animal that human even other animals eat and they rarely think that the fish is a creature that has soul, Pi's aware that there is soul inside the fish. He is very sorry toward the soul living things that he has killed. The fish cannot enjoy its life anymore. Pi thinks the fish and him are the living creation of God. They should not kill each other. Because he loves it, he is feeling guilty. Then, he promise to pray for the fish in his prayer. FACTORS INFLUENCING PI'S RELIGIOSITY The religiosity of a person can be begun since early life of that person. This can appear to the mind of people when they are children. Not all people will experience religiosity since in their early age. Usually the forms of religiosity are based on religion. The moral values and social attitudes of the people will be likely influenced by it. Early introduction of religious things to people are mostly from the people around them but this religiosity can also come from inside the individuals. The factors that influence religiosity of Pi are family's influence, professional workers' influence, needs, interest, and rationality. Pi's religiosity comes from the influence of his parents because they are the closest figure for the children. Although Pi is from Hindu family, he defines his father as person who does not have strong belief about religion. He later explains that all new animals in the zoo owned by his father are blessed by priest. In the zoo there are also two small shrines. They are to Lord Ganesha and to Hanuman. But, the reason behind this is only to please the zoo director. His father thinks the existence of the shrines is good for his business to build a better relationship with the public, not personal reason like personal salvation for him. It is true that Pi is religious because he has been falling in love with Hinduism. But, the children's mental life grows. Pi sees his father as a less or lesser religious than him. Then he might think that committing two new other religions is okay for him. Because of this reason, he begins to think it won't be any problem with my family if I commits to these new religions. Besides of the religious life of his father, Pi also feels that when he was kid, he has never prohibited reading comic and other papers that contain anything about gods of any religion. Pi thinks that his mother was pleased to see him reading any books so long it was not naughty, because she herself is a big reader. Professional workers have a great influence towards Pi's religiosity. Pi was originally a Hindu because he was born in Hindu family. During his childhood, he was familiar with everything about Hinduism. Later on when he enters his adolescence period that is in his fourteen years old, he begins to know about Christianity. Pi is on a holiday trip in Munnar. In Munnar there are three hills. The hill on the right has a Hindu temple, the hill in the middle has a mosque, and the left hill has a Christian church. Pi is a school boy who attends a Christian school but he never goes inside a church. Then, because of curiosity he decides to hide around a corner of the rectory of the church because he is afraid. Inside the church he sees a figure, a priest who is sitting quietly and patiently waiting for anyone who wants to talk to him. On the next day he manages to enter the church and is welcomed by the priest, Father Martin. Pi thinks he is very welcoming. In that church he was told some story about Christianity including God's son who was willing to pay the humanity sins. Pi cannot accept this. He always questions this thing to Father Martin. He always answers it is because of love. Pi does not feel satisfied of the answer. On his last day in Munnar, Pi decides to come to the church again. At first he thinks that the priest is not in but he is. He says to Father Martin that he wants to be a Christian. He says that Pi already is. Before Pi leaves, he finds Father Martin smiling to him. It is the smile of Christ for him. From these, Father Martin's patience and kindness to give explanation to Pi and answers his questions too have made Pi to feel that Christian is not as what he thinks as people with great violence. He has seen the sincerity of Father Martin. He is feeling comforted about what the man is telling. These makes him understands about the religion and finally commits in it. Another professional worker that influences Pi to Pi's religiosity is an imam of a mosque in Mullah Street. At that time, Pi is also in his adolescent period. He is sixteen years old when he knows Islam. Pi actually does not have good impression about Islam. Islam has a reputation worse than Christianity. Islam has fewer gods but greate

Collected data and research material presented in the monograph are a result of financing of the Polish science budget in the years 2011−14; the research project was financed by the National Science Centre according to decision no. DEC-2011/01/B/HS4/04744. The project that resulted in this monograph was financed from public funds for education for 2011 − 2014, the National Science Center under Contract No. DEC-2011/01/B/HS4/04744. ; Value-Based Working Capital Management analyzes the causes and effects of improper cash flow management between entrepreneurial organizations with varying levels of risk. This work looks at the motives and criteria for decision-making by entrepreneurs in their efforts to protect the financial security of their businesses and manage financial liquidity. Michalski argues that businesses exposed to greater risk need a different approach to managing liquidity levels. The scientific aim of this monograph is to present the essence of financial liquidity management under specific conditions faced by enterprises with risk and uncertainty. Enterprises differ from one another in risk sensitivity. This difference affects the area of taking decisions by the managers of those enterprises. The result of interactions between levels of liquidity and sensitivity to risk affects the managers of such enterprises (Altman 1984; Tobin 1958; Back 2001; Tobin 1969). In this monograph the research hypothesis is the claim that enterprises with a higher sensitivity to risk are very different from enterprises with a lower sensitivity to risk, resulting in a different approach to managing their working capital. Enterprise managing teams react to risk, and this reaction is adjusted by an enterprise's sensitivity to risk. Because of its subject area, the book will address the issues of corporate finance. The monograph discusses the behavior of enterprises and the relationships between them and other factors in the market occurring in the management process under the conditions of limited resources. As a result of these interactions with the market and the environment in which individuals who manage enterprises operate, there is an interaction between money and real processes that in the end are the cornerstone of wealth building. This chapter discusses the objectives and nature of enterprises in the context of their risk sensitivity, as well as the relationships between the objectives of enterprises and the characteristic features of their businesses. Enterprises operate in various business environments, but generally speaking, they all have one main aim: wealth creation for their owners. The realization of that aim depends on an idea of business in which the enterprise is an instrument to collect money from clients of the enterprise's services and products. Business environment is crucial not only for future enterprise cash inflows from the market but also for risk and uncertainty (Asch, and Kaye 1997; Copeland, and Weston 1988; Fazzari, and Petersen 1993). According to the author, it is necessary to include an understanding of that risk and uncertainty of future in the rate that reduces the net size of free cash flows for the enterprise owners, beneficiaries, or more generally stakeholders. Enterprise value creation is the main financial aim of the firm in relation to working capital components (Graber 1948; Jensen, and Meckling 1976; Lazaridis, and Trifonidis 2006). Working capital management is a part of a general enterprise strategy to its value maximization (Laffer 1970; Kieschnick, Laplante, and Moussawi 2009; Lyland, and Pyle 1977). This chapter presents a definition of financial liquidity and liquidity-level measurements. This chapter contains four subchapters that address the specific role of short-term financial decisions, a classification of definitions of financial liquidity, sources of information about liquidity level, and liquidity-level measurements (Lazaridis and Tryfonidis 2006; Long, Malitz, and Ravid 1993; Kieschnick, Laplante, and Moussawi 2009). Financial liquidity definition and liquidity-level measurements Here we have an opportunity to present the author's opinion on what assets should be financed with short-term funds and what the level of liquidity is in an enterprise (Michalski 2012a). The discussion also pertains to the issue of the dividing line between long-term and short-term decisions, with greater emphasis on the durability of their effects, rather than the decision-making speed. This section also attempts to answer the question: What are the short-term effects of operations under conditions of uncertainty and risk? The reason for the considerations in this section is the need to characterize the decisions that affect the level of enterprise liquidity. The research hypothesis of this monograph assumes that differences between more risk sensitive and less risk sensitive enterprises are seen in liquidity management. Simply because the enterprises, during financial liquidity management, take into account the differences in their risk sensitivity. This chapter discusses the relationship between firm value and business risk sensitivity. The chapter starts with a presentation of intrinsic liquidity value and firm reactions to market liquidity value. This is the basis for target liquidity level in the enterprise. Liquid assets are the main part of working capital assets, so the next part of the chapter focuses on working capital investment strategies and strategies of financing such investments in working capital in the context of firm value creation. The chapter concludes that, from a firm-value-creation point of view, more risk-sensitive entities should use flexible-conservative strategies, while less risk-sensitive entities have the freedom to use restrictive-aggressive strategies. In the context of a crisis, this is the clear answer and explanation for higher levels of working capital investments observed empirically during and after a crisis. The determinants of intrinsic value of liquidity are attributed to liquidity by enterprise management. Enterprises in which financial liquidity has a high internal value will have a tendency to maintain reasonable liquid resource assets at a higher level. The levels of stocks of funds maintained by enterprises are also the result of the relationship between the liquidity market value and the intrinsic value of liquidity. It demonstrates how to approach the estimation of liquidity and presents the market value of liquidity. Having connected this information with the knowledge of manifestations of the internal liquidity, we can offer an explanation as to why the target (and also probably the optimal) level of liquidity for enterprises with higher-than-average risk sensitivity is at a higher level than the corresponding target (optimal) level for enterprises with a lower level of risk sensitivity. Working capital value-based management models In this part of the monograph we discuss the items contained within the cost of maintaining inventory. Using this approach, a model of managing inventories is presented. Theoretically, the value-maximizing optimal level of inventory is determined to be the modified EOQ model, presented as VBEOQ model. We also present an outline of issues associated with the risk of inventory management and its impact on the value of the enterprise for its owner. We also discuss the principle of the optimal batch production model and how the size of the production batch affects the value of the enterprise for its owner. Here also is demonstrated a modification of the POQ model: VBPOQ. The proposed modification takes into account the rate of the cost of capital financing and the measures involved in inventory when determining the optimal batch production. When managing the commitment of the inventory, it is crucial to take into account the impact of such decisions on the long-term effectiveness of the enterprise. This chapter also discusses the relationships between the management of accounts receivables and the value of a business. A modified (considering the value of a business) model of incremental analysis of receivables is presented, as is a discussion of the importance of capacity utilization by an enterprise for making management decisions pertaining to accounts receivables. Issues related to the management of working capital and enterprise liquidity are and will be an area of research. The analysis in this study focused primarily on working capital and liquidity management; understanding its specifics will facilitate the management of liquidity in any type of organization. Working capital as a specific buffer against risk has its special role during a crisis and can serve as a good forecasting indicator about future economic problems in the economy if a whole business environment notices higher levels of working capital and its components, like cash, inventories, and accounts receivables. The scientific value of the issues discussed in the book is associated with the issue of working capital and liquidity management in enterprises. It is also a result of the exploration and definition of the main financial objective of businesses and the relationship between the objective and the management of working capital and enterprise liquidity. The choice of topic and the contents of research resulted also from empirical observation. Empirical data on enterprises that operate in countries touched by the last crisis document higher-than-average levels of working capital before, during, and after the crisis in these enterprises. These conditions provided the means for a "natural experiment" of sorts. From that point, working capital management theory faced a necessity of even wider development. ; Collected data and research material presented in the monograph are a result of financing of the Polish science budget in the years 2011−14; the research project was financed by the National Science Centre according to decision no. DEC-2011/01/B/HS4/04744. The project that resulted in this monograph was financed from public funds for education for 2011 − 2014, the National Science Center under Contract No. DEC-2011/01/B/HS4/04744. ; How to Cite this Book Harvard Grzegorz Michalski . (April 2014). Value-Based Working Capital Management . [Online] Available at: http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834. (Accessed: 28 May 2014). APA Grzegorz Michalski . (April 2014). Value-Based Working Capital Management . Retrieved from http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834 MLA Grzegorz Michalski . Value-Based Working Capital Management . (April 2014) Palgrave Macmillan. 28 May 2014. Vancouver Grzegorz Michalski . Value-Based Working Capital Management [internet]. New York: Palgrave Macmillan; April 2014. [cited 2014 May 28]. Available from: http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834 OSCOLA Grzegorz Michalski , Value-Based Working Capital Management , Palgrave Macmillan April 2014 ; Author Biography Grzegorz Michalski is Assistant Professor of Corporate Finance at the Wroclaw University of Economics, Poland. His main areas of research are Business Finance and Financial Liquidity Management. He is currently studying the liquidity decisions made by organizations. He is the author or co-author of over 80 papers and 10 books, and sits on the editorial board of international conferences and journals. Reviews 'Due to the recent financial crisis, interest in the topic of working capital has grown significantly to both theory and practice. The research results presented by Grzegorz Michalski contribute to the development of a comprehensive theory of liquidity management and the creation of an integrated working capital and liquidity for different types of business model. The job is processed on a high quality level." -Marek Panfil, Ph.D, Director of Business Valuation Department Warsaw School of Economics 'The book of Grzegorz Michalski is a very good publication that has found the right balance between theory and practical aspects of financial liquidity management. It is extremely timely and valuable, and should be required reading for all corporate finance practitioners, academicians, and students of finance. Value-Based Working Capital Management is comprehensive, highly readable publication, and replete with useful practical examples. It has also enabled corporate leaders to make better-informed decisions in their efforts to protect the financial security of their businesses and manage financial liquidity.' -Petr Polak, Author of Centralization of Treasury Management, and Associate Professor of Finance, University of Brunei Darussalam ; REFERENCES Introduction Adner, R., and D. A. Levinthal (2004). "What Is Not a Real Option: Considering Boundaries for the Application of Real Options to Business Strategy." Academy of Management Review 29(1). Altman, E. (1984). "A Further Empirical Investigation of the Bankruptcy Cost Question." Journal of Finance 39. Back, P. (2001). "Testing Liquidity Measures as Bankruptcy Prediction Variables." Liiketaloudellinen Aikakauskirja—The Finnish Journal of Business Economics 2001(3). Baker, M., and J. Wurgler (2002). "Market Timing and Capital Structure." Journal of Finance 57. Ben-Horim, M., and H. Levy (1982). "Inflation and the Trade Credit Theory Period." Management Science 28(6), pp. 646–51. Blaug, M. (1985). Economic Theory in Retrospect. Cambridge University Press: Cambridge. Charnes, A., W. Cooper, and E. Rhodes (1978). "Measuring the Efficiency of Decision Making Units." European Journal of Operational Research 2. Cokins, G. (2004). Performance Management: Finding the Missing Pieces to Close the Intelligence Gap. John Wiley & Sons: Hoboken, NJ. Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Emery, G. W. (1987). "An Optimal Financial Approach to Variable Demand." Journal of Financial and Quantitative Analysis 22(2), pp. 209–25. Falope, O. I., and O. T. Ajilore (2009). "Working Capital Management and Corporate Profitability: Evidence from Panel Data Analysis of Selected Quoted Companies in Nigeria." Research Journal of Business Management 3, pp. 73–84. Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hirshleifer, J. (1958). "On the Theory of the Optimal Investment Decision." Journal of Political Economy 66. Huyghebaert, N. (2006). "On the Determinants and Dynamics of Trade Credit Use: Empirical Evidence from Business Start-Ups." Journal of Business Finance & Accounting 33(1). Ijiri, Y. (1978). "Cash-Flow Accounting and Its Structure." Journal of Accounting, Auditing and Finance 1(4). Kaura, M. (2002). Management Control and Reporting Systems: Harmonising Design and Implementation. SAGE Publications, Response Books: New Delhi. Khoury, N., K. Smith, and P. MacKay (1999). "Comparing Current Assets Practices in Canada, the United States and Australia." Revue Canadienne des Sciences de l'Administration 16(1), pp. 53–57. Lumby, S. (1993). Investment Appraisal and Financing Decisions. The Chapman & Hall Series in Accounting and Finance. Routledge Chapman & Hall: London. Mallik, A.K., and D. Sur (1998). "Working Capital and Profitability: A Case Study in Interrelation." The Management Accountant 33(11), pp. 805–9. Mallik, A.K., D. Sur, and D. Rakshit (2005). "Working Capital and Profitability: A Study on Their Relationship with Reference to Selected Companies in Indian Pharmaceutical Industry." GITAM Journal of Management 3, pp. 51–62. Markides, C. (1997). "Strategic Innovation." MIT Sloan Management Review 39(3). Masulis, R. (1980). "The Impact of Capital Structure Change on Firm Value: Some Estimates." Journal of Finance 38(1). Myers, S. (1984). "The Capital Structure Puzzle." Journal of Finance 39(3), Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2078/SWP-1548-15376697.pdf (date of access: January 10, 2014). Myers, S., and N. Majluf (1984). "Corporate Financing and Investment Decisions When Firms Have Information Investors Do Not Have." Journal of Financial Economics 13(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2068/SWP-1523-15376412.pdf (date of access: January 10, 2014). Myers, S. C. (1984). "The Capital Structure Puzzle." Journal of Finance 3. Peel, M. J., N. Wilson, and C. Howorth (2000). "Late Payment and Credit Management in the Small Firm Sector: Some Empirical Evidence." International Journal of Small Business 18(2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Pike, R., and B. Neale (1999). Corporate Finance and Investment: Decisions and Strategies. Prentice Hall: London. Pratt, S., and A. Niculita (2008). Valuing a Business: The Analysis and Appraisal of Closely Held Companies. McGraw-Hill: New York. Preve, L. A., and V. Sarria-Allende (2010). Working Capital Management, Financial Management Association Survey and Synthesis Series. Oxford University Press: New York. Robichek, A. A. (1975). "Interpreting the Results of Risk Analysis." Journal of Finance 30(5), pp. 1384–86. Ruback, S. C. (2002). "Capital Cash Flows: A Simple Approach to Valuing Risky Cash Flows." Financial Management 31(2). Scherr, F. C. (1989). Modern Working Capital Management. Text and Cases. Prentice Hall: Englewood Cliffs, NJ. Smith, J. E., and K. F. McCardle (1998). "Valuing Oil Properties: Integrating Option Pricing and Decision Analysis Approaches." Operations Research 46(2). Soltes, V. (2012). "Paradigms of Changes in the 21st Century: Quest for Configurations in Mosaic." Ekonomicky Casopis 60(4). Soufani, K. (2002). "On the Determinants of Factoring as a Financing Choice: Evidence from the UK." Journal of Economics and Business 54. Stewart, G. (1991). The Quest for Value. HarperCollins: New York. Summers, B., and N. Wilson (2000). "Trade Credit Management and the Decision to Use Factoring: An Empirical Study." Journal of Business Finance & Accounting 27(1). Tobin, J. (1958). "Liquidity Preference as Behavior Towards Risk." Review of Economic Studies 67, pp. 65–86. Tobin, J. (1969). "A General Equilibrium Approach to Monetary Theory." Journal of Money Credit and Banking 1(1). Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Williamson, O. (1988). "Corporate Finance and Corporate Governance." Journal of Finance 43(3). Wilner, B. (2000). "The Exploitation of Relationships in Financial Distress: The Case of Trade Credit." Journal of Finance 55, pp. 153–78. Wojciechowska, U. (2001). Liquidity of Polish companies in transition economy: Microeconomic and macroeconomic aspects (in Polish: Plynnosc finansowa polskich przedsiebiorstw w okresie transformacji gospodarki). SGH: Warsaw. Zardkoohi, A. (2004). "Do Real Options Lead to Escalation of Commitment?" Academy of Management Science 29(1). Zmeskal, Z., and D. Dluhosova (2009). "Company Financial Performance Prediction on Economic Value Added Measure by Simulation Methodology." Proceedings of the 27th International Conference on Mathematical Methods in Economics, Mathematical Methods in Economics; H. Brožová, R. Kvasnička eds., Czech University of Life Sciences, Chapter 1. Working Capital Management in the Business Context Adner, R., and D. A. Levinthal (2004). "What Is Not a Real Option: Considering Boundaries for the Application of Real Options to Business Strategy." Academy of Management Review 29(1). Amram, M., and N. Kulatilaka (1999). Real Options: Managing Strategic Investment in an Uncertain World. Harvard Business School Press: Boston. Asch, D., and G. R. Kaye (1997). Financial Planning: Profit Improvement through Modelling. Kogan Page: London. Bagchi, B. and B. Khamrui (2012). "Relationship between Working Capital Management and Profitability: A Study of Selected FMCG Companies in India." Business and Economics Journal 60. Banos-Caballero, S., P. J. García-Teruel, and P. Martinez-Solano (2010). "Working Capital Management in Enterprises." Accounting & Finance 50(3), pp. 511–27. Baxter, M., and A. Rennie (1996). Financial Calculus: An Introduction to Derivative Pricing. Cambridge University Press: Cambridge. Baz, J., and G. Chacko (2004). Financial Derivatives: Pricing, Applications and Mathematics. Cambridge University Press: Cambridge. Beck, P. E., and D. R. Stockman (2005). "Money as Real Options in a Cash-in-Advance Economy." Economics Letters 87. Ben-Horim, M., and H. Levy (1982). "Inflation and the Trade Credit Theory Period." Management Science 28(6), pp. 646–51. Berger, P. G., E. Ofek, and I. Swary (1996). "Investor Valuation of the Abandonment Option." Journal of Financial Economics 42(2). Black, F., and M. Scholes (1973). "The Pricing of Options and Corporate Liabilities." Journal of Political Economy 81. Brasch, J. J. (1972). "The Role of Trade Credit in Economic Development." Nebraska Journal of Economics and Business 11(1), pp. 63–67. Brealey, R. A., and S. C. Myers (1999). Basics of enterprises finance (Polish edition: Podstawy finansow przedsiebiorstw). WN PWN: Warszawa. Brennan, M. J., and E. S. Schwartz (1985). "Evaluating Natural Resource Investments." Journal of Business 58(2). Cassimon, D., and P. J. Engelen (2003). "The New Frontiers of Corporate Finance." Global Business Review 5(1). Cokins, G. (2004). Performance Management: Finding the Missing Pieces to Close the Intelligence Gap. John Wiley & Sons: Hoboken, NJ. Copeland, T. E., and V. Antikarov (2001). Real Options: A Practitioner's Guide. Business & Economics: Texere, London, New York. Copeland, T. E., and P. Keenan (1998). "How Much Is Flexibility Worth?" The McKinsey Quarterly 2. Copeland, T. E., and J. Weston (1988). Financial Theory and Corporate Policy. Addison-Wesley: Reading, MA. Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Copeland, T. E., L. F. Weston, and K. Shastri (2004). Financial Theory and Corporate Policy. Addison-WesleyPublishing Company: Boston. Cote, J. M., and C. K. Latham (1999). "The Merchandising Ratio: A Comprehensive Measure of Current Assets Strategy." Issues in Accounting Education 14(2) May, pp. 255–67. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Dudycz, T. (2000). Financial analysis (in Polish: Analiza finansowa). AE: Wroclaw. Emery, G. W. (1987). "An Optimal Financial Approach to Variable Demand." Journal of Financial and Quantitative Analysis 22(2), pp. 209–25. Fabozzi, F. J. (1999). Investment Management. Prentice Hall: Upper Saddle River, NJ. Falope, O. I., and O. T. Ajilore (2009). "Working Capital Management and Corporate Profitability: Evidence from Panel Data Analysis of Selected Quoted Companies in Nigeria." Research Journal of Business Management 3, pp. 73–84. Fazzari, S.M., and B. C. Petersen (1993). "Working Capital and Fixed Investment: New Evidence on Financing Constraints." The RAND Journal of Economics 24, pp. 328–42. Fernandez, P. (2002). Valuation Methods and Shareholder Value Creation. Academic Press/Elsevier: San Diego. Fewings, D. R. (1996). "Unbiased Trade Credit Decisions under Imperfect Information." Advances in Working Capital Management 3. Gentry, J. A. (1988). "State of the Art of Short-Run Financial Management." Financial Management 17(2), pp. 41–57. Graber, P. J. (1948). "Assets." The Accounting Review 23(1), pp. 12–16. Graham, J. (1996). "Debt and the Marginal Tax Rate." Jounal of Financial Economics 41(1). Graham, J., and C. Harvey (2001). "The Theory and Practice of Corporate Finance: Evidence from the Field." Journal of Financial Economics 60(2−3). Harris, M., and A. Raviv (1988). "Corporate Control Contents and Capital Structure." Journal of Financial Economics 20. Harris, M., and A. Raviv (1991). "The Theory of Capital Structure." Journal of Finance 46(1). Henderson, J. W., and T. S. Maness (1989). The Financial Analyst's Deskbook: A Cash Flow Approach to Liquidity. Van Nostrand Reinhold: New York. Hsia, C. (1981). "Coherence of the Modern Theories of Finance." Financial Management 10(4). Jain, N. (2001). "Monitoring Costs and Trade Credit." The Quarterly of Economics and Finance 41, pp. 89–110. Jensen, M. (1986). "Agency Cost of Free-Cash-Flow, Corporate Finance, and Takeovers." American Economic Review 76(2). Jensen, M. C., and W. H. Meckling (1976). "Theory of the Firm: Managerial Behavior, Agency Costs and Ownership Structure." Journal of Financial Economics 3(4). Kieschnick, R. L., M. Laplante, and R. Moussawi (2009). "Working Capital Management, Access to Financing, and Firm Value" Working Paper. Available at SSRN: http://ssrn.com/abstract = 1431165 (date of access: December 10, 2010). » Link Laffer, A. B. (1970). "Trade Credit and the Money Market." Journal of Political Economy (March/April), pp. 239–67. Lazaridis, I., and D. Tryfonidis (2006). "Relationship between Working Capital Management and Profitability of Listed Companies in the Athens Stock Exchange." Journal of Financial Management and Analysis 19(1), January-June. Available at SSRN: http://ssrn.com/abstract = 931591 (date of access: January 10, 2014). Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Levy, H., and D. Gunthorpe (1999). Introduction to Investments. South-Western College Publishing: Cincinnati, OH. Lyland, H., and D. Pyle (1977). "Information Asymmetries, Financial Structure and Financial Intermediation." Journal of Finance 32(2). Marr, B. (2006). Strategic Performance Management: Leveraging and Measuring Your Intangible Value Drivers. Butterworth-Heinemann: London. Martin, J. D., J. W. Petty, A. J. Keown, and D. F. Scott (1991). Basic Financial Management. Prentice Hall: Englewood Cliffs, NJ. Meszek, W., and M. Polewski (2006). "Certain Aspects of Working Capital in a Construction Company." Technological and Economic Development of Economy 12(3),pp. 222–26. Mian, S. L., and C. W. Smith (1992). "Accounts Receivable Management Policy: Theory and Evidence." Journal of Finance 67(1). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2009). "Effectiveness of Investment in Operating Cash." Journal of Corporate Treasury Management 3(1). Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012b). "Crisis Influence on General Economic Condition and Corporate Liquidity Management: Financial Liquidity Investment Efficiency Model (FLIEM) Use to Diagnose Polish Economics Standing." Proceedings of the 7th International Conference on Currency, Banking and International Finance: How Does Central and Eastern Europe Cope with the Global Financial Crisis? EKONOM: Bratislava, pp. 200–219. Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Miles, J. A., and J. R. Ezzell (1980). "The Weighted Average Cost of Capital, Perfect Capital Markets, and Project Life." Journal of Financial and Quantitative Analysis 15(3). Miller, M. (1999). Merton Miller o instrumentach pochodnych. K. E. Liber: Warszawa. Miller, M., and F. Modigliani (1961). "Dividend Policy, Growth, and the Valuation of Shares." Journal of Business 34(4). Miller, M., and F. Modigliani (1966). "Some Estimates of the Cost of Capital to the Electric Utility Industry, 1954 − 57." American Economic Review 56(3). Modigliani, F. (1982). "Debt, Dividend Policy, Taxes, Inflation and Market Valuation." Journal of Finance 37(2). Modigliani, F., and M. Miller (1958). "The Cost of Capital, Corporation Finance and the Theory of Investment." American Economic Review 48(3). Modigliani, F., and M. Miller (1963). "Taxes and the Cost of Capital: A Correction." American Economic Review 53(3). Moyer, R. C., J. R. McGuigan, and W. J. Ketlow (1990). Contemporary Financial Management. West Publishing Company: Saint Paul. Mueller, F. (1953). "Corporate Current Assets and Liquidity." The Journal of Business of the University of Chicago 26(3), pp. 157–72. Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. (1984). "The Capital Structure Puzzle." Journal of Finance 39(3), Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2078/SWP-1548-15376697.pdf (date of access: January 10, 2014). Myers, S. (1998). "The Search of Capital Structure Puzzle." In Financial Strategy: Adding Shareholder Value. Edited by J. Rutterford. John Wiley & Sons: Chichester. Myers, S., and N. Majluf (1984). "Corporate Financing and Investment Decisions When Firms Have Information Investors Do Not Have." Journal of Financial Economics 13(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2068/SWP-1523-15376412.pdf (date of access: January 10, 2014). Myers, S. C. (1974). "Interactions of Corporate Finance and Investment Decisions: Implications for Capital Budgeting." Journal of Finance 29(1) Available at JSTOR: http://www.jstor.org/discover/10.2307/2978211 (date of access: January 10, 2014). Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C. (2001). "Finance Theory and Financial Strategy." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Myers, S. C. (1984). "The Capital Structure Puzzle." Journal of Finance 3. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Nadiri, M. I. (1969). "The Determinants of Trade Credit in the US Total Manufacturing Sector." Econometrica 37(3). Narware, P. C. (2004). "Working Capital and Profitability: An Empirical Analysis."; The Management Accountant, ICWAI Knowledge Bank, Kolkatta, June, pp. 491−493. Nobanee, H. (2009). "Working Capital Management and Firm's Profitability: An Optimal Cash Conversion Cycle." Working Paper. Available at SSRN: http://ssrn.com/abstract=1471230 or http://dx.doi.org/10.2139/ssrn.1471230 (date of access: January 10, 2014). » Link Nobanee, H., W. K. Al Shattarat, and A. E. Haddad (2009). "Optimizing Working Capital Management." Working Paper. Available at SSRN: http://ssrn.com/abstract=1528894 or http://dx.doi.org/10.2139/ssrn.1528894 (date of access: January 10, 2014). » Link Nobanee, H., and M. Hajjar (2009b). "Working Capital Management, Operating Cash Flow and Corporate Performance." Working Paper. Available at SSRN: http://ssrn.com/abstract = 1471236 (date of access: January 10, 2014). » Link Nowak, M. (1995). Dynamic models of financial management in the enterprise (in Polish: Dynamiczne modele zarzadzania finansami w przedsiebiorstwie). Pret: Warszawa. Opler, T., L. Pinkowitz, R. Stulz, and R. Williamson (1999). "The Determinants and Implications of Corporate Cash Holdings." Journal of Financial Economics 52, pp. 3–46. Opler, T., M. Saron, and S. Titman. (1997). "Designing Capital Structure to Create Shareholder Value." Journal of Applied Corporate Finance 10(1). Opler, T., and S. Titman (1994). "Financial Distress and Corporate Performance." Journal of Finance 49(3). Osband, K. (2011). Pandora's Risk: Uncertainty at the Core of Finance. Columbia Business School Publishing Series. Columbia University Press: New York. Ozkan, A. (2001). "Determinants of Capital Structure and Adjustment to Long Run Target: Evidence from UK Company Panel Data." Journal of Business Finance & Accounting 28(1−2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Polak, P. (2012). "Addressing the Post-Crisis Challenges in Working Capital Management." International Journal of Research in Management 6(2). http://ssrn.com/abstract = 2195059 (date of access: January 10, 2014). Schwartz, R. A., and D. A. Whitcomb (1978). "Implicit Transfers in the Extension of Trade Credit." In Redistribution through the Financial System: The Grants Economics of Money and Credit. Edited by K. E. Boulding and T. F. Wilson. Preager Special Studies: New York, pp. 191–208. Shapiro, A. C. (1990). Modern Corporate Finance. Macmillan Publishing Company: New York. Shulman, J. M., and R. A. K. Cox (1985). "An Integrative Approach to Working Capital Management." Journal of Cash Management November−December. Smith, J. K. (1987). "Trade Credit and Informational Asymmetry." Journal of Finance 42(4), pp. 863–72. Solomon, E. (1963). The Theory of Financial Management. Columbia University Press: New York. Stark, A. (1987). "On the Observability of the Cash Recovery Rate." Journal of Business, Finance and Accounting 14(4). Thakor, A. V. (1993). "Corporate Investments and Finance." Financial Management Summer, pp. 135−44. Titman, S. (1984). "The Effect of Capital Structure on a Firm's Liquidation Decision." Journal of Financial Economics 13(1). Uyar, A. (2009). "The Relationship of Cash Conversion Cycle with Firm Size and Profitability: An Empirical Investigation in Turkey." International Research Journal of Finance and Economics 24. Vernimmen, P., P. Quiry, M. Dallocchio, Y. Le Fur, and A. Salvi (2009). Corporate Finance: Theory and Practice. John Wiley & Sons: Chichester, UK. Walker, D. A. (1985). "Trade Credit Supply for Small Business." American Journal of Small Business 9(3) Winter, pp. 30–40. Warner, J. (1977). "Bankruptcy Costs: Some Evidence." Journal of Finance 32(2). Warner, J. (1977). "Bankruptcy, Absolute Priority and the Pricing of Risky Debt Claims." Journal of Financial Economics May. Zietlow, J., and A. Seidner (2007). Cash and Investment Management for Nonprofit Organizations. Wiley: Hoboken. Zingales, L. (2000). In Search of New Foundations. Journal of Finance 55(4). Chapter 2. Understanding and Measuring Financial Liquidity Levels Back, P. (2001). "Testing Liquidity Measures as Bankruptcy Prediction Variables." Liiketaloudellinen Aikakauskirja—The Finnish Journal of Business Economics 2001(3). Bagchi, B. and B. Khamrui (2012). "Relationship between Working Capital Management and Profitability: A Study of Selected FMCG Companies in India." Business and Economics Journal 60. Brigham, E. F. (1975). "Hurdle Rates for Screening Capital Expenditure Proposals." Financial Management; 4(3), pp. 17–16 Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Cote, J. M., and C. K. Latham (1999). "The Merchandising Ratio: A Comprehensive Measure of Current Assets Strategy." Issues in Accounting Education 14(2) May, pp. 255–67. Damodaran, A. (1999). Applied Corporate Finance: A User's Manual. John Wiley & Sons: New York. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Database Osiris product of Bureau van Dijk (date of release: 2013 SEP 15). Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Dudycz, T. (2000). Financial analysis (in Polish: Analiza finansowa). AE: Wroclaw. Emery, G., and R. Lyons R. (1991). "The Lambda Index: Beyond the Current Ratio." Business Credit November/December. Etiennot, H., L. A. Preve, and V. S. Allende (2012). "Working Capital Management." Journal of Applied Finance 1 (ISSN 1534-6668), pp. 162–75 [This work was reported also as Etiennot, H., L. Preve, and V. Allende (2011). "Working Capital Management: An Exploratory Study." Journal of Applied Finance 2/2011, pp. 2–23 (available at SSRN: http://ssrn.com/abstract = 2119217).] Fama, E., and H. French (2005). "Financing Decisions: Who Issues Stock." Journal of Financial Economics 76. Fama, E. F. (1980). "Agency Problems and the Theory of the Firm." Journal of Political Economy 88(2). Fernandez, P. (2001a). "Valuing Companies by Cash Flow Discounting: Ten Methods and Nine Theories." EFMA 2002 London Meetings, Working Papers IESE Business School, Madrid. Available at SSRN: http://ssrn.com/abstract = 256987 (date of access: 2014 January 10). » Link Geske, R. (1977). "The Valuation of Corporate Liabilities as Compound Options." Journal of Financial and Quantitative Analysis 12(4). Gill, A., N. Biger, and N. Mathur (2010). "The Relationship between Working Capital Management and Profitability: Evidence from the United States." Business and Economics Journal 10. Graham, J., and C. Harvey (2001). "The Theory and Practice of Corporate Finance: Evidence from the Field." Journal of Financial Economics 60(2−3). Gupta, A., and L. Rosenthal (1991). "Ownership Structure, Leverage, and Firm Value: The Case of Leveraged Recapitalizations." Financial Management 20(3). Heinkel, R. (1982). "A Theory of Capital Structure Relevance under Imperfect Information." Journal of Finance 37(5). Henderson, J. W., and T. S. Maness (1989). The Financial Analyst's Deskbook: A Cash Flow Approach to Liquidity. Van Nostrand Reinhold: New York. Higgins, R. C. (1977). "How Much Growth Can Firms Afford?" Financial Management 6(3). Higgins, R. C. (1981). "Sustainable Growth under Inflation." Financial Management 10(4). Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hill, N. C., and W. L. Sartoris (1995). Short-Term Financial Management: Text and Cases. Prentice Hall: Englewood Cliffs, p. 2 Jensen, M. C., and W. H. Meckling (1976). "Theory of the Firm: Managerial Behavior, Agency Costs and Ownership Structure." Journal of Financial Economics 3(4). Kaplan, S. N., and R. S. Ruback (1995). "The Valuation of Cash Flow Forecast: An Empirical Analysis." Journal of Finance 50(4). Kemna, A. G. Z. (1993). "Case Studies on Real Options." Financial Management 22. Khoury, N., K. Smith, and P. MacKay (1999). "Comparing Current Assets Practices in Canada, the United States and Australia." Revue Canadienne des Sciences de l'Administration 16(1), pp. 53–57. Kieschnick, R. L., M. Laplante, and R. Moussawi (2009). "Working Capital Management, Access to Financing, and Firm Value" Working Paper. Available at SSRN: http://ssrn.com/abstract = 1431165 (date of access: December 10, 2010). » Link Kim, C-S., D. Mauer, and A. Sherman (1998). "The Determinants of Corporate Liquidity: Theory and Evidence." Journal of Financial and Quantitative Analysis 33(3). Lazaridis, I., and D. Tryfonidis (2006). "Relationship between Working Capital Management and Profitability of Listed Companies in the Athens Stock Exchange." Journal of Financial Management and Analysis 19(1), January-June. Available at SSRN: http://ssrn.com/abstract = 931591 (date of access: January 10, 2014). Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Long, M., L. B. Malitz, and S. A. Ravid (1993). "Trade Credit, Quality Guarantees, and Product Marketability." Financial Management 22. Luehrman, T. A. (1998). "Investment Opportunities as Real Options: Getting Started on the Numbers." Harvard Business Review 4. Maness, T., and J. Zietlow (2005). Short-Term Financial Management. South-Western/Thomson Learning: Mason, OH. Maness, T. S., and J. T. Zietlow (1998). Short-Term Financial Management. Dryden Press: Fort Worth, TX. Martin, J. D., J. W. Petty, A. J. Keown, and D. F. Scott (1991). Basic Financial Management. Prentice Hall: Englewood Cliffs, NJ. Melnyk, Z. L., and A. Birati (1974). "Comprehensive Liquidity Index as Measure of Corporate Liquidity." Scientific and Behavioral Foundations of Decision Sciences. Southeastern Region of the American Institute for Decision Sciences, Atlanta. Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Modigliani, F., and M. Miller (1963). "Taxes and the Cost of Capital: A Correction." American Economic Review 53(3). Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Neftci, S. N. (1996). An Introduction to the Mathematics of Financial Derivatives. Academic Press: San Diego, CA. Nita, B. (2011). "Synthetic indicator of liquidity in static approach in terms of demand for net working capital" (in Polish: "Syntetyczny wskaznik plynnosci finansowej w ujeciu statycznym w kontekscie zapotrzebowania na kapital obrotowy netto"). Research Papers of Wroclaw University of Economics 182, Wroclaw. Nowak, M. (1995). Dynamic models of financial management in the enterprise (in Polish: Dynamiczne modele zarzadzania finansami w przedsiebiorstwie). Pret: Warszawa. Paddock, J. L., D. R. Siegel, and J. L. Smith (1988). "Option Valuation of Claims on Real Assets: The Case of Offshore Petroleum Leases." Quarterly Journal of Economics 103(3). Parrino, R., and D. Kidwell (2008). Fundamentals of Corporate Finance. Wiley: New York. Peasnell, K. (1982). "Some Formal Connections between Economic Values and Yields and Accounting Numbers." Journal of Finance and Accounting 9(3). Peel, M. J., N. Wilson, and C. Howorth (2000). "Late Payment and Credit Management in the Small Firm Sector: Some Empirical Evidence." International Journal of Small Business 18(2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Pike, R., and B. Neale (1999). Corporate Finance and Investment: Decisions and Strategies. Prentice Hall: London. Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Piotrowska, M. (1998). "Macroeconomic conditions of the money market in Poland" (in Polish: "Makroekonomiczne uwarunkowania rynku pienieznego w Polsce"). Scientific Papers of the University of Economics in Wroclaw 783, Wroclaw. Polak, P. (2009). "The Centre Holds: From the Decentralised Treasury Towards Fully Centralised Cash and Treasury Management." Journal of Corporate Treasury Management 3(2), pp. 109–12. http://ssrn.com/abstract = 1653318 (date of access: January 10, 2014). Polak, P. (2010). "Centralization of Treasury Management in a Globalized World." International Research Journal of Finance and Economics 56. http://ssrn.com/abstract = 1702687 (date of access: January 10, 2014). » Link Pratt, S., and A. Niculita (2008). Valuing a Business: The Analysis and Appraisal of Closely Held Companies. McGraw-Hill: New York. Preve, L. A., and V. Sarria-Allende (2010). Working Capital Management, Financial Management Association Survey and Synthesis Series. Oxford University Press: New York. Rajan, R., and L. Zingales (1995). "What We Know About Capital Structure: Some Evidence from International Data." Journal of Finance 53(3). Rizzi, J. V. (2007). "How Much Debt Is Right for Your Deal?" Commercial Lending Review 22(4). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 8(1). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 4. Salamon, G. L. (1982). "Cash Recovery Rates and Measures of Firm Profitability." Accounting Review 57. Samuels, J. M., F. M. Wilkers, and R. E. Brayshaw (1993). Management of Company Finance. Chapman & Hall: London. Sarjusz-Wolski, Z. (2000). Inventory control in an enterprise (in Polish: Sterowanie zapasami w przedsiebiorstwie). PWE: Warszawa. Scherr, F. C. (1996). "Optimal Trade Credit Limits." Financial Management 25 (1) (Spring), pp. 71–85. Schilling, G. (1996). "Working Capital's Role in Maintaining Corporate Liquidity." TMA Journal 16(5). Schwartz, R. A. (1974). "An Economic Model of Trade Credit." Journal of Financial and Quantitative Analysis 9(4), pp. 643–57. Schwartz, R. A., and D. A. Whitcomb (1978). "Implicit Transfers in the Extension of Trade Credit." In Redistribution through the Financial System: The Grants Economics of Money and Credit. Edited by K. E. Boulding and T. F. Wilson. Preager Special Studies: New York, pp. 191–208. Shapiro, A. C., and S. D. Balbier (2000). Modern Corporate Finance. Prentice Hall: Upper Saddle River, NJ. Shulman, J. M., and R. A. K. Cox (1985). "An Integrative Approach to Working Capital Management." Journal of Cash Management November−December. Siegel, J. G., J. K. Shim, and W. G. Hartman (1999). Guide to finance (in Polish: Przewodnik po finansach). WN PWN: Warsaw. Sierpinska, M., and D. Wedzki (2002). Financial liquidity management in an enterprise (in Polish: Zarzadzanie plynnoscia finansowa w przedsiebiorstwie). WN PWN: Warsaw. Singh, P. (2008). "Inventory and Working Capital Management: An Empirical Analysis." The ICFAI Journal of Accounting Research 7(2), pp. 53–73. Smith J. K., and C. Schnucker (1994). "An Empirical Examination of Organizational Structure: The Economics of Factoring Decision." Journal of Corporate Finance 1. Soltes, V. (2012). "Paradigms of Changes in the 21st Century: Quest for Configurations in Mosaic." Ekonomicky Casopis 60(4). Spremann, K. (2010). "Old and New Financial Paradigms." In Current Challenges for Corporate Finance: A Strategic Perspective. Edited by G. Eilenberger. Springer-Verlag: Berlin Heidelberg. Summers, B., and N. Wilson (2002). "The Empirical Investigation of Trade Credit Demand." International Journal of the Economics of Business 9(2), pp. 257–70. Titman, S., and R. Wessels (1988). "The Determinants of Capital Structure Choice." Journal of Finance 43(1),pp. 1–19. Varian, H. R. (1987). "The Arbitrage Principle in Financial Economics." Economic Perspectives 1(2). Waiss, L. (1990). "Bankruptcy Resolution: Direct Cost and Violation of Priority Claims." Journal of Financial Economics 27(2). Walker, D. A. (1985). "Trade Credit Supply for Small Business." American Journal of Small Business 9(3) Winter, pp. 30–40. Walter, J. (1957). "Determination of Technical Solvency." Journal of Business January. Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Weston, F. (1963). "A Test of Cost of Capital Propositions." The Southern Economic Journal 30(2). Wojciechowska, U. (2001). Liquidity of Polish companies in transition economy: Microeconomic and macroeconomic aspects (in Polish: Plynnosc finansowa polskich przedsiebiorstw w okresie transformacji gospodarki). SGH: Warsaw. Zietlow, J., and A. Seidner (2007). Cash and Investment Management for Nonprofit Organizations. Wiley: Hoboken. Chapter 3. Intrinsic and External Values of Liquidity and Optimization Altman, E. (1984). "A Further Empirical Investigation of the Bankruptcy Cost Question." Journal of Finance 39. Asch, D., and G. R. Kaye (1997). Financial Planning: Profit Improvement through Modelling. Kogan Page: London. Baker, M., and J. Wurgler (2002). "Market Timing and Capital Structure." Journal of Finance 57. Banos-Caballero, S., P. J. García-Teruel, and P. Martinez-Solano (2010). "Working Capital Management in Enterprises." Accounting & Finance 50(3), pp. 511–27. Beck, P. E., and D. R. Stockman (2005). "Money as Real Options in a Cash-in-Advance Economy." Economics Letters 87. Blaug, M. (1985). Economic Theory in Retrospect. Cambridge University Press: Cambridge. Brealey, R. A., and S. C. Myers (1999). Basics of enterprises finance (Polish edition: Podstawy finansow przedsiebiorstw). WN PWN: Warszawa. Brennan, M. J., and E. S. Schwartz (1985). "Evaluating Natural Resource Investments." Journal of Business 58(2). Brigham, E. F. (1975). "Hurdle Rates for Screening Capital Expenditure Proposals." Financial Management; 4(3), pp. 17–16 Chriss, N. A. (1997). Black-Scholes and Beyond: Options Pricing Models. McGraw-Hill: New York. Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Cox, J., S. Ross, and M. Rubinstein (1979). "Option Pricing: A Simplified Approach." Journal of FinancialEconomics 7. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). DeAngelo, H., and R. Masulis (1980). "Optimal Capital Structure under Corporate and Personal Taxation." Journal of Financial Economics 8(1). Deloof, M. (2003). "Does Working Capital Management Affect Profitability of Belgian Firms?" Journal of Business Finance & Accounting 30(3 − 4), pp. 573–88. Dixit, A. K., and R. S. Pindyck (1994). Investment under Uncertainty. Princeton University Press: Princeton, NJ. Dixit, A. K., and R. S. Pindyck (1995). "The Options Approach to Capital Investment." Harvard Business Review 73(3), May−June, pp. 105−115. Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Eckbo, B. E. (2007). Handbook of Corporate Finance: Empirical Corporate Finance. Elsevier/North Holland: Amsterdam. Fernandez, P. (2001b). "Valuing Real Options: Frequently Made Errors." Working Papers IESE Business School, Madrid. Available at SSRN: http://ssrn.com/abstract = 274855 or http://dx.doi.org/10.2139/ssrn.274855 (date of access: January 10, 2014). » Link Fewings, D. R. (1996). "Unbiased Trade Credit Decisions under Imperfect Information." Advances in Working Capital Management 3. Fisher, E., R. Heinkel, and J. Zechner (1989). Dynamic Capital Structure Choice: Theory and Tests. Journal of Finance 44. Frank, M., and V. Goyal (2003). Testing the Pecking Order Theory of Capital Structure. Journal of Financial Economics 67. Frank, M., and V. Goyal (2009). "Capital Structure Decisions: Which Factors Are Reliably Important?" Financial Management 38. Hamada, R. (1969). "Portfolio Analysis, Market Equilibrium, and Corporation Finance." Journal of Finance 24(2). Harris, R. S., and J. J. Pringle (1985). "Risk-Adjusted Discount Rates: Extensions from the Average-Risk Case." Journal of Financial Research 8(3). Haugen, R., and L. Senbet (1978). "The Insignificance of Bankruptcy Costs to the Theory of Optimal Capital Structure." Journal of Finance 33(2). Herath, H. S. B., and C. S. Park (1999). "Economic Analysis of R&D Projects: An Options Approach." Engineering Economist 44(1). Herath, H. S. B., and C. S. Park (2002). "Multi-Stage Capital Investment Opportunities as Compound Real Options." Engineering Economics 47(1). Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hill, N. C., and W. L. Sartoris (1995). Short-Term Financial Management: Text and Cases. Prentice Hall: Englewood Cliffs, p. 2 Hirshleifer, J. (1965). "Investment Decisions under Uncertainty: Choice Theoretic Approaches." Quarterly Journal of Economics 74(4). Hubalek, F., and W. Schachermayer (2001). "The Limitations of No-Arbitrage Arguments for Real Options." International Journal of Theoretical and Applied Finance 4(2). Jajuga, K. (2005). "Problems in Operational Risk Measurement." In Finansowanie dzialalnosci przedsiebiorstw. Wydawnictwo WSB: Poznan, pp. 137–44. Kester, W. C. (1984). "Today's Options for Tomorrow's Growth." Harvard Business Review 2. Kogut, B., and N. Kulatilaka (2004). "Real Options Pricing and Organizations: The Contingent Risks of Extended Theoretical Domains." Academy of Management Science 29(1). Kulatilaka, N. (1993). "The Value of Flexibility: The Case of Dual-Fuel Industrial Steam Boiler." Financial Management 3. Kulatilaka, N., and L. Trigeorgis (2001). "The General Flexibility to Switch." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Lee, Y. W., and J. D. Stowe (1993). "Product Risk, Asymmetric Information, and Trade Credit." Journal of Financial and Quantitative Analysis 28, pp. 285–300. Leland, H. (1994). "Corporate Debt Value, Bond Covenants, and Optimal Capital Structure." Journal of Finance 49(4). Leland, H. E., and D. H. Pyle (1977). "Informational Asymmetries, Financial Structure and Financial Intermediation." Journal of Finance 32(2). Lessard, D. R. (1996). "Incorporating Country Risk in the Valuation of Offshore Projects." Journal of Applied Corporate Finance 9(3). Lofthouse, S. (2005). Investment Management. Wiley: Chichester, UK. Long, M., L. B. Malitz, and S. A. Ravid (1993). "Trade Credit, Quality Guarantees, and Product Marketability." Financial Management 22. Luehrman, T. A. (1998). "Investment Opportunities as Real Options: Getting Started on the Numbers." Harvard Business Review 4. Lumby, S. (1993). Investment Appraisal and Financing Decisions. The Chapman & Hall Series in Accounting and Finance. Routledge Chapman & Hall: London. Madden, B. (1999). CFROI Valuation: A Total System Approach to Valuating the Firm. Butterworth-Heinemann: Oxford. Majd, S., and R. S. Pindyck (1987). "Time-to-Build Option Value and Investment Decisions." Journal of Financial Economics 18. Makridiakis, S., and S. Wheelwright (1989). Forecasting Methods for Management. Wiley & Sons: New York. Marris, R. (1963). "A Model of the 'Managerial' Enterprise." The Quarterly Journal of Economics 77(2). Masulis, R. (1980). "The Impact of Capital Structure Change on Firm Value: Some Estimates." Journal of Finance 38(1). McDonald, R., and D. Siegel (1986). "The Value of Waiting to Invest." Quarterly Journal of Economics 101(4). McGrath, R. G., W. J. Ferner, and A. L. Mendelow (2004). "Real Options as Engines of Choice and Heterogeneity." Academy of Management Review 29(1). Merton, R., and A. Perold (1999). "Theory of Risk Capital in Financial Firms." In The New Corporate Finance: Where Theory Meets Practice. Edited by D. H. Chew. McGraw-Hill: Boston. Merton, R. C. (1973). "Theory of Rational Option Pricing." Bell Journal of Economics and Management Science 4(1). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012b). "Crisis Influence on General Economic Condition and Corporate Liquidity Management: Financial Liquidity Investment Efficiency Model (FLIEM) Use to Diagnose Polish Economics Standing." Proceedings of the 7th International Conference on Currency, Banking and International Finance: How Does Central and Eastern Europe Cope with the Global Financial Crisis? EKONOM: Bratislava, pp. 200–219. Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Miller, M. (1988). "The Modigliani-Miller Propositions after 30 Years." Journal of Economic Perspectives 2(4). Modigliani, F., and M. Miller (1958). "The Cost of Capital, Corporation Finance and the Theory of Investment." American Economic Review 48(3). Moles, P., and N. Terry (1999). The Handbook of International Financial Terms. Oxford University Press: Oxford. Moyer, R. C., J. R. McGuigan, and W. J. Ketlow (1990). Contemporary Financial Management. West Publishing Company: Saint Paul. Mun, J. (2002). Real Option Analysis. Tools and Techniques for Valuing Strategic Investments and Decisions. John Wiley & Sons: Hoboken, NJ. Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. (1998). "The Search of Capital Structure Puzzle." In Financial Strategy: Adding Shareholder Value. Edited by J. Rutterford. John Wiley & Sons: Chichester. Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C. (2001). "Finance Theory and Financial Strategy." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Nobanee, H. (2009). "Working Capital Management and Firm's Profitability: An Optimal Cash Conversion Cycle." Working Paper. Available at SSRN: http://ssrn.com/abstract=1471230 or http://dx.doi.org/10.2139/ssrn.1471230 (date of access: January 10, 2014). » Link Nobanee, H., W. K. Al Shattarat, and A. E. Haddad (2009). "Optimizing Working Capital Management." Working Paper. Available at SSRN: http://ssrn.com/abstract=1528894 or http://dx.doi.org/10.2139/ssrn.1528894 (date of access: January 10, 2014). » Link Nobanee, H., and M. Hajjar (2009a). "A Note on Working Capital Management and Corporate Profitability of Japanese Firms." Working Paper. Available at SSRN: http://ssrn.com/abstract = 1433243 or http://dx.doi.org/10.2139/ssrn.1433243 (date of access: January 10, 2014). » Link Opler, T., L. Pinkowitz, R. Stulz, and R. Williamson (1999). "The Determinants and Implications of Corporate Cash Holdings." Journal of Financial Economics 52, pp. 3–46. Opler, T., M. Saron, and S. Titman. (1997). "Designing Capital Structure to Create Shareholder Value." Journal of Applied Corporate Finance 10(1). Osband, K. (2011). Pandora's Risk: Uncertainty at the Core of Finance. Columbia Business School Publishing Series. Columbia University Press: New York. Ozkan, A. (2001). "Determinants of Capital Structure and Adjustment to Long Run Target: Evidence from UK Company Panel Data." Journal of Business Finance & Accounting 28(1−2). Piotrowska, M. (1998). "Macroeconomic conditions of the money market in Poland" (in Polish: "Makroekonomiczne uwarunkowania rynku pienieznego w Polsce"). Scientific Papers of the University of Economics in Wroclaw 783, Wroclaw. Polak, P. (2012). "Addressing the Post-Crisis Challenges in Working Capital Management." International Journal of Research in Management 6(2). http://ssrn.com/abstract = 2195059 (date of access: January 10, 2014). Poteshman, A., R. Parrino, and M. Weisbach (2005). "Measuring Investment Distortions When Risk-Averse Managers Decide Whether to Undertake Risky Project." Financial Management 34, pp. 21–60. Rappaport, A. (1988). Creating Shareholder Value: A Guide for Managers and Investors. Free Press: New York. Razgaitis, R. (2003). Dealmaking Using Real Options and Monte Carlo Analysis. John Wiley and Sons: New York. Reilly, F. (1992). Investments. The Dryden Press: Fort Worth, TX. Remer, D. S., S. B. Stokdyk, and M. L. Van Driel (1993). "Survey of Project Evaluation Techniques Currently Used in Industry." International Journal of Production 32(3). Ross, S. A. (1973). "The Economic Theory of Agency: The Principal's Problem." American Economic Review 63(2). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 8(1). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 4. Ross, S. A. (1995). "Uses, Abuses and Alternatives to Net-Present-Value Rule." Financial Management 24(3). Rubinstein, M. (1973). "A Mean-Variance Synthesis of Corporate Financial Theory." Journal of Finance 28(1). Salamon, G. L. (1985). "Accounting Rates of Return." American Economic Review 75. Salamon, G. L. (1988). "On the Validity of Accounting Rates of Return in Cross-Sectional Analysis: Theory, Evidence, and Implications." Journal of Accounting and Public Policy 7. Scherr, F. C. (1989). Modern Working Capital Management. Text and Cases. Prentice Hall: Englewood Cliffs, NJ. Schilling, G. (1996). "Working Capital's Role in Maintaining Corporate Liquidity." TMA Journal 16(5). Sharpe, W. F. (1964). "Capital Assets Prices: A Theory of Market Equilibrium under Conditions of Risk." Journal of Finance 19 (3), pp. 425–42. Shiller, F. J., and F. Modigliani (1979). "Coupon and Tax Effects on New and Seasoned Bond Yields and the Measurement of Cost of Debt Capital." Journal of Financial Economics 7(3). Shleifer, A., and R. Vishny (1992). "Liquidation Values and Debt Capacity: A Market Equilibrium Approach." Journal of Finance 47(4). Smith, J. E., and K. F. McCardle (1998). "Valuing Oil Properties: Integrating Option Pricing and Decision Analysis Approaches." Operations Research 46(2). Smith, J. E., and R. F. Nau (1995). "Valuing Risky Projects: Option Pricing Theory and Decision Analysis." Management Science 41(5). Stiglitz, J. (1969). "A Re-Examination of the Modigliani-Miller Theorem." American Economic Review 59(5). Stiglitz, J. E., and A. Weiss (1981). "Credit Rationing in Markets with Imperfect Information." American Economic Review 71(3). Taggart, R. A. (1991). "Consistent Valuation and Cost of Capital: Expressions with Corporate and Personal Taxes." Financial Management 20(3). Trigeorgis, L. (1996). Real Options: Managerial Flexibility and Strategy in Resource Allocation. MIT Press: Cambridge, MA. Turnbull, S. M. (1979). "Debt Capacity." Journal of Finance 34(4). Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Zmeskal, Z., and D. Dluhosova (2009). "Company Financial Performance Prediction on Economic Value Added Measure by Simulation Methodology." Proceedings of the 27th International Conference on Mathematical Methods in Economics, Mathematical Methods in Economics; H. Brožová, R. Kvasnička eds., Czech University of Life Sciences, Chapter 4. Net Working Capital Management Strategies Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2009). "Effectiveness of Investment in Operating Cash." Journal of Corporate Treasury Management 3(1). Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Sarjusz-Wolski, Z. (2000). Inventory control in an enterprise (in Polish: Sterowanie zapasami w przedsiebiorstwie). PWE: Warszawa. Sierpinska, M., and D. Wedzki (2002). Financial liquidity management in an enterprise (in Polish: Zarzadzanie plynnoscia finansowa w przedsiebiorstwie). WN PWN: Warsaw. Conclusion Etiennot, H., L. A. Preve, and V. S. Allende (2012). "Working Capital Management." Journal of Applied Finance 1 (ISSN 1534-6668), pp. 162–75 [This work was reported also as Etiennot, H., L. Preve, and V. Allende (2011). "Working Capital Management: An Exploratory Study." Journal of Applied Finance 2/2011, pp. 2–23 (available at SSRN: http://ssrn.com/abstract = 2119217).] Further References from Value-Based Working Capital Management Ehrhardt, M., and P. Daves (2002). "Corporate Valuation: The Combined Impact of Growth and the Tax Shield of Debt on the Cost of Capital and Systematic Risk." Journal of Applied Finance 12(2), pp. 31–38. Elvin, M. (2004). Financial Risk Taking: An Introduction to the Psychology of Trading and Behavioural Finance. John Wiley & Sons: Chichester, West Sussex, Hoboken, NJ. García Teruel, P. J., and P. Martínez Solano (2007). "Effects of Working Capital Management on Enterprise Profitability." International Journal of Managerial Finance 3, pp. 164–77. Grinblatt, M., and S. Titman (2001). Financial Markets and Corporate Strategy. McGraw-Hill/Irwin: Boston. Kerkhof, J., B. Melenberg, and H. Schumacher (2010). "Model Risk and Capital Reserves." Journal of Banking & Finance 34, pp. 267–79. Leary, M., and M. Roberts (2005). "Do Firms Rebalance Their Capital Structure?" Journal of Finance 60(6). Margrabe, R. (1978). "The Value of an Option to Exchange One Asset for Another." Journal of Finance 33(1). Markowitz, H. M. (1952). "Portfolio Selection." Journal of Finance 7 (1), pp. 77–91. Triantis, A., and A. Borison (2001). "Real Options: State of Practice." Journal of Applied Corporate Finance 14(2). Van der Wijst, D. (1989). Financial Structure in Small Business: Theory, Tests and Applications. Lecture Notes in Economics and Mathematical Systems, vol. 320. Springer-Verlag: Berlin Heidelberg. Vijayakumar, A. (2011). "Cash Conversion Cycle and Corporate Profitability: An Empirical Enquiry in Indian Automobile Firms." International Journal of Research in Commerce, IT & Management 1(2). ; National Science Centre no. DEC-2011/01/B/HS4/04744 ; Grzegorz Michalski

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

John Tanner, July 22, 2013 ; Business at the Crossroads - Ogden City is a project to collect oral histories related to changes in the Ogden business district since World War II. From the 1870s to World War II, Ogden was a major railroad town, with nine rail systems. With both east-west and north-south rail lines, business and commercial houses flourished as Ogden became a shipping and commerce hub. ; The following is an oral history interview with John Tanner. The interview was conducted on July 22, 2013, by Lorrie Rands. John discusses his experiences with 25th Street. ; 36p.; 29cm.; 2 bound transcripts; 4 file folders. 1 videodisc: digital; 4 3/4 in. ; Oral History Program John Tanner Interviewed by Lorrie Rands 22 July 2013 Oral History Program Weber State University Stewart Library Ogden, Utah John Tanner Interviewed by Lorrie Rands 22 July 2013 Copyright © 2014 by Weber State University, Stewart Library Mission Statement The Oral History Program of the Stewart Library was created to preserve the institutional history of Weber State University and the Davis, Ogden and Weber County communities. By conducting carefully researched, recorded, and transcribed interviews, the Oral History Program creates archival oral histories intended for the widest possible use. Interviews are conducted with the goal of eliciting from each participant a full and accurate account of events. The interviews are transcribed, edited for accuracy and clarity, and reviewed by the interviewees (as available), who are encouraged to augment or correct their spoken words. The reviewed and corrected transcripts are indexed, printed, and bound with photographs and illustrative materials as available. Archival copies are placed in Special Collections. The Stewart Library also houses the original recording so researchers can gain a sense of the interviewee's voice and intonations. Project Description Business at the Crossroads - Ogden City is a project to collect oral histories related to changes in the Ogden business district since World War II. From the 1870s to World War II, Ogden was a major railroad town, with nine rail systems. With both east-west and north-south rail lines, business and commercial houses flourished as Ogden became a shipping and commerce hub. After World War II, the railroad business declined. Some government agencies and businesses related to the defense industry continued to gravitate to Ogden after the war—including the Internal Revenue Regional Center, the Marquardt Corporation, Boeing Corporation, Volvo-White Truck Corporation, Morton-Thiokol, and several other smaller operations. However, the economy became more service oriented, with small businesses developing that appealed to changing demographics, including the growing Hispanic population. ____________________________________ Oral history is a method of collecting historical information through recorded interviews between a narrator with firsthand knowledge of historically significant events and a well-informed interviewer, with the goal of preserving substantive additions to the historical record. Because it is primary material, oral history is not intended to present the final, verified, or complete narrative of events. It is a spoken account. It reflects personal opinion offered by the interviewee in response to questioning, and as such it is partisan, deeply involved, and irreplaceable. ____________________________________ Rights Management Special Collections All literary rights in the manuscript, including the right to publish, are reserved to the Stewart Library of Weber State University. No part of the manuscript may be published without the written permission of the University Librarian. Requests for permission to publish should be addressed to the Administration Office, Stewart Library, Weber State University, Ogden, Utah, 84408. The request should include identification of the specific item and identification of the user. It is recommended that this oral history be cited as follows: Tanner, John, an oral history by Lorrie Rands, 22 July 2013 , WSU Stewart Library Oral History Program, Special Collections, Stewart Library, Weber State University, Ogden, UT. iii John Tanner July 22, 2013 Abstract: The following is an oral history interview with John Tanner. The interview was conducted on July 22, 2013, by Lorrie Rands. John discusses his experiences with 25th Street. LR: Okay, it is July 22, 2013 and we are in the home of Mr. Tanner talking about 25th Street and his memories of it. I'm here with Avery Pince. Mr. Tanner, thank you so much for allowing us to come into your home and do this. Let's start off with where were you born and how you ended up in Ogden. JT: I was born at 29th and Kiesel, 2858 Kiesel Avenue and my mother and father built that home when they got married, so I lived there all my life and raised a few chickens and fed a few tramps and went through there until I went to college. LR: So, what are some of your childhood memories of 25th Street? JT: Well, 25th Street, when I was young, I would go over there to—we'd walk to the Paramount Theater all the time and we'd go to 25th Street and go up and down there. We used to like to go to the Utah Noodle Parlor there, halfway down the street. There was a family—he was a good old Chinese man that had a very fine restaurant. He's the one that planted that whole hill on the Junction of Harrison, there's now the Kobe restaurant, and for years he just guarded that ready to move his restaurant there, moved it there three or four years and died. But, we used to ride our bikes up and down 24th Street to go to the Depot and see the trains come in and up and down and watch the soldiers come through there and 1 watch them waving the goodbyes and the farewells, that was all an adventure to a kid. One of the men that worked down there that was in charge of the depot, I guess the superintendent, Raymond Wright, was in the stake presidency with my father, so we'd go down and carry information down to him and back and forth to the—for the family. I didn't really start going up and down 25th Street until I got the job in high school of going to what they call the yard office which was a building after the twelve track tunnel. We'd come out and there was a building there that was in the middle of the rail yard that the dispatcher's and all would work, so they took care of scheduling things in the ice house for the trains and box cars and they would dump a lot of the climbers and that out of the engines on the spot right next to it there. It was quite an interesting place because on the trains they'd unload the garbage and we'd collect the pop bottles two cents a bottle and I'd get the deposit on the bottle. That was my first exposure to the 25th Street drill heavy. I joined the—worked there as a callboy for the dispatchers there at night and I'd go there at eleven or twelve and work until eight in the morning. I would call on the telephone to get the porters and waiters and the engineers and the brake men for the various trains. It was my job to go over to 25th Street to the Porters and Waiters Club in the middle of the night from 2:00 to 4:00 to roust out the porters and waiters for the trains. I would also call engineers and brakemen to come there. As a side for that, I got so I could go home, ride my bike home in the middle of the night and sneak dad's car out of the garage and go out to the Washington Terrace and pick up the engineers or the brakemen. 2 Taxis were hard to get at that time of night and during the war and gas was rationed and so it was a good deal for me to go pick up those people and take them to work and I'd make 15, 20 dollars at a time, and then Dad didn't know about it until later on. I'd go over to the Porters and Waiters Club at two or three in the morning and it was, at that time, I guess the colored people could not stay in hotels and so forth, so a lot of the traffic, it was through that hotel lobby, which was in the front of the Porter's & Waiters Club. But, in the rooms, the rooms were built, as you notice on 25th Street, those buildings were stacked pretty tight on there and there wasn't any ventilation in that except through the roof on the third and fourth floor and so those halls were dark and narrow and I'd have to go in there with a flashlight and shine it in the face of the guy and wake him up and say, "Hey, are you George Washington Jones, who are you?" There'd be six to eight men in the room there and the three or four men that I had to call, may not all be in the same room, so I'd have to go to two or three rooms and, of course, the smell of the sweat and that in the summer was kind of strong down the halls and in those rooms. They also had a bar and dance floor where people like Nat King Cole, Count Basie, and Duke Ellington would come. But, if it was at all possible, at night, when they weren't busy, there's an old Mr. Coal that was the desk man at the hotel and he would go up there and take me in and wake up the guys for me because he could see I was scared. We had a lot of experiences there because there was a lot of big, scary, colored fellows that were there and then I learned later that the whole basement was kind 3 of a dance floor and recreation or bar area for the people and so that would draw the women in there that I could see some pretty fancy dressed women come in there in the middle of the night or leave in the middle of the night. But, my main job was going over there and getting the people out for their job on the passenger trains and by doing it, waiting in the lobby for Mr. Coal to go with me a time or two. I think I told you that there were a couple of big dark fellows sitting in there and these two women came in all fancied up, you just couldn't believe, dressed to the T. The big bucks went over to these women and said, "Hey babe, let's me and you go out in the field and…" I won't say the word, but that's what they wanted to do. The little gal would say, "Alright, but I got to go home and change my clothes first." That was kind of impressive to me because I had never seen that seedy side of life. So, that was fun. Another good memory for me because I was over there a lot. I would also ride my bicycle over to the California Free Market and pick up a salami and loaf of bread and cheese for the condiments for a couple of seedy people and the yard officer for their midnight lunch. That was kind of interesting to go up and down the street at night on a bicycle and see the drunks laying on the side of the road or the policemen rousting them up and putting them in the squad cars and so forth. There was always two policemen there, they'd never go in with one. They'd say, "Don't ever go in the 25th Street without two police officers." I saw a lot of the nightlife activity of the soldiers staggering up and down the street and the police would help them hustle back to the train so they wouldn't miss their train and they'd have let them. The first time I ever got 4 propositioned by a queer was there, riding my bike up one night. He kept on standing there and looking at me making funny faces and then he'd start rubbing his leg with his arm like that. I didn't really know what he was doing until my mother told me and said, "Stay away from him." I guess they liked pretty boys at that time. So, that was an adventure I had there. We'd go up to Ross and Jacks restaurant there opposite the Municipal Park. Their favorite meal was burgers and fries, or burger spuds, it was potatoes and gravy and a hamburger patty. My Uncle John was an awning maker and canvas man and he'd go there for lunch every day, so he'd take us to Ross and Jacks when he was around and I got used to going into Ross and Jacks. When I was selling papers, I guess that was the earliest experience I had on 25th Street was the paper routes that I had. I'd go along 25th Street and down to the Paramount Theater and in the basement of the Kiesel building next to it was where the—we folded the papers and got them in our bicycles. So, we would stop in at Ross and Jacks maybe and eat before or after we took our paper route. Then, as I told you, on VJ Day, the end of the war, why, the train whistles and the factory whistles all started tooting and, so that brought all the people out from the depot clear up to the 26th and Washington and during the day they all started dancing. But that Sunday afternoon when the war started, I guess it was the 7th of December, why, they called me in to sell extras and so I stood on the corner of Grant and 25th Street and shouted, "Extra, extra, read all about it," selling the papers and really made a lot of money that day and sold all my papers. People were very interested in what was going on and so I spent a lot of time there on 5 25th Street. Then the bus depot was there on the corner at that time—the Greyhound Bus. Then, I guess, I went in the Broom Hotel a lot because of selling papers and leaving papers at the desk. There was a seaman that came as a tramp or hobo you'd call them, I guess, or traveling guy that came to the back door of the house one time and mother fed him and found out that he was a carpenter and had him do some things. His name was Auto Presnitts, he was an old Dutchman sailor, but he was a great carpenter. Mother would make sure that he was alright and we'd go down to 25th Street. He lived in a room above the grocery store there, I think it was Nicholas, at the time I think two doors up on the north side of 25th Street from Wall Avenue—or no, from Lincoln, about halfway up the block. I'd sit there in the car and wait for mother to go and see if he's alright. Mother had a little concern for me there because she had a brother that had died and gone off the rail and was kind of a wayward individual and he had died in the room and they didn't find him for a few days there. She was always concerned about me being in that area with the type of people. I was warned by Mother and the police to be careful, but I had no problems there. I was too young and immature to worry about it and as long as I chaied up my bicycle, it didn't bother me. I did go up and down there at night in the middle of the night at all hours, so I saw a lot of nightlife that you just wouldn't normally see there. Then, also, you mentioned the prisoners of war, they had the Germans and Italian prisoners of war out at the 2nd Street depot and they'd come by bus into the depot at 25th Street and go up and down there and filter out into the 6 shopping areas. There was a men's clothing store called B&B's at that time just above Grant on 25th Street, and my father had a clothing store on 24th Street and so we would interchange with the clothing store and do some of their tailoring and that back and forth when our seamstress wasn't available. I'd have to take clothing over there—the pants or a suit coat or that to get tailored for our store. They'd send a lot of those prisoners that needed clothes over to our store from B&B's so we had a good relationship with them. I know mother used to have to go and get groceries at that grocery store for Auto Presnitts all the time and take them up to his room and that. I think there was some connection or relationship of a cousin or something that was connected with that that Mother knew. Of course, during the Depression, we didn't realize it, but she'd go and get cow's tongues or tripe and make a meal out of that for us and I got to where I liked sliced cow tongue sandwiches. They weren't bad, she'd boil them up and then all the taste buds would peel off like a skin, so you just had the muscle in the middle and it was very good. So, I enjoyed that part of 25th Street too that did feed me quite a bit. We'd sit in the terminal there at the depot and watch the people go by, the servicemen by the USO branch there, we could maybe sneak a donut or coca cola once in a while from them. They were nice ladies. That was mainly, basically what I did on 25th Street. I was there when the war started as a paperboy and after, or before the war ended. When it ended, I was there working at the Porter's and Waiters Club was very familiar with me and the Utah Noodle Parlor was very interesting to me. I don't know whether it was a Legion Hall or what—just down 7 the street on the south side from the bus station and there was a lot of people in there and I had some interaction with those people, but I don't remember just what it was. That was another spot that I spent some time at, so that was mainly the things. We—this isn't exactly 25th Street—but my dad did get me up in the middle of the night one time when I was a kid, and of course, the railroad tracks came out of the depot, or just past the depot and went down the middle of Wall Avenue. Well they took, the circus train came, and they pulled that train right down the middle of Wall Avenue and then all the cars were there and then the elephants—would unload all the different cars with the tents and the poles and animals and that—that was a real thrilling thing to go see the circus arrive in town in the middle of the night. But, it wasn't on 25th Street. They took those animals and went a parade up 25th Street and then it took them to, up by Harrison—just below Harrison where the golf course is—on the west side of Harrison. There was a big field there and they'd pitch the three big tents there and there's carnival rides in the circus and have it all there, right up there by Harrison. That was another adventure that we had, to see the circus train unload, probably not applicable to you, but it was interesting to me. The old fashioned three ring circus. AP: Elephants on 25th Street. LR: I know, that's crazy, and did they walk all the way up? JT: Yeah, they had a parade with elephants and then they'd doll up the elephants with the banners and that and ladies ride them in the morning. They'd parade up 25th Street and over to 20th and then up to there, all with the elephants and the 8 horses and the beasts, that was quite a site to see. Yeah, a real parade of just— well, it was Barnum & Bailey in their height of their circus season I guess. That was interesting. I thought it was kind of interesting for me as a childhood memory. I don't know what else I could tell you and that—remind me. LR: Well, I was going to ask, going back to the POW's, did you have any personal interaction with any of them? JT: With who? LR: The POW's. JT: Oh yeah. They'd come in my dad's store all the time and so I got to know them. Then we had one of them or two of them do some work for us and one of them was Gene Miconey, which he stayed in town after the war and they had a tile business on 7th and Wall. That was one of the prisoners of war that you'd see all the time around town and he came over to the store. The first thing we had him do was he replaced the tile entries in the store on 24th Street with paving tiles and it was kind of wrapped up to the front of the store, so all those brick tiles were there and he did that and replaced a couple of those reflective glass or glass blocks that were in the sidewalk because the underneath the sidewalk was a tunnel and storage and so forth for my dad's store, Watson Tanners. There was a lot of tunnels under 25th Street like that too that would get from one side of the street over to the other, or traveling, so you didn't see all the traffic that went by as far as the corruption that was in there because all the bars were on the other side of the street. That was a known circumstance that the 9 tunnels were used quite a bit there on the street. During the depression, the German war prisoners were a little hard to associate with, they were kind of on their own and they were kind of filthy. Not filthy in dirt, but filthy minded. I had the opportunity one time of seeing three or four of them arguing about how much sperm they could put in the cup. I didn't appreciate that, but I did witness it myself. One or two of them said they were quite proficient at producing sperm. But I, of course, I didn't know about life at that time, but you did see them sitting there and talking and of course, I was a mouse listening on the side more or less. They used to ride the Bamberger Railroad. It used to go through there and they'd get on that and ride out to Hill Field and work out there too. I did in high school too, the year before. We'd get out of school and catch the Bamberger down there on 24th or 25th or even as far as south of the 29th Street. But you'd get out of school and hurry down the Bamberger Station and ride the Bamberger out to Hill Field or the Arsenal and I worked at the Arsenal on rollerskates. They'd have these large bins of carts, well I'd skate around and pulling cards and putting them in different bins waiting for the IBM computers to run that. That was an interesting part of my life from a young experience and involved me with some of the prisoners they were putting to work out there too. So, that was part of it. LR: So, as far as 25th Street, would you ever just go down there for fun, or was it just work related? JT: Well, we would go there for fun on our way to the movies or after the movies. We, I shouldn't say this, but, we would go into the hotel room areas and pick up 10 the cigarette butts and unwrap them and make enough to get copy, roll a cigarette. So, I got experienced with smoking a little bit, when I was a young teenager until my mother got a hold of me. She marched me up to the corner up to California Free Market and she bought a pack of cigarettes and a great big cigar and she took me down in front of the house for the whole neighborhood to see and made me smoke all of those. I was just green as green. LR: I'll bet you were sicker than a dog. JT: And I never smoked again. That was enough for me. She treated me royally with that. But, we did a lot of things there as a group. I'd find money on the street there and one time I found, I think it was a dollar or five dollars, I can't remember, but you could buy the milk nickels from Brown's Ice Cream, they were five cent ice cream bars on a stick that the Brown's Ice Cream would make there just off of 25th Street. So, I took that money and my mother took it and bought a few boxes of those ice cream bars and the whole neighborhood had a party with ice cream bars and all the kids as little kids. We would go up and down 25th Street playing because you'd find a lot of dropped money from the drunks there and so forth. So, I'd always get to check out and see if you could find a nickel or a dime or a quarter going up and down the street. The prostitutes were there and they'd proposition us or offer to help us do things, or they'd ask for information of who was where and because they were kind of transient. Those dolls would stay mostly around the Lincoln and 25th Street, that seemed to be the prime place and there was a bar on the southeast corner there that had a lot of traffic and 11 fights and a lot of prostitutes in and out of there, so I don't remember just what the name of it was, but I kind of stayed away from that one. LR: So was it as scary during the day as it was in the evening? JT: No, no. There were lots of people, but it was mostly passengers off the trains and so forth, so you didn't see the seediness of 25th Street as much. We'd go there and park a lot because mother would stop and go to the grocery store and you'd see a lot of people walking up to the hotel Ben Lomond from the depot and back and forth that way. The only activity you saw in the morning was—and the late afternoon—the prostitutes would come out. A lot of the delivery trucks and that were there in the day time, so it was more commerce than other or people asking for directions. There was a lot of people asking for directions to find their way to get up to the main shopping area at Washington Boulevard between 23rd and 26th, I guess. I do remember the first time I heard about marijuana and that. Why, there was two or three drunks in the Ben Lomond Hotel that took marijuana and were up on the upper floors and thought they were flying and two of them went out the window and landed. I don't know whether they landed on that marquee of the Orpheum theater or what, but it was quite a tragic experience for people who were high on drugs. That was the first experience with drugs that I found out. As far as the marijuana goes, why, that used to be all over the county. The pioneers planted west of Ogden. Marijuana grew along all the irrigation ditches for ropes of hemp fibers. 12 My dad would take me driving. I was crazy about driving and as a twelve year old kid and so forth, why, I'd, he'd put me on a pillow and seat and we'd go out to the west ward and the duck blinds and the gun club there and drive along the canals and see the baby ducks and the baby coots and so forth that were swimming there and Dad had a good friend out there and the granddad also, old pioneer fellow that was named George East was there and had a farm there and he had been all over that area around the lake and out to—not Antelope Island, but the Fremont Island. He collected Indian artifacts all the way from Fremont into Salt Lake and he's show us these big boxes of arrowheads and spearheads that he'd picked up all around there. I think the state finally got a hold of most of those. Old George, he used to, he couldn't write and read, so every Saturday he'd come into the store and grandpa would witness his X and give him money or a check and he'd go across the street. It wasn't 25th Street, but it was a bar across the street there between the Eccles building and Kiesel Avenue that was a poker parlor and upstairs on the second floor he'd gamble all day with the poker, but every Saturday that was his past time. So, as a kid, walking to work with Dad and seeing the activities on 25th street, then seeing it at night, why, I was very familiar with 25th Street. LR: So, the business your family owned on 24th Street, how long were you there— did your family own that? JT: Well, it started out with Wright's Department Store on the corner of 24th and Washington and my grandfather was head of the men's department and when Wright closed, why granddad and Sherriff Watson took over the men's 13 department and named it Watson-Tanner Clothing Company. Then we moved another building west later there, and I know in the Depression they were having a struggle and Dad bought into the store and took over a $30,000 loan and started to pay that off, but he salvaged the business for Granddad I think. Then, the store continued on 24th Street there and eventually moved into the Eccles Building when they, just before they built the mall and so we had the men's clothing store in that area for 87 years. Then, Dad died and my brother got called on a mission. They just had the remodeling of the Eccles Building and all the dust and so forth had destroyed the stores stock we had in the basement and insurance had just cleared that off, so they got the minimum stock and then a payoff from the insurance and then Dad died and my brother, who was barely running the store then—why, it was just time to move the—it was ten days away from going into the mall. The mall had been operating for five or six years. They begged my brother to move over to the mall and they were within ten days of signing the contract to take a men's store in the mall and my Dad died and my brother got called on his president mission and it all changed. That's when the store went out of business at just an ideal time. None of the other boys or family wanted to go to work in the store at that time, I was in a family of seven children. My oldest was a sister, my youngest was a sister and then there was five boys in between, so we had good use of the men's clothing store. I used to—the store would get some Catalina sweaters in, in a large and medium and small. I'd always take the small and the sales clerks would take the mediums and Dad couldn't figure out why they wouldn't sell, 14 because all they had left were the larges. It took him a while to figure out that I had 22 sleeveless sweaters and 20 long sleeve Catalina sweaters, in high school. I was a clothes horse with the men's clothing, but even at that, as a child, my mother would make shirts for us and for the families in the neighborhood that were poor. Mother did a lot of sewing and there was a Riddle family that had a lot of children ten or eleven, I don't know, but they all had this weeping eye situation that was a genetic defect I guess. All these kids would have these dripping eyes and pouring and that, so mother would get busy and she'd make a bunch of dresses and boy's shirts and every Christmas, why, we'd take that over there, so that was something. My mother was quite an unusual woman, she was the last of 13 children and so, well, most all of her family died before they were age 50 with high blood pressure. So, she was the last of 13 children and by the time she got to 50, 60, 70, why, they had blood pressure pills. The doctor told us one time there he had the blood pressure and it was off scale 325 or 350, whatever, and he said, "I wouldn't dare bring it down to less than 230." They just had high blood pressure. LR: The name of the store was Watson-Tanner? JT: It was Watson-Tanners and then Tanner's for Men. When we moved into the Eccles Building it was Tanner's for Men. LR: Are there any other memories you can remember or would like to share about 25th Street? 15 JT: No—well, there was a tourist souvenir shop and so forth on the corner of Wall and 25th there that the people, the soldiers and that, would come and there were a lot of souvenirs—leather craft and silver thing there, so that was an attraction to us and a lot of others because we'd go down there and buy belts and buy souvenirs. They used to take wire and make a design out of it, like a little house and so forth out in the Salt Lake and leave it for a period of time and then they'd bring it in and it was all encrusted with salt, so there was a crystal house there that they'd sell. We'd buy those and then we'd suck the salt off of them. That was an interesting part of it that they had the souvenirs there all the time, so the parts of the—other than that, why, mostly I just went up and down 25th Street. There was no attraction to me. In high school, my one friend's dad owned the bars across the street from the Porter's and Waiter's Club, so we'd go there. He was kind of a spoiled kid. Pappus' dad bought him a car for high school, as soon as he turned sixteen. And then the other kid that got me down there, he had a connection there at Combey's. His dad and family bought into one of the places there and was running a business. I think it was more of a restaurant somewhere, but I can't remember just where that was, but that's pretty much what I know of 25th Street. AP: So you were friends with George Pappas' son. JT: Yeah, Tom Pappas. AP: Did you guys spend a lot of time at Pappas' store or did you kind of stay out of there? 16 JT: Well, it was a bar, so all we'd do is go in there to cash money that Tom. He'd take us down there when he wanted some money from his dad or something. They frowned on young kids going in the bars and that, so we didn't stay in there very long and his dad would get a little upset. But he bought Tom a brand new car off the floor. A green Oldsmobile or Pontiac I think. I was really envious of him because he got all the girls with that because he had a brand new car and was a good looking guy with dark hair and tall. In high school we had clubs, it wasn't fraternities, but we had clubs and he was in the club and I was in the club, but I was too small to do much because I—between my junior and senior year, I grew six inches. I graduated from high school at 5'6" and that summer I grew six inches and up to 6'2". That was another thing we did on 25th Street, we'd come in with a fellow named Dan Sylvester, who was a fellow that lost his arm and he was a foreman at Browning Ranch up there at Connor Springs. We'd come into 25th Street and go to the jail and bail out all the drunks in the drunk tank on Sunday night and then we'd take them out to the ranch there and they would tromp the hay stacks. They didn't bail the hay at that time, it was all grass hay and so they'd take the bull rig up and dump this hay that we'd rake up with the horse teams. They'd tromp in and pack it down and then Friday night, why, we'd take them into town and they'd get drunk and Sunday night we'd pick them up. Old whiskey Dave thought it was such a great deal that he got his two sons involved working there. There's a lot of characters I could tell you about, but most of them would take them into Tremonton rather than Ogden and we'd go to Ogden to get the dirt 17 tank. Once he got out the base, or out to Connor Springs, why, they'd go into a bar and restaurant in Tremonton and we'd go in and take a movie and we'd go down and pick them up after and they'd be fighting and brawling and drunk and they'd have to herd them like a bunch of cows into the trucks. AP: Last time we were here you mentioned that you had to go down into the basement of The Standard to get the papers. JT: Yes. AP: Where was The Standard? Was it on Washington? JT: No, it was in the basement of the Kiesel Building, it was the presses and there was an alley between the Kiesel Buidling and the Paramount Theater and that's where we'd go down there. All the paper boys would go down there and they had benches alongside and they'd bring the bundles of papers there and we'd sit there and fold them up and put them in our paper bags on the handle bars of the bikes. My uncle used to make canvas bags for us that would hang off the handle bars down each side and we'd take and deliver about 150 to 200 copies of The Standard and my route was up to between 28th and 31st—from Monroe up to Harrison. AP: And then occasionally selling papers on 25th Street? JT: Well, when they'd call in, the fellow that had the prime spot of 25th and Washington was I guess handicapped in some ways. They called him Popeye because he had a round face and big bustly arms and he got hired by the Paramount Theater to run the Popeye Club, so we called him Popeye and he 18 would sell papers on the corner and he was a little stupid, but he was handicapped. Then he married a girl that was a little cerebral palsy, I guess you'd call it, and almost blind. He's lead her around the town. So, those two characters were reminiscent of 25th Street because they were always right around 25th Street. They'd go into Ross and Jacks and they'd sell papers and all of that. So, that was a place where the presses were in the basement of the Kiesel building. AP: So he had the prime spot on 25th Street? JT: Oh yeah, 25th and Washington in front of the hotel. Was that the Broom Hotel or Ben Lomond? AP: Ben Lomond. JT: Across from Ben Lomond on the other side was where all the traffic was between there and the Egyptian Theater and Keely's Café and all that and Samuel's Store and that was a heavily populated part of the business district that was used more too because it was right around the corner from 25th Street. So, the main traffic flow of the people was from 24th and Washington, around 25th Street and down to Lincoln. Most of the people didn't go shopping below Grant on 25th Street and that's where the natives of Ogden, why, they just didn't populate the areas very much there. AP: So after the railroad left in the late sixties, early seventies, did you not live in the area? Did you go down to 25th Street at all after that when it started to not be so busy down there? 19 JT: Well, I, let's see, I went on my mission in 1949 and then I was working out at Rusty's Drive-In at that time on Riverdale Road where the Warren's restaurant is now. But, a lot of people from the ballpark, which used to be on 33rd and Wall, people would go to 25th Street from there in the evening after the ball games, so that drew quite a crowd from the Pioneer League Ballpark. I worked at the gas station on the corner of 27th and Grand, kitty-corner from Clix's and we'd have to go down to 25th Street to rescue people in cars or take gas to them when they'd run out of gas. So, that was a Quick Trip down there, but I guess I didn't see much of 25th Street after 1949 because when I came back from my mission, I went to college and was working at Hill Field. I worked at Hill Field from 11 until 7 and I'd drive like mad up to Logan for the college. You'd go up the Brigham City Canyon, they were constructing the freeway and you'd go up with the blasting on the road on the other side up one side of the road in the morning and by the time you came down there in the evening, why, they'd made a road down the other side of the canyon. So, I knew where every Highway Patrolman was and I went through that dry lake one time at a hundred miles an hour on three inches of glare ice. I don't know how I did it. LR: Well, we really appreciate your time and allowing us to come and interview you about 25th Street. JT: Yeah, it's a lot of memories for me, but I didn't frequent there a lot. We went past 25th Street and the hot dog stand is between 27th and 28th, Kramer's Hot Dogs, shouldn't miss that, they made the best hamburgers and hot dogs in the world. They were both big, fat people and they'd sit in that little teeny stand there, but 20 they'd bake their own rolls and they'd put up their own pickles. The hamburgers, they'd cook in a boiling sauce that was, I guess Worcestershire sauce and something, but it would come out with the juiciest hamburgers you'd ever get. That was another part of my life, a very important part, we'd save a dime or a quarter and after the show on Saturday night, we'd go over to Kramer's and have a sandwich on the way home. But, that wasn't involved with 25th Street. AP: How did the porters and waiters feel about you, would they say, "Oh, that's Tanner's kid." Were you friends with a lot of the— JT: Oh, Mr. Coal used to take care of me like I was his only son. He was the nicest man you could ever meet and he would escort me through the place to find the colored people that were going to the Porter's and Waiters and usually on the Streamliner, they'd come through about 4 or 4:30 and they had six to eight porters and waiters that would be ready to go on that train, so I'd get them up at 2 or 3 to—(Phone rings). AP: So you worked out at the yard office which was behind the station, right? And you would ride your bike? JT: Yeah, the yard office was, well there were twelve sets of tracks there at the Depot and they had a tunnel underneath those and they'd come up and the yard office right out in the middle of the rail yards there. There was a big chimney there and a pile of cinders that was right next to the yard office and all that's gone now, but that's where they had the dispatchers that called the engineers and the brakemen and the porters and waiters. I was pretty much the one that called them and did the running and the leg work for them. There was a big Jewish 21 fellow that liked salami and I'd buy that salami and mustard and pickles and a loaf of bread in the middle of the night to feed him and his other fellows there. You can see a big, balding, Jewish man with a big cigar that—he treated me royally and we'd have a treat with him all the time. I was young and I guess good looking, but for a kid my age, I was so small nobody worried about me very much. I wasn't big enough to threaten anybody. I started school when I was five years old, see, so I didn't really get my growth spurt until about the time I got out of high school. I used to go down to 25th Street to see the cowboys and so forth. I had a friend that we'd go to the auction and I'd buy mustangs or colts for the auction for 20 or 50 dollars and then I'd put them out in my grandmother's land on 24th and west of the flour mill there where the aircraft place was. He had 20 acres there and granddad would help the farmers out by taking a piece of ground for them if they were in trouble and giving them a suit and that, so he had 20 acres there and 20 acres out at Washington Terrace and around the foothills. So— AP: And the auctions happened on 25th Street? JT: No, the auctions were the exchange down in the lower area, but the reason I mentioned 25th Street is this Archie Anderson had a corral on 25th Street, but it was west of the rail yards and west of the river. So, I'd buy horses and he'd take them and get him to his corral there because I didn't have any saddles or anything. They were wild and I would take these rope harnesses and halters and I'd lead them from there over into the field there where granddad had this piece of ground and then they had a big sandy pit at the front of it and I could get on 22 the horses and break them there. But Archie Anderson used to buy the horses from me and take them and I'd make 20 or 25 dollars a horse by breaking them. I got in trouble for it because my dad was on the school board and we'd go down to the auction and buy these horses and so the last two periods of school they'd go down there. Well, the dean of men caught us and they had to go in and they called you in and they were going to expel us. They expelled the other friend that I had, but he said, "What am I going to do with you? I can't expel you, your dad's president of the school board." So, we came to a mutual agreement and the next, rest of the summer or the school year, why, he'd go to the auction and be with us there because he lived up in Huntsville and had a farm there. So, I'd sit there the last two periods of school and go with the dean of men to the auction. It worked out fine, but I didn't realize what influence that it had with my dad being president of the school board and on the school board for years until I later found out how influential he was. But, Dad would never say anything about it. AP: Do you remember spending any holidays on 25th Street? 24th of July or Pioneer Days? JT: Well, at that time, Harmon Peery was the mayor and yeah, everything was centered around there and the carnival had come there on 25th Street right behind where the municipal building was and where the park is now. They'd set up the carnival there every year the carnival would come there and I was there. An experience I had there was, a couple of friends I had lived up in Soldier's Hollow and they'd bought a couple of mustang horses and they would ride them 23 bareback. We didn't have saddles then. Anyway, they were a couple of wild kids and they had flippers, the sling-shots, or whatever you call it, that take a couple of pieces of inner tube and tie them to a fork. Well, they were deadly with those flippers, so we'd go to these carnivals that would set up the bottles of the caps, and they'd get a prize and they'd sit there with those flippers and pick off all those bottles and get prizes. The carnival guys didn't think they could do that, but if they'd let them use their own flippers instead of the guns or that that they had there, why, these two kids could hit all the things until they wouldn't let them play anymore. They went out to the Hooper's Days—Tomato Days in Hooper. We slept overnight near the little duck pond there by where they had the—(Phone rings). We woke up in the morning out there in Hooper and I was still in the sleeping bag and they got up and they went over by this duck pond and I actually saw them shoot a Mallard Duck with their flippers, on flight in the air and we had it for breakfast. Those were wild times. They were real wild kids and they'd ride those horses everywhere, they'd just Dred not around town. They fed those horses so well, they were just fat, round ponies and they could do anything with those horses. I had three horses when I was in high school and I didn't have any place to keep them except Grandad's land and I'd stake them along the road. Well, by the time fall was coming, I had three horses and my dad didn't know I owned a horse and when he found out, it was just before deer season and he said, "I'll get rid of those horses for you." I was riding bareback and then my pants would be so covered 24 with mud and sweat that they'd stand up at the back of the end of the bath tub when I'd take a shower or bath, why, I could stand my pants right there. Dad got a hold of those horses and got a hold of a couple of farmers out there in Kaysville and Hooper and sold all three horses just like that. Traded me up for the winter, I didn't know what I was going to do with them. He knew enough farmers there. But, we, our whole life centered around 25th Street and 24th Street. It was a big thing to go to the carnival every year between there and the fire station and Brown's Ice Cream, why, it was a real party every year in the summer. AP: Did you ever go see any of the restaurants that were down there with your family? Did you Dad take you down there? JT: Yeah, Utah Noodle Parlor, we'd go there and then there were three good Chinese restaurants—the Utah Noodle Parlor, and Kay's Noodle Parlor, which was by the Paramount Theater, and the Bamboo Parlor, which was on Grant between 24th and 25th. In high school, we always took our dates down to Kay's Noodle Parlor or Utah Noodle Parlor. They were the best. You'd get a big bowl of pork noodles there after the dance and that would be our ideal thing to go down to 25th Street to hang out in a car. You didn't really connect anything other than just high school activities with 25th Street at that time, but we did go down 25th Street a lot. I know Mother would go down there and buy kitchen utensils a lot from one of those stores down there. Then, there were two or three people that she was connected with. They lived in hotels along there and above Nicholas 25 Grocery Store and she was a very generous and amazing woman. I saw her one time, she read three books in the morning, and she could read like mad and gave three different book reviews to the women's clubs in the afternoon. Three different types of books, and they were big books with five hundred pages. She had a memory and was artistic and I expected that of other people, but my mother could do anything. She could sew up a storm and she had people come to her to—there was the Harrington family that the woman had a twisted back and was very hard to fit and she'd come there and mother would pin all around the bottom of her dress and sew a dress so it'd fit her. She'd sew clothes for widows and she'd make bread for the people and she was active in music, but that was my activities with 25th Street and it was mostly through my mother taking in all these tramps and so forth. They all knew where to go. Somebody would pass the word, so all the tramps would come to the back door and she'd put them to work and it didn't matter what, a little painting or what, but they'd have to work a little and she'd have a big bowl of soup for them and make homemade bread and take care of it. So, we went down to 25th Street a lot for that. They kind of made us stay away because of kids, why, the two cops would say, "You don't go down 25th Street at night with single." They're amazed that I went over to the Porter's and Waiter's Club and rode my bicycle up and down the street, but they wouldn't do it with the bars and the fights that went on there. They just kind of shied away from it. Mayor Peery supported the rough cowboys and that of the town and that, but the Pioneer Day Rodeo was—Mayor Peery was a big thing in the big parade 26 and it would bring Indians down from the Shoshoni or Black Foots right up in Pocatello. They'd all gather just on Washington just above my house waiting for the parade to start and we'd go visit with all those Indians in their fancy headdresses and so forth. The other family I knew from 25th Street, was the Lambert Family and the old man was kind of an Indian-lore individual and he had two sons that I was involved with a lot. One was named Walt, and the other one was named John. John was killed when the Japanese attacked Pearl Harbor, he was there on one of the ships and died. Walt was an oddball, but he was an Indian artifacts collector and his Dad taught Indian artifacts all around the northern part of the state and that tied into the souvenir shop on the corner of 25th and Wall because he provided a lot of Indian-lore souvenirs there for them and feathers and beads and belts and so forth. But, 25th Street wasn't a playground. AP: Did the police keep an eye out for you when you were younger and you were riding your bike up and down, you said that the cops wouldn't even go by themselves, did they keep an eye on you? JT: Oh yeah, up by the police station, but below Grant they'd say, "You're on your own. We're not going down there with that." But, I had no problems with riding a bike down the middle of the street and when I'd go over to the Porters and Waiters Club I'd just chain it up to a post out front and Mr. Cole would take me when he could, and if not, why—but it was scary going into those rooms at night, I'll never forget it, but I thought those guys were giants. Big black men, I'd say, "Hey, are you George Washington Jones," "Hell no, I'm so and so, he's over 27 there." I'd wake them up in the middle of the night and they weren't very happy about it. AP: I bet. They were up all night partying down at the club and then go to sleep upstairs? JT: Well, that was kind of a secret at that time with prohibition, why, that was a little naughty to be having parties down there and having liquor that was prohibited and black marketed and so forth, but those people had a good time down there when they'd have parties. Mr. Cole kept me separated from that, he just wouldn't let me know what was going on. He'd have the people go when he'd open the door and let them go down the hall there, but all I was involved with was going upstairs down the hallways there to find the porters and waiters. That would smell in the summer, I never forgot it. That's probably my most favorite memories there was what I told you. AP: You went into the club there—into the hotel—that was your favorite? JT: Yeah, because I did that every night all summer long. It wasn't just a once in a while, it was every night that I'd have to go over there, that was part of my job, so they got to know me and I traveled up and down 25th Street I guess with people and then I was so small that they didn't pay much attention to me. It was fun and it was interesting to see all the people that would come off the trains and the G.I.'s and you'd get to see good ones and bad ones right away and that's where I saw what drinking could do to you. They'd have these G.I.'s that would fall down on the curb together and their faces were bleeding and their buddies were drunk 28 and they'd just leave him there. "You take care of yourself, we're going on down to the Depot." LR: Well, we really appreciate your time. AP: Yes, thank you. LR: Thank you very much for allowing us into your home. JT: You bet, I'm sorry, but I thought that little bit of information about the Porter's and Waiters Club was something you might not know about as far as 25th Street. AP: Well, you were there to see it all happen and it's something to hear about. JT: Yeah, I'm 84 and half years old. 29

GETTYSBURG "NEWS" PRINT. r . t —Mil HELP THOSE WHO HELP US. The Intercollegiate Bu^au or Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of Caps, Gowns and Hoods to the American Colleges and Universities from the Atlan-tic to the Pacific- Class contracts a specialty, I?.iclL G-o-wns for t3a.e E'-o.lpit and. Bench., WANTED. College students during their vacation can easily make $20 to $30 per week. Write for par-ticulars. THE UNIVERSAL MFG. CO., Pittsburg, Pa. Come and Have a Good Shave,,, or HAIR-CUT at Harry B. Sefton's New Tonsorial Parlors, 35 Baltimore St. BARBERS' SUPPLIES A SPECIALTY. Also, choice line of fine Cigars. Wanted. LADIES AND GENTLEMEN in this and adjoining territories to represent and advertise the Wholesale and Educa-tional department of an old established house of solid financial standing. Salary $3.5° per day with expenses advanced each Monday by check direct from headquar-ters. Horse and buggy furnished when necessary. Position Permanent. Ad-dress, BLEW BROTHERS & CO., Dept. 8, Monon Bldg., Chicago. 111. IF YOU CALL ON C. fl. Bloeher, Jeuuelei*, Centre Square, He can serve you in anything you may want in REPAIRING or JEWELRY. , • . . 1 WE RECOMMEND THESE FIRMS. "FOUR POINTS" Quality of material; thorough-ness of workmanship; perfection of style, and fairness of price are the four cardinal points of this tailor store. J. D. LIPPY, ^9 Chambersburg Street, GETTYSBURG, PA. CITY HOTEL, Main Street, - Gettysburg, Pa. Free 'Bus to and from all trains. Thirty seconds' walk 'from either depot. Dinner with drive over field with four or more, $1.35. Rates, $1.50 to $2.00 per Day. Livery connected. Rubber-tire buggies a specialty. John E. Hughes, Prop. For Artistic Photographs TIPTON, The Leader in Photo Fashions. Frames and Passapartouts Made to Order. C. E. Barbehenn THE EAGLE HOTEL Corner Main and Washington Sts. ©rattalatuma Literal, 50c. Interlinear, $1.50. 147vols. Sirtumaroa German, French, Italian, Spanish, Latin, Greek, $3.00, and $1.00. Completely Parsed Caesar, Book I. Haa on each page interlinear translation, literal translation, and every word completely parsed. Long rowels marked. $1.50. Completely Scanned-Parsed Aeneld, L $1.50. Completely Parsed Cicero, Oration I. $i.». HINDS. NOBLE & ELDREDOE 31-33-35 W. 15th St. New York City Schoolbooks of all publishers at one store PATRONIZE OUR ADVERTISERS. II Of Novelties for the Fall Season, including Latest Suiting, Coating, Trousering and Vesting. Our Prices are Right. SPECIAL CARE TAKEN TO MAKE WORK STYLISH AND EXACTLY TO YOUR ORDER. CUill CQ. Seligman, Taiio*. 7 Chambersbupg St., Gettysburg, Pa. R. A. WONDERS Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, etc. Scott's Corner, opp. Eagle Hotel GETTYSBURG, PA. Pool Parlors in Connection. D. J. Swartz Country Produce in Groceries Cigars and ToDacco GETTYSBURG. Established 1887 by Allen Walton. Allen K. Walton, Pres. and Treas. Root. J. Walton, Superintendent. Hiimmelstown Brown Stone Company and Manufacturers of BUILDING STONE, SAWED FLAGGING, and TILE, WALTONVILLE DAUPHIN COUNTY, PENNA. Contractors for all kinds of cut stone work. Telegraph and Express Address, BROWNSTONE, PA. Parties visiting quarries will leave cars at Brownstone Station, on the P. & R. R. R. PATRONIZE OUR ADVERTISERS. A&**44**M4**M4«444 mtt m w«. ttj - - - , I 126 THE MERCURY. VOX HOMINIBUS. BY "ATLANTIS." AROUND the purple azure hill, The river spreads its waters broad, And with its beauty calm and still, Forever murmurs praise to God. And where old ocean dashes wild And hurls the broken wrecks on shore Her thunders say to nature's child, " I praise the Lord forevermore ! " Within the forest's leafy shade Where wooing winds do softly sigh The message by the leaves displayed Is, " Glory be to God on High ! " The lowing herd, the fiery steed, By limb and form and instinct true, Give to their great Creator meed, Honor, and praise most justly due. But man, Creation's royal child, His body formed for God's own fane, Himself this temple hath defiled And mocked his maker's glorious name ! But sweeter far than Siren's song, Fair Virtue cries in accents plain " Ye men ! seek health, forsake the wrong And God's own image thus regain." _ THE MERCURY. 127 THE HOLY GRAIL OF THE TWENTIETH CENTURY. J. EDWARD LOWE, '06. THE past teems with brilliant failures. Woolsey, Solomon, Socrates, Antony, Brutus and Caesar; love, glory, dominion, disgrace, disgust, ingratitude. " He must be fenced with stronger mail Who would seek and find the Holy Grail." The king saw that few of his knights had reached the lower plane of perfect manhood. Few of King Arthur's knights knew the real meaning of the vision. They followed the Grail from curiosity or because others had seen it, therefore the quest was not for them. Their rashness raised an insurmountable barrier between them and their hopes. But we, as Sir Galahad heard, may hear the " still small voice " calling for us to follow. According to a very old tradition the Holy Grail was a cup made of one great sapphire, out of which Jesus drank wine at the last Supper. The Grail-bearer was put under a vow to be chaste and pure of heart. This cup was brought into Britain by Joseph of Arimathea and preserved in his family for many years, an object of adora-tion by pilgrims. The heathen prince Arviragus gave Joseph an isle of marsh whereon to build. Joseph was thankful to the king for this marshy spot, a place very hard to build upon ; but better than to be refused admission. Here he erected a small church, with no other material than the wattles from the marsh. He dedicated that small church to the Great Jehovah, and placed the Holy Grail therein. When it shone before the knights of Camelot, it became necessary for them to leave all and follow it. It is necessary for the knights of the twentieth century to leave all and enter this quest. One of Joseph's descendants broke his vow of chastity, and the Holy Grail disappeared. It became an object of devout search throughout the world by the knights of the Round- Table, and at last the first appearance of the Holy Grail was thus related to Sir Percivale by his sister who was a nun. » - f i i .••»-'( r * IMIMIB llih 128 THE MERCURY. "Sweet brother, I have seen the Holy Grail ; For, waked at dead of night, I heard a sound As of a silver horn from o'er the hills blown, And I thought, It was not Arthur's use, To hunt by moonlight; and the slender sound As from distance beyond distance grew Coming upon me—O never a harp nor a horn Nor aught we blow with breath, or touch with hand, Was like that music as it came ; and then Streamed through my cell a cold and silver beam, And down the long beam stole the Holy Grail, Rose-red with beatings in it, as if alive, Till all the white walls of my cell were dyed With rosy colors leaping on the wall ; And then the music faded, the Grail Past, the beam decayed from the walls and The rosy quiverings died into the night." This was told to the knights by Percivale, and they fasted, watched and prayed. Among them was Sir Galahad, called the " Morning-star," the " Sinless," and who always wore white armor. When he heard of the vision his eyes became wonder-ful and beautiful. Merlin, the enchanter, made a chair and placed it in the vast circular hall. It was carved with strange figures; like a serpent ran a scroll of letters in a tongue that no man could read, " Perilous " for good and evil. If any man sat in that chair of destiny, he would be lost. By misadventure Merlin sat in it, and died. When Galahad heard of Merlin's doom, he cried, " If I lose myself, I save myself." On a summer night while the great banquet lay along the hall, the vision came ; Galahad sat in Merlin's chair, " All at once, os there he sat they heard A cracking and a riving of the roof, A rending, and a blast, and overhead Thunder, in the thunder there was a cry, And in the blast, there smote along the vast hall A beam of light, seven times clearer than day ; And down the long beam stole the angel with wide-spread wings in celes-tial white, bearing the Holy Grail. All over covered with a luminous cloud, And none might see who bare it, and it past." Under an enchantment, Arthur and his court are sustained by a shadowy life, while the procession of the Grail passes nightly before their eyes. They can not be released by death THE MERCURY. 129 until Galahad, the unstained hero, comes into the castle, and, by asking the meaning of the Holy Grail, breaks the spell. Galahad enters their midst; but fails to ask the question. The knights waited breathlessly until he heard a voice and swore a vow. . " Sir Percival vowed before them, that he had not seen the Grail, and would ride, Twelve month and a day in quest of it, Until he found and saw it, as the nun His sister saw it; and Galahad swore the vow And good Sir Bors, Sir Lancelot's cousin, swore, And Lancelot swore, and many among the knights, And Gawain swore, and louder than the rest." Lancelot and many of the knights heard it; sorrow filled their hearts. When Arthur on his return from exterminating a band of heathen heard what had befallen them, he foresaw failure, and failure in this meant failure in all. The knights of the twentieth century do not look upon the Grail as a phantom, it has long since been revealed to them. Neither do they regard the Grail-bearer a mysterious winged form ; but we are able to imagine that we see in the centre of a great glory the appearance of a man, clad in a robe intensely white; 'above its shoulders tower the tops of wings shining and folded ; a star over its forehead glows with steady lustre, bril-liant as Hesperus ; its hands are stretched toward us in bles-sing; its face is serene and divinely beautiful." The Idyls of the King is the latest and greatest picture of man's conflict with sin and fate. The basis of the poem is found in the mystical story of King Arthur and his Round- Table. We need not stop to inquire whether Arthur was a historical character, or a myth, whether the birth-place of the legend which Tennyson has so clearly depicted in his Idyls', was on the misty mountains of Wales, or among the castles of i-ritain. Whatever the origin of the story may be, this fact is certain, that in the middle ages the name of King Arthur had come to stand for an ideal of royal wisdom, chivalric virtue and knightly power. It stands as the central figure in the Idyls of the King. Arthur formed the fair order of the Round- Table a glorious company, the flower of men, that they might have as an object: ISO THE MERCURY. " To serve as a model for the mighty world, And be the fair beginning of a time, To reverence the king, as if he were Their conscience, and their conscience as their king, To break the heathen and uphold the Christ, To ride abroad redressing human wrongs, To speak no slander, no, nor listen to it, To lead sweet lives in purest chastity." Arthur and his glorious company of knights dwelt in their great hall at Camelot. Peace came like spring, for the king had driven out the heathen, and his kingdom blossomed like a rose in richness and beauty. Constant was the pastime of the tournament, where the eye of beauty beheld the brave deeds of dauntless knights. What was the supreme signification of the quest for the Holy Grail? Undoubtedly the poet means symbolizing the attainment of spiritual perfection; this work is a parable. The struggle depicted is our own in which we are engaged every hour. The dual nature of man is at strife. Soul against sense. There is a Round-Table today. We lack Arthur, but a greater Arthur is here. We are the descendants of the knights of the sixth century, and Christians of the twentieth cen-tury. Our conflict is as severe, our goal is the same, our op-portunities are greater. " 'Tis as easy now for the heart to be true • As for grass to be green or skies to be blue, 'Tis the natural way of living." There is a Holy Grail for modern knighthood to strive for. The Grail signifies for us the attainment of a lofty character, perfected manhood, purity of life, courage, truth and all that makes a man. All free men may unite in this quest. The basis of a purpose to form a perfected character, lies not in an evil character, but in a free will. The soul is not foredoomed to a hopeless struggle, but is free to choose between good and evil; and individual destiny is decided by the choice. The past teems with brilliant failures, whose examples should be as beacons to steer us safely from the shoals of present and eternal ruin. Amb'tion establishes its shrine and nations bow THE MERCURY. 131 down and worship. But the niornful cry of Woolsey sounds in our ears : " Cromwell, I charge thee fling away ambition; " men too eagerly follow after the phantom, pleasure. The splendor of Solomon filled his brimming cup, and he drained it to its dregs, and exclaimed in despair, " All is des-tiny." " Knowledge is power," cries the sage ; that is the highest good of life. A deep pathos invaded the gloom of Socrates' last hour. He died like a philosopher, yet without hope. Antony sought for success in love, Brutus in glory, Caesar in dominion. The first found disgrace, the second dis-gust, the third ingratitude, and all found destruction. Great-ness is by 110 means the key to happiness, for some of the greatest men have been the most miserable. Neither does folly prophesy misfortune, for the fool is ordinarily lucky. Let us enter the quest for a higher ideal, work out the problem of life, not bit by bit, but in all its glorious beauty and complete-ness. Be monarchs of ourselves; sway the sceptre in our humble sphere, that we may be crowned in the Fair Celestial city, where the splendor is indescribable, such beauty the human eye has never seen. The throne of Arthur was secure and his reign began prosperously. The poet says that his poem is a tale of human life shadow-ing sense at war with soul. The conflict is in our own exper-ience and lies in the inward struggle. The king, who wore the white flower of a blameless life, is a man in whom the spirit has triumphed. His kingdom rests on this foundation. His aim was to bring his realm into harmony with himself; to build up a spiritual and social order, on which his character would be impressed with the highest and noblest thoughts imaginable. His task was to elevate his people to a higher plane, socially and morally. His greatest foes were not the heathen, for he had subdued those ; but they were the pas-sions and the evil nature in the hearts of the people within his realm. Throughout the world in all ages this conflict is trace-able. The chaste knights of the sixth century rejoice in Sir Laun-fal, " who flashed forth in his unshared mail, to seek in all climes for the Holy Grail;" also in Sir Galahad the pure, U2 THE MERCURY. called " The Morning Star." The chaste knights from the six-teenth until the present century rejoice in Luther, " The Morn-ing Star of the Reformation." The moral knights of the sixth century rejoice in Sir Percivale; those of the twentieth century rejoice in Moody; they left all vain-glorious rivalries and fol-lowed the sweet vision of the Holy Grail. The victorious souls of the sixth-century rejoice in Lancelot and Arthur, noble kings of their country. The victorious souls since the eigh-teenth- century have idolized Washington "The Father of his country; " those of the twentieth century reverence their assasi-nated president, William McKinley. Yes, the Holy Grail of the sixth century was not a phantom. It is the most splendid and most mystical description of the Idyls. The achievement of the quest was the noblest and greatest deed the chivalry of Arthur's order could attempt. The king planned for a delay of the quest, until his knights had attained the necessary degree of social order, and moral perfection. They had been to the ends of the earth in search for the Grail, only to find it at their own door, when genuine charity and love for their fellowmen took possession of their hearts. The same is true of the modern age. We should make a measure of our lives, not by days and weeks, but by thoughts and deeds ; so that when our forms are no longer seen, and our voices no longer heard, may it be said of us, that we spent our lives for the Holy Grail. THE MERCURY. 1.33 COLLEGE OPPORTUNITIES. ESSAY, '07. THERE are very few men, if any, who realize fully, when they enter college just what lies before them. They are apt to look upon the institution and to judge it from their knowledge of preparatory schools. They fail to realize to what extent their sphere of action has been changed, and conse-quently lose valuable time and opportunities before becoming aware of this great change. This, at least, was the writer's experience, and in order that others may not make the same mistake this article is written. Of course the primary thing the student comes to college for is the curriculum work, and this is the very thing that he is most liable to neglect. But it should not be fixed in mind as so much grinding to be done or as so much work to be gotten over as easily as possible, for it is nothing of the kind. The curriculum is not merely so much Latin and Greek and Mathematics mixed up with a few 'ologies and 'isms. But it is the result of years of study by master teachers and of cen-turies of experimenting. It has been evolved from the in-numerable sciences and branches of study known to man. It has been found by theory and by practice that the regular college curriculum of the present time is the course of study that best prepares a man for an active place in the world, and best rounds out his personality. The professors by whom the studies are directed are men of great experience—men who are especially strong in their departments. This advantage of expert instruction the stu-dent has throughout his entire course. It is no small oppor-tunity for students to have such a course of study under such direction open before them. It should not be neglected in any particular, for if it is, the student will awake, as many be-fore him have done, after a year or two have passed by, to find that he is losing in the race—that he is not gaining in its en-tirety that for which he came to college. The curriculum, then, is the primary object. There are opportunities within it, however, of achieving success along M '34 THE MERCURY. special lines. The prizes are offered for this purpose. They are stimuli to greater proficiency. The opportunities for literary attainment are almost unlimited. The inexhaustable libraries will furnish the best books, both of referance and of literature, that the student may need. The essay prizes are incentives for the cultivation of his literary talents. The Literary Societies offer opportunities for practi-cal experience in writing, in public speaking, and in clear thinking while before an audience. They offer training in composition, in oratory, in debate and in various other literary exercises, all of which are of the greatest importance to the college man. The college publications offer additional oppor-tunities for literary experience, such as managing or editing a paper, or more generally, writing up for publication any event of importance, or putting in presentable form the ideas one may have about a certain subject. It is a valuable experience to be on the staff of one of the publications, or at least to be-come a contributor to their columns. There is much to be gained, or lost, by the associations in college. The student's success depends, more than he knows, upon the company he keeps. To be one among several hun-dred young men of high ideals and aspirations is a privilege granted to comparatively few. There are all kinds of men in this student body, men who will be among the leaders of the world's activity in the coming years, and men who will never be anything more than ordinary. If he chooses the former (men) as his companions, his work and habits of study will grow like theirs, easy and natural, and become a source of pleasure to him. But if, on the contrary, he should select the latter men—those who spend much of their time loafing about the pool-room, the cigar-store, or the hotel, letting their golden opportunities slip by unheeded—his inclination will grow along this same line and the object and aim of his college course will, in some degree, be lost. The Y. M. C. A. offers another broad field of action. The active Y. M. C. A. man becomes prominent among the students and weilds an influence for good. It is advantageous to the student to take an active part in this work. It brings him into I THE MERCURY. 135 closer touch with a larger number ol students and he profits by it. This in itself is a broad field and might be dwelt upon to some length, but space does not permit. College offers many other opportunities in addition to the ones before mentioned. For instance, the musical clubs, the orchestra, the dramatic clubs, all with their training and enjoy-able trips, athletics, with all that goes with them, all are in-viting the student to enter them and profit thereby. But all this requires work, in fact, every opportunity offered by college implies work on the part of the student. So we might say, in a word, that the great opportunity a college offers is Work. But it is the right kind of work, and the 'right degree of work to meet the needs of the student. The ideal college life, then, is the well planned, well regulated, strenuous life. So, since we came to college to work and the college offers us work in abundance, let us not be turned away from our purpose by any momentary pleasure-giving avocations, but let us rather do as much work as possible and thereby lay up for ourselves imperishable treasures of discipline, knowledge and power. A PLEA FOR POETRY. BY S. E. SMITH, '07. IN the childhood of the world, in the rosy-fingered dawn of Greek civilization, history and literature began. The ac-cumulated fancies of the ages united in the story of the wrath of Achilles and of the wanderings of Odysseus. The mighty warriors of that day were models of physical courage and de-lighted in slaughter and destruction. Yet, when their feuds were laid aside for a time, they were not ashamed to listen to the deeds of war, love and revenge, clothed in the sensuous imagery of that age. The Odyssey frequently tells us " and a divine bard sang gloriously." Indeed the poet was a welcome guest in the palace of every Achaean king. The land of Aeneas brought forth its bards and in the Augustian age they were 136 THE MERCURY. among the most honored of men. The populace loved poetry and the proud patricians were not slow in helping a poor poet. Thus, Horace, a clerk, becomes a gentleman of leisure under the patronage of Maecenas. In all the Imperial city there was a genuine love for the Muses' art. When the mistress of the world gave way before the barbarian hordes, the love of song still continued. The Germans, with all their vigor and brut-ality, were delighted with the rude rhymes of their day. Our Saxon ancestors loved the fierce lines of Beowulf, brimful of a coarse brutality and horrible murders. Such was the poetry which delighted our Saxon forefathers as they drank and ca-roused in their banquet halls. And then, when the scene of the world's progress shifted to the British Isles and Albion as-sumed the leadership in the world's affairs poetry was given a new impulse. The long line of poets from Spenser to Tennyson have fashioned for themselves monuments which will endure. In England the poets have received every consideration. Many of them have been pensioned by the government. The office of poet-laurate has been a glittering ideal for every English bard. The free air of America has inspired many of her rugged sons to song and during the past century a noble company of poets appeared. Thus, have the poets flourished since the earth first cradled the infant soul of man. They have been universally loved because they have spoken to the heart. They have furnished the inspiration tor useful deeds. They have supplied the balm of Gilead for many a heart wound. They have armed the mightiest of warriors, they have soothed the most timid of women. The kingly Gladstone found daily help in the study of Homer. His manly character gained strength for mighty political battles through contact with the poets. Such has been the influence of the poetic muse upon the world. But times have changed. In this land of ours a new influence has appeared. It has quickened the national pulse. Under its spell material progress has been so great that the sluggish blood of Europe has been amazed at the rush of our national life. Today America is setting the pace for the rest of the world. In the material things of life Columbia is supreme. But as a nation we have paid for this supremecy. THE MERCURY. 13; We have given up that which satisfies the soul for that which delights the body for a time. As a nation we are unacquainted with the poets. Of course everyone knows the names of the great poets and can tell works they have written. But how many are acquainted with the works themselves ? How many can repeat from memory a half dozen lines from the works of four different poets ? We Americans no longer see visions in the poets' lines. We are too commonplace. We have for-gotten that the poets have clothed the infinite in finite terms. Indeed, by foresaking the poetic Muse, we have lost the very breath of heaven. What is the cause of this national indiffer-ence to the masters of English verse ? Let me tell you a story. Two lads of nine go out for a walk in the woods and with child-like eagerness search for treasures. The one is attracted by the smooth stones, gleaming in the bed of the foaming brook. He takes off his shoes and stockings and wades in the rushing waters. He gathers a great heap of the shining pebbles. He fills his pockets and places the rest in his hat. The other boy cares not for the flinty baubles but finds delight in the flowers growing on the grassy bank of the stream. At length they start on their way homeward. The pebbles in the hat become so heavy that their owner is obliged to fling them away and those in his pockets become so heavy that they are a burden. At last they reach their home and the boys show their treas-ures. The first boy tired out by his heavy burden drops the stones on the floor and the white pebbles are not as beautiful as when they lay in the bed of the stream under the bright sun. The second boy puts his flowers in water and for a week their soft colors are a reminder of the glorious woods. Like the first boy we Americans are too much occupied with the pebbles, material things of life. We neglect the flowers, the poetry of life, which can open to us a glimpse of the eternal. It is no wonder that Americans grow old before their time, that when we contemplate the temporal comforts which we have secured, there comes a satiety which is almost a loathing. The Ameri-can method has made life a scramble for wealth and position, a ceaseless round of duties. No time is there for a fellowship with earth's choicest spirits. The business man will tell you he 138 THE MERCURY. has no time for poetry. We of the coming generation are catching his spirit. Oh, what a mistake! By shunning the companionship of the poets we are cutting ourselves off from the noblest thoughts of the world. Our plea is for a wider ac-quaintance with the poets. Our desire is that the gems of poetry may be fixed in the halls of memory. The poet has a message for every experience of life. Thus, when the tempter comes luring us into the paths of questionable pleasure, the message of the Scottish bard rings out: " Pleasures are like poppies spread, You seize the bloom, its beauties shed ; Or like the snowfall along the river, One moment white, and melts forever ; Or like the Borealis rays which flit Ere you can point their place ; Or like the rainbow's lovely form, Evanishing amid the storm." When the madness of man is upon us and in our folly we be-gin to judge our fellowmen, Joaquin Miller, the poet of the Sierras, reminds us: " In those whom men pronounce as ill I find so much of goodness still ; In those whom men pronounce divine I find so much sin and blot. I hesitate to draw the line When God has not." When we are dissatisfied with our surroundings and long for distant scenes, we should hear the mild rebuke of Emerson: " Why see Italy Who cannot circumnavigate the sea Of thoughts and things at home but still adjourn The nearest matters for a thousand days ? " The poet has a message for those who buy and sell. would be fewer bad bargains if Lowell's lines were memory: 1' Earth gets its price for what Earth gives us, The begger is taxed for a corner to die in, The priest hath his fee who comes and shrives us, We bargain for the graves we lie in ; At the Devil's booth are all things sold, Each ounce of dross costs its ounce of gold ; There held in THE MERCURY. 139 For a cap and bells our lives we pay, Bubbles we earn with a whole soul's tasking ; 'Tis heaven alone that is given away, 'Tis only God may be had for the asking." And then, when life is dark and disappointment and the end of lile are like clouds in the way, how comforting is Tennyson's expression of an eternal hope: " Sunset and evening star And one clear call for me, And may there be no moaning of the bar, When I put out to sea. " But such a tide as moving seems serene, Too full for sound and foam, As that from out the boundless deep Turns again home. " Twilight and evening bell, And after that the dark ; And may there be no sadness of farewell When I embark.- " And though from out the bounre of time and place The flood shall bear me far, I hope to see my Pilot face to face, When I have crossed the bar." These are a few poetic gems from the inexhaustible minds. They are not for weaklings. Poetry is not effeminate as some have affirmed. The ages acknowledged it the language of the soul. It unites the mortal with the immortal. It brings the largest vision of opportunity and service. The way is open- Nature abhors a vacuum. Our minds must think some thoughts. Shall we allow the cares and worries of our present existence to cloud minds which are immortal ? Let us keep our hearts in harmony with the Infinite by a companionship with the poets. Then will our souls rise from things of earth to their eternal home. V1/ - 140 THE MERCURY. TOM LAYMOND'S DECISION. STORY. DARE I keep on playing ? How can I give it up? Is it wholly impossible lor me to become both an athlete and a scholar ? These were the words that involuntarily fell from the lips of Tom Laymond as he sat alone in his cosy room in one of the dormitories of the Newton College in one of the New England States, trying as he had tried time and time again, since entering college, to decide whether he should give up his football and his prospects of a position on the " Varsity" eleven and devote all his time to study. Tom Laymond had been born and reared in the little village of Compton in the heart of the Green mountains, and there among the hills and valleys he had developed a strong, vigor-ous body as well as a keen and energetic mind and it was little wonder that during his three years in the acadjmy of a neighboring village he had developed into a star half-back idolized and envied by all the boys of the academy. Now he had entered college and during the two short weeks that he had been there, he had shown such promise that coach Weston had already given him a position as sub-halfback on the " varsity " eleven and had spoken so encouragingly that his hopes for a permanent position were high and not un-reasonably so. But as he had found the opportunities for ath-letic development much greater at the college than at the academy; he found also that his studies would be more diffi-cult and would require much more time. At the beginning of his college career Tom had promised his parents that he would never allow anything to tempt him to neglect his studies. And now he found the questions already mentioned confronting him. With his love for football and his desire to be a great athlete, battling against his determination to keep up his stand-ard of scholarship, no wonder the struggle was a hard one and had to be fought over and over again. Matters with Tom continued this way for several days. Sometimes he would almost determine to play football, regard-less of the cost, and again he would almost decide to give it up. But he kept hard at work under Coach Weston, who being THE MERCURY. 141 much pleased with his efforts placed him in a game with one of the rival colleges as " varsity " half-back and kept him in during the entire game. It was a hard contest but Tom was finally pushed over the goal line for a touchdown which won the game. And as he limped wearily from the field, Jack Leighton, one of his warmest admirers, called him aside and introduced his sister Hazel. Bruised, torn, and covered with the dust and dirt of the battle, it was little wonder that Tom felt slightly confused as he looked into the face of this fair maiden. For Hazel Leigh-ton was beautiful enough to set the heart of any man throb-bing, let alone that of this young athlete. Tom hurried away to dress but those few moments that he had gazed into the face of Hazel Leighton had wrought a great change in the heart of Tom Laymond and more than this as he hurried away to-ward the gymnasium he overheard some words of admiration which she spoke to her brother. That night the battle with Tom raged more fiercely than ever. A new and powerful argument had sprung up in favor of athletics, for he cherished in his heart the image of beautiful Hazel Leighton, and her words of admiration were constantly passing through his mind. In spite of all this he stood firmly in his resolve to maintain his scholarship and finally after toss-ing upon his bed until dawn was stealing over the eastern hill-tops, he arose determined that he would give up neither but become both an athlete and a scholar. So quietly and earnestly he went to work on his lessons for the coming day. Having made this decision Tom went about his work and play with an energy and determination that invariably conquers all difficulties, yet many were the trials with which he met dur-ing the remainder of his course, and at times he thought that he would have to fight the old battle over again. But gradu-ally the season drew to a close and with his mind and energies all centered on the final game with Goston University he for a time forgot his troubles. The day for the game finally arrived and early in the after-noon it was called. Before many minutes it was seen that the teams were well matched, so well indeed that during the first - ■ -w l^f^' ' 142 THE MERCURY. half each team scored a touchdown ; but during the second half the ball surged back and forth near the center of the field ; first in possession of one side and then of the other. Finally, with only three minutes to play, Tom broke through the line and by a brilliant dash carried the ball over. For a while it seemed that the Newtonians had gone wild. Cheer after cheer they gave and, rushing from the sidelines, they seized Tom and carried him from the field in triumph. Yet amid all his glory Tom could not fully enjoy himself until he met the smiling eyes of Hazel Leighton and heard her words of praise. Then he gave himself fully to the enjoyment of the occasion feel-ing that those few words from her lips far excelled the plaudits of all his fellow-students. Football season being over Tom soon found time beginning to drag and also to his amazement that he made little, if any, improvement in his class standing, because he was neglecting his physical training and he soon began to see that physical and mental training should go hand in hand; for the trained mind is worthless in a ruined body and a strong body is power-less without a mind to guide it. So each day he was more impressed with the wisdom of his decision to become both an athlete and a scholar. Thus Tom continued throughout his college course. He became not only a football star but also a " forward " on the basketball team and " crack " shortstop of the baseball nine. Yet his work did not suffer and at the close of his college course he ranked second in his class. But he won also what he prized far more than all his honors and that was the heart and hand of Hazel Leighton, and one beautiful evening in June as they strolled along the pathway from the college talking, of the days when they were almost strangers, Hazel turning to Tom said : " Now. I want to tell you how I first came to love you. I admired you first as an athlete, afterward as a student; and I soon found that one worthy of so much admiration was worthy also of my love." And Tom clasping her in his arms replied: " Then you also, above all things else, I owe to my decision." THE MERCURY. 143 CHARACTER AND ITS INFLUENCE. Bv ZENAS O. FISCUS, '07. Character is one of the greatest motive powers in the world. In its noblest embodiments it :xemplifies human nature in its highest forms, for it exhibits man at his best. Although genius may command admiration, character the more secures respect. The former is more the product of brain-power, the latter of heart-power, and in the long run it is the heart that rules in life. A man to possess a noble character need not be a great man as the world classes great men. That man has a true, noble character who uses his gifts rightlv and does his duty in what-ever station of life he may be situated. At the same time while duty, for the most part, applies to the conduct of affairs in common life by the average of common men, it is also a sustaining power to men of the very highest standard of character. They may not have money or property or learning or power; and yet they may be strong in heart and rich in spirit. And whoever strives to do his duty faith-fully is fulfilling the purpose for which he was created and is building up in himself the principles of a manly character. Intellectual culture has no necessary relation to purity or excellence of character. A man may be accomplished in art, literature and science and yet in honesty, virtue, and the spirit of duty might well pattern after some poor, illiterate peasant. But back of character lies a chain of actions, thoughts, and feelings each of which contributes to the education of the temper, the habits, and the understanding, and exercises an in-evitable influence upon al! the acts of our future life. There-fore with the light of great examples to guide us, every one is not only justified but in duty bound, to aim at reaching the highest standard of character. Men of high character carry its influence wherever they go When Washington consented to act as commander-in-chief of the patriot army during the Revolutionary war, it was felt as if the strength of the American forces had been doubled. Again, many years later, in 1789, when Washington, grown old, had withdrawn from public life and was living in retirement at Mt -.-.- . ■ -*- — . .--.'., «.-«. - 144 THE MERCURY. Vernon, and war with France seemed imminent, President Adams wrote to him saying, " We must have your name if you will permit us to use it; there will be more efficiency in it than in many an army." Such was the esteem in which the great President's noble character and eminent abilities were held by his countrymen. Thus Washington left behind him the ex-ample of a great and noble character as a model for his nation to form themselves by in all ages to come. Then again a nation must possess character if it would en-dure and this is secured only through the character of the in-dividual. Where national character ceases to be upheld a nation may be regarded as next to lost. When such a state is reached that honor and obedience are seemingly lost, the only remedy is the restoration of individual character and if this be irrecov-erably lost there will be nothing left worth saving. THE MERCURY. 145 THE CONSUMMATION. w F. MOSER, '07. HY should we turn to lesser art When free in nature 'round By far degree the rarest hue, The truest song is found ? Awakened by the day's decline, To life they quickly spring, While o'er the land in joyful tones All nature's heart doth sing. What hue is like the dying hue The darkening evening holds ? Its crimson and its amber sweep In rolling, swelling folds? Among the kingdoms of the clouds, The monarch's royal robe, It well portrays in flashing rays That monarch's crown is love. What note is like the swelling chord That from the wild birds come, When at the evening winging swift To distant forest home? Its melody floats earthward While the volume rolls along, As 'neath the sky swift passes by The songster and his song. It almost seems as if the sky Were painted in our sight While from its portals sweetly sounds The chorus of the night; And though the arching dome may seem To lose its last bright ray, The gloom but serves to usher in The glory of the day. ^MflNBfl 146 THE MERCURY. "THE SPECKLED HORSE." BY H. A. MCGILL, '06. The time—evening of Feb. 7th, in the year of our Lord 1902; the place—the great city of London ; and the man Jim Grath —criminal, ex-convict and kidnapper. " I'm tired, so tired, sir, you said we'd soon see the Beautiful Lady." The brave little voice quivered pitifully, and the great blue eyes of the tiny lad in kilts, looked up fearlessly, if full of tears, into the hardened face of the man. All day long they had tramped these two, " miles and miles " it seemed to little Rob, from the handsome home where he had lived with the " Beautiful Lady," to the strange and narrow streets through which this queer man now hurried him. The " Beautiful Lady " was a name the child had given to the step-mother, whose short stay in the home of his grave, silent father had brought days of unknown and undreamed of happiness to little Rob. Days, which had suddenly passed away, when one stormy night, she came with* flushed face, and tear-bright eyes, to say good-bye to him. "Why had she gone ? The question had been in the child's mind ever since that fatal night, but he dared not ask the father, whose love had, until her coming, been the one bright spot in his lonely little life. For, to this, the child of his first wife, the man, judged by acquaintances to be cold, haughty, and mercenary, had given the love of a heart long hidden from the world, and the child, in the wonderful wisdom of his childhood, had accepted it without question. In this same spirit of unquestioning faith, the boy had held out his tiny hands to the " Beautiful Lady," when she came through her marriage of convenience, to the home of the man whom the world called her fit companion for life's journey, the man who seemed as cold and proud as she herself. So it was, that despite her bitterness, and her cynicism, this little child had wrought a miracle, and through the love which sprang up in her heart for the son, grew the love, that suffered in secret for the father. Of course this state of affairs should have soon ended in a wonderful " finale" of enlightment for the man,and joy for the THE MERCURY. 147 woman, the chief goal of the romantacist should have been reached at once, and " all gone merrily as a marriage bell." Yet real life rarley runs along the lines of romance, and sad truth compells the statement that these unhappy people were at last forced, through their many quarrels, into a permanent separation. These things, however, Rob could not understand. Had not he said that he would take care of her, and buy her everything in the world, when he was a big man ! But she had only smiled at this generous offer, and hugged him tight, so tight, that it almost hurt, then put him down quickly, and gone away out into the dark night, never to come back to him again. Now, this morning while he played near the edge of the park, all alone with his thoughts, this strange, good-natured man had come. He had told him all about her, the " Beautiful Lady," and the man seemed to know her well, and had prom-ised to take him to her so that he could ask her again to stay with him. She had given him the Speckled Horse, maybe she was sorry now, and wanted him for herself. " You see the Speckled Horse is very nice" he had told the strange man as he showed his treasure, " and maybe she will come back if she can have him again." But now he was very, very tired, and the Speckled Horse was so heavy. He seemed to have sharp edges and points all over him, that stuck into Rob's arms and chest as he walked, and hurt, then, all of a sudden, he jumped out of his arms, and went rolling off into the gutter, and Jim, the strange man, who now did not smile, any more, but scowled, gave Rob a hard jerk when he tried to go after him, and said " come along in here young one." He did not even seem to remember that "the Speckled Horse was very nice'' and " had belonged to her." Into a strange, foulsmelling house they hurried, and left that wonderful steed to perchance an awful fate. Rob could not understand again, and he sobbed aloud. Lights hurried to and fro in the great suburban mansion, and over its surrounding parks. All afternoon the searchers had been working, and now returned only to report fruitless labors, and start once more upon their quest. To the man who sat there worn with anxious dread in the midst of his 148 THE MERCURY. riches, the minutes dragged as hours and were far out-stripped by his bitter thoughts. Suddenly upon the threshold of the great library door stood the woman; she, whom he had thought to use as a figure-head in his handsome mansion; she, whose beauty was to have impressed his acquaintance, just as his wealth and position had already done ; the woman, to whom much had been given, according to his worldly stand-point, but who had failed him, and repaid his bounty by the disgrace of his name. With one quick impulsive gesture she held out her arms toward him, then suddenly dropping them asked, in a voice so broken and changed, that he scarcely recognized it, " The boy, have you not yet found him ?" He rose quickly to his feet and, faced her in his bitterness. " What is that to you ?" he said, "You can not care, or else you would not so soon have left both him and me. Why do you come here now to taunt me that I have lost him ?" Turning her face from the scorn of his angry eyes, she answered brokenly," "Because I loved him too, and——" " And ? and what ?" he questioned," You," came the almost inaudible reply. In the great room silence reigned—a silence that could be felt; then, as a log burned itself out and fell upon the hearth the man lifted his bowed head and crossed over to his wife. As he raised her down-cast face between his hands, he looked deep into the eyes, where sorrow struggled with a light before unseen, and said in a voice made gentle through a great hu-mility. "Let us go, and search for him together." [TO BE CONTINUED.] %> THE MERCURY Entered at the Postoffice at Gettysburg as second-class Matter VOL. XIII GETTYSBURG, PA., OCTOBER, 1905 No. 5 Editor-in-chief HARRIET A. MCGILL, '06 Exchange.Editor MARY B. MCGILL, '06 Business Managers THOMAS FAUST, '07 E. VICTOR ROLAND,'07 Associate Editors - H. F. SMITH, '07 CLIFFORD HARTMAN, '07 W. B. RICK, '07 Advisory Board PROF. J. A. HIMES, LITT.D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D.D. Published each month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance; single copies 15 cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Busi-ness Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. To the Freshmen of Pennsylvania College : Dear Friends, Years come and go, and once more it is the duty as well as the great pleasure of a MERCURY staff to welcome the new class which has entered the portals of our Alma Mater. Wel-come— how significant is the word, what hope of future promise does it contain, and how great the expectations which its utter-ance arouses. We need you, newcomers, that is what it means. We need you in the Y. M. C. A., in the class-rooms, on the athletic field, in the halls of our rival literary societies, and greatly indeed does the MERCURY need your help and coopera-tion. Do not let the feeling that you are strangers withhold your interest in your College—she belongs \.o you, use her. If I50 THE MERCURV. you have ambition, do not fear the fate of brave Caesar; there is no " honorable man " among our higher classmen who will condemn you—start in and win. There is, for instance, a priz*, which the Pen and Sword society has offered for the best pro-duction of any kind, to be published in our college monthly. There are but three more numbers to be issued by the present staff, and until this number, no one has tried for that prize Do you wonder that you are needed ? Any person handing his prc-duction and a nom de plume to Dr. Himes has a fair trial (or the winning of this prize. One person may write as many articles as he desires, all will be noticed. Do not let our student-body be shamed before the Alumni of the Pen and Sword by the ingratitude of not even trying for the prize, which they so kindly offer. There are more ways than one to show that you are worth something to your Alma Mater. Try this one, Freshmen, and good luck to you. Sincerely, "THE STAFF." As we begin another year in our college course it will be profitable, perhaps, to old students as well as new, to say a few words on athletics. Not to expound many new facts and theories but to impress one and all with the necessity of ath-letic training and encouragement. We have come here to develop and strengthen our minds to encounter the many disappointments, failures, successes, etc., in life. We must keep in mind, however, that an exceedingly well developed mind can accomplish little without a sound, healthy body. Take advantage of our athletic field, gymnas-ium, tennis courts, etc., in your spare moments, and you will develop with your mind, a stronger, healthy body. One is necessarily a companion of the other and if you have ambition some day to amount to something above the ordinary it is nec-essary for you to be sound in body and mind. Then, in concentrating your efforts with those of others, you will be able, if not to make a varsity, to help develop one. This is where the true college spirit lies. No varsity can sue- THE MERCURY. 151 ; ceed without a second team and, when the true love of Alma Mater is present, each one strives unselfishly toward the better-ment of the varsity. Thus in bettering yourself you can at the same time by sincere cooperation promote the standing and welfare of your College. Further, if through some reason you are not able to lend your efforts to the physical making of the varsity, give them good honest support. All efforts will be in vain unless there is a loyal support by the entire student body. Learn the yells and don't be afraid to use them in encouraging the team. When asked for financial support give it promptly and as lib-erally as possible. Give all candidates encouragement and don't be too ready to find fault with the coaching, placing and management of the teams. In short, give your attention to the welfare of the college, which surely includes all that has here been said, and be a good, loyal College man. c. H. The Senior was weary: He had finished his last summer vacation at home, and well launched upon the duties of his last Collegiate year, had been thinking of the future. He had planed wonderful things for himself, this Senior. A career already marked with the word success, a position secured immediately after his graduation, " health, wealth, happiness," and in short many things. In the meantime, however, the Senior fell asleep. It was then that there came to him a strange dream, and a strange vision—the meaning of which he cannot understand so he fain would inquire from the seers of his Alma Mater, as to the interpretation thereof. Although the Senior had never been an athlete he saw himself in the garb of an acrobat, and heard, above the sound of a great concourse of people, the voice of a trainer, whom he had never seen before, yet whose personality seemed strangly familiar, speaking to him, and giv-ing him his final directions. It seems that his task was the climbing of a great promontory, along which there were cer-tain resting places to which the trainer could follow him with ad-vice and encouragement. From the top this eminence how-ever, could be seen a great mass of ice and snow which must i 152 THE MERCURY. be lept before the acrobat could reach another promontory, from whose height he must cast himself into the crowd below. And, in order that through this last feat he might come to no harm, the Senior had prepared for himself a matress to throw before him, and make for himself a landing place. Slowly, and with much hope in his heart he began the ascent, and upon the first resting place was the trainer, who with words of cheer bade him pass on. So was it with the second and third stages, but when he reached the top, without thought of the faithful trainer, he flung his matress before him, and leaped through ice and snow upon the other promontory. So far, all had been well, it was here that fear sized him, as he gazed upon the great depths be-low, and strained his eyes to find a vacant place in the multi-tude where he could throw his matress. It was then, that he burried his face in his hands, and cried in great despair to the trainer, seeking aid in his distress, yet scarce expecting it. Then suddenly as he faltered trembling upon the brink, his trainer as by a miracle stood beside him, and pointing to the matress at his feet, said in that gentle, patient voice, with which he had been want to coach him. " It is too broad— you must return, and make for yourself a narrow one, thus alone will you find room in the crowd below. It was then that the Senior awoke, and now in his bewilder-ment, would know the interpretation of his dream. In truth his wish shall be granted, for he has been blessed above his fellows through the spirit of warning. Thus say the seers. The first promontory is the College course—the second the symbol of his position after leaving his Alma Mater before he has taken his place in the world; the matress is his idea of what that place shall be, and the trainer, well the trainer is known to all men, his name is Experience. PATRONIZE OUR ADVERTISERS. } /*■ FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames. Repair Work done promptly. Under-taking a specialty. * Telephone No. 97. L Bendei 37 Baltimore St., Gettysburg, Pa. The Windsor Hotel 1217-29 Filbert St., Philadelphia. Headquarters for Students. Thoroughly Renovated, Refurnished and Remodeled FRANK M. SCHEIBLEY, Manager. Graduate of Lafayette College 1898. A Complete Encyclopedia of Amateur Sport Spalding's Official Athletic Almanac FOR 1905. EDITED BY J. E. SULLIVAN (Chief of Department of Physical Culture. Louisiana Purchase Exposition). Should be read by every college student, as it contains the records of all college athletics and all amateur events in this country and abroad. It also contains a complete review of Olympic Games for the official report of Director Sullivan and a resume of the two days devoted to sports in which savages were the only contestants, in which it is proved conclusively that savages are not the natural born athletics we have heretofore supposed them to be. This is the first time in which the athletic performances of savages have ever been systematically recorded. This is the largest Athletic Almanac ever published, containing 320 pages. Numerous illustrations of prominent athletes and track teams. Price rp Cents. For sale by all newsdealers and A. G. SPALDING