Suchergebnisse

Issue 18.4 of the Review for Religious, 1959. ; Two, Prayers John XXIII Prayer for the Church of Silence [On January 23, 1959, the Sacred Penitentiary pub|ish~d the Italian text ~f a prayer composed by the Holy Father for the. Church of Silence. The original text, a translation of which appears.below, is to be found in Acta Apostolicae Sedis, 51 (1959), 112~13. A partial indulgence of three years can be gained by the faithful when they recite the prayer with contrite heart.] OJESUS, Son of God, who lovedthe Church and who gave Yourself for it to sanctify it and to make it appear before You glorious and immaculate (Eph 5:23-27), look down with mercy on the painful conditions to which Your mystical spouse is subjected in certain parts of the Catholic world and especially now in the great nation of the Chinese. ! See, O Lord, the treachery that threatens the souls of Your faithful' and consider the calumnious insinuations leveled against Your pastors, Your ministers, and Your faithful followers who long to spread the truth of the Gospel and that kingdom of Yours which is not of this world. How insistent and dangerous are the attempts to tear the seamless robe of Your spouse, the one, holy, catholic, apostolic, and Roman Church, by separating the hierarchy and the local communities from the only center of truth, authority, and salvation, the See of Peter! Before this spectacle of such grave evils, we ask first of all for pardon for the offenses which are being committed against You. In truth the words spoken by You to Saul of Tarsus on the road to Damascus, "Saul, Saul, why do you persecute Me?" (Acts 9:4), can well be repeated today, as they could be in the course of recent and past history. We trust always in the efficacy of the sublime words You addressed to Your Father from the cross, "Father, forgive them, for they do not know what they are doing" (Lk 23:34). As Your sacrifice was the source of universal salvation, so through your grace may the martyrdom which the Church, Your spouse 193 JOHN XXIII Review [or Religious and our mother, suffers in different regions bring salvation all men. O Prince of Peace, grant that the bishops and the priests, the religious and the laity, may always and everywhere be "solici-tous to preserve the unity of the spirit in the bond of peace" (Eph 4:3). May Your omnipotent power overcome every hu-man calculation so that pastors and flocks may remain obedient to the voice of the only universal Pastor, the Roman Pontiff, who feels in his heart the responsibility of that supreme desire of love: "Holy Father, keep in Your name those whom You have given Me, that they may be one as We are" (Jn 17:11). Finally~ O Redeemer, look with satisfaction at the merits and prayers of Your and our Mother, the august Queen of the missions and of the universal Church; look at the labors, the sacrifices, and the blood of "the innumerable heralds of the faith who have always and are still giving heroic testimony to You; and, mindful above all of Your precious Blood shed for many for the remission oz sins, give Your peace to China and to the entire world, because in no other is there hope and victory .and peace, but only in You, our Lord and immortal King of the ages and of the nations. Prayer to the Eucharistic Christ [The following prayer, the orighaal text of which is given in Acta Apostolicae Sedis, 51 (1959), 163-64, was composed by the Holy Father as a preparation for the coming International Eucharistic Congress to be held in Munich, Germany. His Holiness (AAS, 51 [1959], 164) has granted a partial indulgence of ten years to the faithful who devoutly recite the prayer with contrite heart; moreover once a month they may gain a plenary indulgence under the usual conditions, if they have recited the pra~,er daily for a whole month.] O Jesus, King of nations and of ages, accept the acts of adoration and of praise which we, Your brothers by adoption, humbly offer to You. You are "the living Bread come down from heaven which gives life to the world" (Jn 6:33) ; High Priest as well as Victim, You offered Yourself on the cross in a bloody sacrifice of expia-tion to the Eternal Father for the redemption of the human race; 194 July, 1959 Two PRAYS.US and now each day You offer Yourself on our altars by the hands of Your ministers so that there might be restored in each heart Your "kingdom of truth and of life, of holiness and of grace, of justice, of love, and of peace~' (Preface of the Mass of Christ the King). O "King of Glory," may Your kingdom come! Rule from Your "throne of glory" (Heb 4:16) in the hearts of children so that they may keep immaculate the shining purity of their baptismal innocence. Rule in the hearts of youth so that they may grow in wholesomeness and purity and in docility to the voice of those who represent You in the family, in school, and in the Church. Rule in the heart of the home so that parents and children may live united in the observance of Your holy law. Rule in our country so that in the harmonious ordering of the social classes all its citizens may regard themselves as children of the same heavenly Father, called to work together for the common temporal good and happy to belong to that one Mystical Body, of which Your Sacrament is both the symbol and the everlasting source. Rule, finally, O King of Kings and "Lord of Lords" (Deut 10:17) over all the nations of the earth and enlighten the rulers of each nation that, inspired by Your example, they may nourish "thoughts of peace and not of affliction" (Jer 29:11 ). O Eucharistic Jesus, grant that all people may serve You freely in the knowledge that "to serve God is to reign." May Your Sacrament, O Jesus, be a light to the mind, a strength to the will, an attraction to the heart. May it be a support to the weak, a comfort to the suffering, a viaticum of salvation to the dying, and for all may it be a "pledge of future glory." Amen. 195 The Rest:oral:ion ot: All Things in Christ: Richard Cardinal Cushing, D.D., UL.D. [The following address by the Cardinal Archbishop of Boston was delivered as the main address of the Sacred Heart Institute for Nuns conducted by American Directors of the Apostleship of Prayer and held at Roberts Center, Boston College, on April 4, 1959.] THE DEVOTION TO the Sacred Heart makes no appeal whatever to those outside the Church and to some within the Church. It is the story of a nun who had a vision of our Lord in which He showed her a wound on His side. Then He said to her: "Behold the Heart which loves so much, and is loved so little in return." What is this but sentimentalism, and a kind of senti-mentalism which does not appeal to people of our times. My dear Sisters: Is there anything more undignified than the figure of the rejected lover who cannot keep his abandon-ment to himself, but must go about exposing his wounded feel-ings for all the world to see, inviting sympathy because he unloved? Yet that is the figure under which Divine Love rep-resented itself to the apostle of the Sacred Heart--St. Margaret Mary. Why? It may help to understand the answer if we recall that all through the Old Testament this is the kind of language in which Almighty God refers to the disloyalties of His people. The covenant which He made with the Israelites when He brought them out of Egypt was like a marriage contract com-mitting both sides to fidel.ity; and when they turned to the wor-ship of idols, he appealed to that covenant. "And thou," He says through the prophet Jeremias, "and thou with many lovers have been unfaithful; come back to me, and thou shalt find welcome." This is pleading language, and it is God who pleads. When a prophet of the Old Testament speaks like that, he is using a metaphor. The Old Testament is full of metaphors. When others talk about God raising His hand, stretching out 196 I:~ESTORATION IN CHRIST His arm, keeping a watchful eye over His friends, giving a ready ear to their prayers, we'do not think that God, who is pure spirit, has hands or arms or eyes or ears like ourselves. And so it is when God describes himself as a jealous lover. He means that if He were a man, this is how the infidelity of His friends would affect Him. If He were a man? In the fullness of time, He became man; He trod our earth, and was subject, as man, to the play of emotions; He wept and rejoiced. He was indignant, and felt fear. The metaphors had come true at last: God Incarnate really saw with human eyes and stretched out a human hand to save us. And He was accessible like ourselves, to the expressions of feeling which we find so difficult to control. When an injury was done to the honor of His Father in heaven, He flared up; and we read in the New Testament: "Jesus looked upon them with anger." The success of His first missionaries gave Him the same feeling which comes to you and me when good news reaches us, and we read that "At that time, Jesus was filled with gladness." The tragedy of a friend's death was told him. The sad news drew from Him, as it would from us, a 'tribute of natural tears and we read: "Jesus wept." Our Lord did not even hide from us His disappointments: "Jerusalem, Jerusalem, still murdering the prophets, and stoning the messengers that are sent to thee, how often have I been ready to gather thy children together, and thou didst refuse it!" How often--He looks back over the sad record of Jew'ish history; the authentic accents of a Divine Person pierce through the veil of His humanity and here is God weeping with human eyes over tl~e pent-up sorrows of a human heart. Now I think we have the real meaning of the Sacred Heart devotion; it translates the Divine Nature into human terms for us. After all, we find it hard, don't we, to get God into our mind-picture? We cannot portray Him--His glory dazzles us; we are confused b~ the thought of the enormous gulf which lies between Him and creatures. We know that His Providence 197 CARDINAL CUSHING Review for Religious extends over all His works; He cares even for the sparrows, and yet. He is so great, and we are so small! Even our sins-- just an unkind word said about a neighbor, and we tell ourselves and we confess that we have offended God; think of the scale of the thing, our little lapse, and His infinite existence, put side by side! And then think of tl~e Sacred Heart, and all at once the whole thing becomes vivid, clear. Jesus Christ in heaven, taking an interest in our tiny needs, as He took an interest in many tiny needs on earth. Jesus Christ hurt by our sins, as He was hurt by so many slights and disappointments up and down the villages of Galilee. The echoes of our prayer no longer seem to die away in infinite distance; they strike a chord in the Sacred Heart, and become vocal to us, real to us. If critics object that we are too sentimental over our devo-tion in honor of the Sacred Heart, that we single out one partic-ular side of our Lord's character, represent Him too insistently in one particular attitude, one of mercy and tenderness and wel-come, let us remind them that it is these qualities in the Divine Nature which we find it most difficult to believe. Here, most of all, we need a diagram in flesh and blood to convince us. How can God, so upright a judge, be merciful? How can He, who is without passion, be tender to us? How can He, who has no need of human companionship, welcome us? It is these qualities, that we rejoice to see mirrored in the Sacred Heart. Our Sacred Heart statues and holy pictures represent our Lord in one particular attitude, as He revealed Himself to Sister Margaret Mary, an attitude of tender abasement, of mournful pleading with mankind. Again critics wonder. Is this your Christ, they ask, this weak, womanish figure, in a posture of sentimental appeal? Is your religion all sugary sweetness, all variations on a minor key? Has it stopped still with the seventeenth century; has it no mes-sage for today? And to that we answer, No, you have it all wrong. The Sacred Heart is the treasury of all those splendid qualities with which a perfect life was lived; it is the repository of 198 July, 1959 RESTORATION IN CHRIST all those noble thoughts which mankind still venerates in the Gospels'. It was the Sacred. Heart that burned with anger when the traders were driven out of the Temple; it was the Sacred Heart that loved the rich young man, yet would not spare him; it was the Sacred Heart that defied Pilate in his own judgment-hall. It is strong and stern and enduring; it hates prevarications and pretences. The perfect flowering of a human life, not on this occasion or that, but all the way, all the time, the utter sacrifice of a human will-- that is what the Sacred Heart means. There is no picture, no statue on earth that can portray its infinite beauty. The perfect flowering of our life at all times and in all ways; that should be the harvest of our devotion, dedication, and con-secration to the Sacred Heart. Religious, more than any other group of the followers of Christ, have the opportunity to reach that ideal. They have the available means and opportunity to answer the plea of the Sacred Heart for the return of human love for love divine. In the silent anonymity of your community life, you offer day by day the sacrifice of your personal independence and your natural yearning for recognition and human affection. If you live consist-ently with the ideals of your religious profession, you can truly say that you have left all things and have become so Christlike as to have produced the perfect flowering of your own life in the life of the Sacred Heart. Your vows of poverty, chastity, and obedience leave nothing for yourself. Through these vows, the essence of the religious life, you become one with God. How could you attain to a more perfect flowering of your life? Truth-fully you are called Sponsae Christi. In this capacity you can kneel each morning before the alkar on which the Sacrifice of Calvary is renewed and identify your love with the love of the Eternal Priest in humble and self-less fulfillment of the ideals of perfection which He Himself estab-lished in His earthly life. It is not without significance, therefore, that the spread of devotion to the Sacred Heart in modern times owes its origin 199 CARDINAL CUSHING Review for Religious to the apparitions of our Blessed Lord not to some renowned scholar or churchman but to a lowly nun. St." Margaret Mary was one of yourselves. Her call to the religious life, her postu-lancy and novitiate, her profession of religious vows, her long years of obedience to her rule and prayerful cooperation with the wishes of her superiors--all these circumstances of her life have their counterparts in the life of each one of you, St. Margaret Mary also found the same difficulty which you experience in following up the inspirations of God's grace which come so mysteriously to those who are closely associated with apostolic works. Neither religious themselves, nor those who cooperate with them in realizing the objectives of their various communities, can ever understand completely the divine orienta-tion of the human impulses out of which the success of any reli-gious community is drawn. As we look back over the centuries at what happened be-tween 1673 and 1675 in a little French village, we can see clearly that the judgments of psychologists and the cautious reserve of theologians and canonists have all played their part in the spread of the devotion to the Sacred Heart of which St. Margaret Mary was destined to be the modern apostle. They could not under-stand sentimentalism of this kind for they did not recall that Christ was man as well as God, human as well as divine. What stands out unmistakably in her life is her humble and charitable forbearance in the face of adverse personal criticism and her unquestioning submission to the authority of the Church. That indeed is one of many phases of the perfect flowering of human life: the total sacrifice of one's will to the will of another. Her spiritual directors understood her and guided her with sympathy and encouragement; she followed their counsel and obeyed to the last detail their suggestions of hopeful expectancy of eventual approval, A soul which is illumined by divine grace, a will that is one with the will of God, is never stubborn or un-disciplined. Margaret Mary's own certainty of the truth of the revelations made to her brought likewise the conviction that God's 200 July, 1959 RESTORATION IN CHRIST plans would be realized in God's own way and in God's own time. She knew that she was but the instrument of the power and mercy \ of Him who had afforded her unquestionable evidence of His love. She knew that the Christ, who had revealed to her the richness of His own inner life, was also the Christ who had founded His Church and who had'sent His Holy Spirit to abide within it until the end of time. In this peaceful and undisturbed awareness of her own relation to Christ our Lord, she was content to suffer the disappointment and frustration that would be in-volved in the reconditioning of men's souls which the spread of devotion to the Sacred Heart would bring about. When we look at Margaret Mary from this point of view, we see in her a great-ness of soul and a discerning penetration of divine wisdom which the humble circumstances in which she lived and died could never have revealed to those who knew her as a sister in religion and as a fellow human being. She is the messenger, the apostle of the devotion to the Sacred Heart because her heart gave all to the Heart of Christ. The beauty of her soul was the perfect flowering of life. And here, I think, is the great lesson which you, my beloved religious, can take to yourselves. In your life as religious you must share in the sorrows and sufferings which were glorified on the Cross. This is the meaning for you of the mystery of the Sacred Heart which was made known to the world by one of your number. How can that be accomplished? First of all, by self-immolation. To seek for oneself alone in religious life any measure of comfort or self-gratification is to substitute the prudence of the world for the prudence of the brides of God. As spouses of Christ, you must be faithful to your mystical espousal and marriage and accept cheerfully the burdens of community life and surrender yourselves without reservation to the demands which your respective congregations may make on you as they carry on their appointed apostolic works. Secondly, in your religious life you must resemble Christ in the mediating functions of His priesthood. The sacred humanity 201 CARDINAL CUSHING Review for Religious of Christ, symbolized in its ministrations of love by the Heart which was pierced with a lance, enable Christ to stand as a mediator between God and men. So too the religious, living in the world even while separated from it by the boundaries of her cloister, brings God into the lives of others as she carries on her varied works. The religious is thus in a very real sense a mediatrix between God and men. Those whom you serve are thereby raised from earth to heaven by the unselfish detachment with which you apply your-selves to works upon which material values may be set. Thus you are able to stand at Christ's side as His devoted helpers. Thus you are drawing men's souls to Christ as did Christ Him-self in His revelation of God's love for man in the visible form of His human nature. Thirdly, your principal objective as religious must always be to diffuse into the souls of others the love of Christ. How dismally we fail, even while we seem to be successful, if we have gained spectacular victories in ambitious undertakings at the cost oi: arousing bitterness and dissension among those with whom we live and work! In the companionship of your sisters in reli-gion, in your relations with your superiors, in the services which you render to your community, in your ministrations of charity and mercy to the faithful, you must always be a messenger of divine love and an inspiring example of the practice of Christian charity. I don't know of any othdr way in which we can respond to the appeal for love from the heart of Christ unless it would be to crystalize that response by fidelity to the spirit and letter of the Morning. Offering of the Apostleship of Prayer. This is more than a prayer formula, it is a way of life by which every act of the day becomes transformed into a prayerful tribute to the Sacred Heart. It is also the way of gpiritual child-hood for it sanctifies the ordinary things of life into extraordinary spiritual power and unites us to the sacrifice of the Mass through-out the world~ The Morning Offering is also the greatest means by which we can recognize the importance of each day in our lives. Each 202 July, 1959 RESTORATION IN CHRIST day is life in miniature. Today is unique; it has never happened before, it can never happen again. For one moment it is all-important, fills the.stage; tomorrow it will have taken its place in the unreal pageant of dead yesterdays. It has a significance, then, all its own; but this significance belongs to it because it is related to a series. We may think of it as the beginning of a series, the first day of a new departure in our lives. Or we may think of it as one day among others, with the same duties, cares, temptations as the others. Or we may think of it' as the last~ of a series; one today will be the last of all our todays, with eternity for its infinite tomorrow, and it may be this. Think of this day, for example, as the beginning of a new departure. How shall we begin? Not by any frantic efforts of our own; we will begin by listening to the voice of God: Hodie si vocem eius audieritis, nolite obdurare corda vestra. We speak to Him through ou.r spiritual exercises, and we unite ourselves with all the members of His Mystical Body throughout the world by today's offering of everything we do to Him. There is another use we may make of the magic word today. Instead of worrying about whether we shall ever commit our cus-tomary sins again, let us simply resolve not to commit them today. Dignare Dornine die isto sine peccato nos custodire; let us see if we can't cheat the devil, like some grasping creditor, by saying "Not just yet; not today." And let us ask simply for the grace which is needed to avoid those sins just in the sixteen hours that lie between bed-time and bed-time. Die isto, let us make today a holiday from our venial sins. This day without sin- we will avoid, His grace helping us, those little daily repeated irreverences by which we offend Him. This day without sin- we will especially avoid sinning against ourselves, by the wrong use of God's creatures. And we will avoid sinning against our neighbors. We know the sisters we have to live with, the little t~aults ot~ manner and behavior .which get on our nerves, all the more surely because they are repeated day by day. This day, with this gladness in our hearts, we will 203 CARDINAL CUSHING greet them with a cheerfulness which is infectious, which lightens their burden as well as our own. A smile at all times- how much difference that can make to life's tragedies! Today, sanctified and enriched by the Morning Offering, becomes like a sacrament from which we can derive not only an inspiration for the future, the future that may be so different if we will use today aright; not only a warning for the present, to make us avoid this day the temptations that every day beset us, but an attitude, also, towards the past, an attitude of abiding penitence and reparation. Let us remember our sins each day, as if we had no more space left for sinning; let us repent for them, as this were our last opportunity of contrition. And He, who re-turned to heaven with the penitent thief for His escort, will shorten our purgatory and hasten to unite us with Himself. Hodie vocem audieritis ~ it can never be too early to begin our conver-sion. Hodie eris mecum in paradiso ~ thank God, it can never be too late. Our renewed consecration today to the Sacred Heart gives evideace of our appreciation of the tremendous potential which you have at your disposal for the restoration of all things in Christ. We consecrate you anew to the Sacred Heart because you belong to Christ, because you are one with Christ, and because your efforts are so powerful and so indispensable for the realization of His divine mission. Let me become the spokesman for each one of you as I repeat the words of consecration which St. Mar-garet Mary formulated as she gave expression to her own consum-ing love ot: Christ her Lord: I consecrate to the Sacred Heart of our Lord Jesus Christ my person and my life, my actions, pains and sufferings, so that I may be unwilling to make use of any part of my being save to honor, love and glorify the Sacred Heart . Do Thou consume in me all that can displease Thee or resist Thy holy will. Let Thy pure love imprint Thee so deeply upon my heart that I shall never more be able to forget Thee or~to be separated from Thee. May I obtain the grace of having my name written in Thee, for in Thee I desire to place all my happi-ness and all my glory, living and dying in very bondage to Thee. Amen. 204 The AAariology of Pope Plus XII John A. Hardon, S.J. IT IS EASY to write on Pope Pius XII and the Blessed Virgin Mary because there is so much to say. We might recall how as a young boy in Rome he would stop every day to visit the shrine of Madonna della Strada at the Church of the Gesu where, as he told his mogher, "I pray and tell Mary everything." Or we might reflect on his life-long devotion to the rosary, his frequent sermons on our Lady, his constant reference to her in his writings or, in summary, his own testimony shortly after election to the papacy, that "our priestly life began with Mary and has always been directed under her motherly eye." In all this profusion of Marian piety, one aspect may be overlooked. Pius XII made a substantial contribution to the science of Mariology, a contribution concerning which, no doubt, volumes will be written in the years to come. We shall examine only the highlights of a large subject, whose implications have an important bearing on the whole body of Christian asceticism. The Assumption of the Blessed Virgin Mary On November i, 1950, Pius XII answered the requests of the Catholic hierarchy with a solemn definition that, "by the authority.of our Lord Jesus Christ, of the Blessed Apostles Peter and Paul, and by Our own authority, We pronounce, declare and define as a divinely revealed dogma: The Immaculate Mother of God, Mary ever Virgin, after her life on earth, was assumed body and soul to the glory of heaven." The spontaneous reaction of the faithful was gratitude for the exalted honor paid to the Mother of God. The Pope's own sentiments were expressed to the bishops gathered in Rome for the occasion, when he told them the joy he felt over the proclamation and the assurance it gave him that Mary would obtain the graces of which mankind stood in such dire need. On the level of piety and devotion, therefore, Mary's Assumption was only the climax in a series of definitiong 205 JOHN A. HARDON Review for Religious to honor the Blessed Virgin, beginning with the divine maternity at Ephesus and terminating in the past century with her Immaculate Conception. But dogmatically the constitution Munificentissimus Deus has a much deeper significance that de-serves to be recognized. Shortly before the actual definition but after its public an-nouncement, the Anglican bishops of England lodged a formal protest against the "new" dogma. "We profoundly regret," they said, "that the Roman Catholic Church has chosen by this action to increase dogmatic differences in Christendom and has thereby gravely injured the growth of understanding between Christians based on a common possession of the fundamental truths of the Gospel." The Anglican complaint was not a wild gesture. It exposed their radical opposition to the Church's authority over Christian doctrine, which I believe many Catholics ~do not fully appreciate. Pope Pius defined Mary's Assumption as a truth divinely revealed. Of the two sources of revelation, theologians com-monly say the Assumption was implicit in tradition, in spite of the practical absence of documentary evidence before 300 A.D. Some years before the definition, a scholarly work was published under Vatican auspices on The Silence of the Early Centuries on the Assumption of the Blessed Virgin Mary. The author frankly admitted that except for apocryphal sources we have no explicit witness in the early patristic age. Yet the Pope finally declared the doctrine was in revelation. How do we know? On the answer to this question rests a new insight into Christian tradi-tion which had been gaining momentum since the eighteenth century. Briefly stated, tradition is coming to be identified more and more with the Church's magisterium or teaching office and less exclusively as the genetic source, along with Scripture, of the truths of salvation. Behind this new emphasis is a development of dogma since the Council of Trent which reveals hidden depths of power in the Mystical Body of Christ. The Church is being seen more clearly as not only the guardian of a faith once and for 206 July, 1959 MARIOLOGY OF PIUS XII all given-to the Apos.tles, but as perpetual expositor of that faith in every age to the end of time. In August of the same year that he defined the Assumption, the Pope laid down the principles~ which guided the Marian defini-tion. The Church's teaching authority, he said in Humani generis, is not confined to reflecting or consolidating the past. It is also, ~nd especially, the vital, presetit-day function of an organism animated by the Spirit of God: "Together with the sources of revelation (Scripture:and tradition) God has given to His Church a living magisterium to elucidate and explain what is contained in the deposit of faith only obscurely :and, as it were, by implication," The degree of obscurity, we may add, is irrelevant. Given this faculty by her 0~:ounder, whose" Spirit of truth abides with her at all times, the Church can infallibly discern what belongs to revela-tion no matter how cryptic the contents may be. Consequently whenl Pius XII defined the Assumption, he did more than propose the doctrine for acceptance by the faith-ful or give them a new motive for devotion to the Blessed Mother. He vindicated as never before the Church's i~ower to authorize a legitimate development in doctrine .and pii~ty that scandalizes those outside the true faith and may even surprise b~elieving Catholics. The Assumption thus becomes part Of a'larger process, along with Catholic Action, the litui:gical movement and even such practical matters as the mitigated Eucharistic fast, in which the current problems of the Church and the present needs of souls are being met by the Holy Spirit: It was no coincidence that on the day following the Assump-tion d~finition the Pope expressed, the hope that this new honor to Mary would intrbduce "a spirit of penance to replace the' prevalent love of pleasure, and a renewal of family lifE, stabilized where divorce was common and made fruitful where birth control was practiced." If there is one feature that characterizes the modern world it is 'the cult of the body. Science and ingenuity exhaust themselves in providing for bodily comforts, avoidance of pain, and the.pampering of every sensual desire. Divorce and 207 JOHN A. HARDON Review for Religious birth control, lurid reading and entertainment are only symptoms of a deeper malady for which revelation provides at least one Certain remedy: faith in the resurrection of the body, for us on the last day as for Mary on the day of her departure from this life. Since the body is made to be immortal, it is infinitely im-portant to provide for its eternal happiness by discipline and sell control--because the alternative is also bodily immortality, but in hell, as the price of earthly pleasure against the will of God. The Immaculate Conception Three years after defining the dogma of the Assumption, Pius XII Called on the Catholic world to join in the observance of a Marian Year from December, 1953, to December, 1954, to commemorate the centenary of Pius IX's definition of the Immaculate Conception. He introduced the Marian Year with the encyclical Fulgens corona, whose doctrinal content went far beyopd the immediate purpose of proclaiming a season of special prayers to the Mother of God. According to the late Pontiff,. the Assumption was a conse-quence of the Immaculate Conception, not merely in the super-ficial sense of something suitable, but in the. strict logic of supernatural merit and providence. "These two singular privi-leges bestowed upon the Mother of God stand out in most splendid light as the beginning and the end of her earthly journey. ,For the greatest possible glorification of her virgin body is the comple-ment, at once appropriate and marvelous, of the absolute inno-cence of her soul which was free from all stain. Just as she took part in the struggle of her only-begotten Son with the serpent of hell, so also she shared in His glorious triumph over sin and its sad consequences." This correlation between the two mysteries has a long and respected theological history, which other statements of Pius XII indicate that he knew very well. Addressing the National Eucha-ristic Congress of Cuba in 1947, he acknowledged the petition which the Cubans 'had sent to the Holy See relative to Mary's 208 July, 1959 MARIOLOGY OF PIUS XlI Assumption. "This mystery must certainly be true, according to the mind of him who has rightly been called the Doctor Eximius, who teaches that this privilege is most eminently congruent with the innocence and purity of the Virgin Mary." The Doctor Eximius was Francis Suarez, the sixteenth-century theologian. whose Disputations on the Blessed Mother are the most exhaustive in classic Mariology. Again in the actual document of definition, the Pope referred to Suarez's conclusion that "the mystery of the Assumption was to be believed with the same firmness of assent as that given to the Immaculate Conception of the Blessed Virgin. Thus he already held that such truths could be defined." How are the Immaculate Conception and the Assumption related in Suarez, and by implication in Pius XII? Their rela-tion arises from the subtle but necessary connection between sin and its consequences in the after-life. The souls of the just in heaven, says Suarez, still desire and seek the glorification of their bodies. To the extent to which this is lacking to them, they are deprived of the perfection of beatitude, even though only in accidentals. When the soul of Mary, therefore, was separated t~rom her body, this hunger and desire for "the perfect perfection" were not absent. Being always full of grace, she had a title to perfect glory on leaving this world. And what Mary desired, she must immediately have obtained, in virtue of her exalted position and "by a mother's right." Therefore just as during her stay on earth she had never contracted the least stain ofsin, so after this life she was freed from every corruption and sequel that are the wages of sin. Her body was not to decay, nor was she to wait until the last day, as others who are sinners, to rise with her body from the grave. In the same document, Fulgens corona, the Pope made an-other association, this time a historical one, and not between the first and final mysteries in the life of the Blessed Virgin but be-tween the Immaculate Conception and the supernatural phe-nomena at Lourdes. In his judgment, "the Virgin 1QIary herself wished to confirm by some special sign the definition which the 209 JOH~ A. HARDON Review for Religious Vicar of Christ her divine Son on earth had pronounced amid the applause of the whole Church. Four years had not yet elapsed ¯ ~hen, in the French town at the foot of the Pyrenees, the Virgin Mother showed herself to a simple and innocent girl at the grotto of Messabielle, And to this same girl, earnestly inquiring the name of her with whose vision she was favored, with eyes raised to heaven and sweetly smiling, she replied, 'I am the Immaculate Conception.' " Following the original visions, thousands of peo-ple from every country in the world have made pilgrimages'to Lourdes, where "miraculous favors were granted them, which excited the admiration of all and confirmed the Catholic religion as the only one given approval by God." This judgment is highly significant. In the last analysis, a Catholic wants to prove that no other religion than his own is from God, he must invoke some principle by which any religious system can be tested and its divine authorization verified. Such a principle is the norm of miracles, which even the unlettered primitive can understand. It says simply that when God com-municates a revelation (as claimed in some form by every organ-ized religion), He will confirm the mysteries He reveals and make them rationally acceptable by working miracles in favor of the truths that He wants believed. Or put negatively, He will not work miracles in support of a pretended revelation because, as master of the miraculous, He would be actively cooperating in a lie. In the context of the Lourdes apparitions and the constant stream of preternatural wonders there granted by God, this means that what Lourdes stands for is perennially attested as true. The Immaculate Conception is a strict mystery, not even conceivable apart from revelation. Miracles are visible signs of divine inter-vention that lead the well-disposed to believe (or strengthen their belief) in what cannot be seen, on the argument that the same agency which produces the phenomena also revealed the doc-trine in whose atmosphere the phenomena take place. 210 July, 1959 MARIOLOGY OF P~us XII Mediatrix of Graces . The !ast element in the triad of Marian privileges to which Pius XII made a lasting theological contribution is Mary's role as universal mediatrix of graces. On the fourth anniversary of the Assumption dogma and in closing the Marian Year, the Pope instituted a new feast of the Queenship of Mary, for May 31, and in the encyclical Ad caeli Reginam elaborated on the basic principles that underlay Mary's royalty, namely, her unique posi-tion as liaison between Christ and the humar~ race. An examination of the teaching of the fathers of the Church since the rime'of Origen, Ephrem, and St. Jerome shows a prac-tical unanimity in regarding the mother of Jesus as sharing with Him, albeit subordinately, a truly royal dignity~. Ephrem called her "Empress and Ruler"; Origen, "Mistress and Queen"; the seventh ecumenical council spoke of her as "the Lady ruler ~of all Christians"; and in modern times, Benedict XIV gave her the title "Queen of heaven and earth." The ancient tradition is re-flected in the liturgy of the East which poetically addresses Mary as "carried into heaven on the. chariots of the cherubim, the seraphim wait upon thee and the ranks of the heavenly host bow before thee." Familiar hymns like the Salve Regina and prayers like the Litany of Loretto confirm the sentiments of Christian art since the Council of Ephesus (431 A.D.) which "portrays Mary as Queen and Empress seated upon a royal throne, adorned with the royal insignia, crowned with the royal diadem and surrounded by the host of angels and saints in heaven and ruling not only nature and its powers but also over the machinations of Satan." However, more important than the evidence of its traditional character is the dogmatic basis for Mary's queenship which the late Pontiff traced to her divine maternity and her association with Christ in the redemption .of the world. The Pope synthesized in bold analogy the Catholic doctrine which some theo.logians con-sider definable. The Blessed Virgin has not only received the grade of excellence and perfection which is supreme after that of Christ Himself but has also received some sharing 'of that et~icacy by which her Son and our 211 JOHN A. HARDON Review for Religious Redeemer is rightly and properly said to reign over the minds and wills of men. For if the word of God performs miracles and gives graces through the humanity He has assumed, if He employs the sacra-ments and His saints as instruments for the salvation oi~ souls, why should He not use His mother's office and efforts to bring us the fruits of the Redemption? We may transmit the comparison between Mary's intercessory power and that of other saints. Certainly if they can pray in our behalf and obtain favors we should not otherwise receive, how much more the Queen of Saints and the Mother of the Author of grace. The remarkable thing is to associate the Blessed Virgin's share in our Redemption with the humanity of her divine Son and to compare its efficacy with the function of the sacramental system. Both analogies are penetrating concepts. By relating Mary's role of mediatrix to the human nature of Christ, the Pope wished to emphasize what even Catholics are liable to forget, that while God can perform by His own power all that is effected by created natures, yet in the counsels of His providence He has preferred to help men by the instrumentality of other men- whose efficacy for sanctifying others depends on their proximity to the human nature assumed by the Son of God. Viewed in this light, the potentiality of the Blessed Virgin as an instrument of grace takes on staggering proportions. As the woman whose consent mad~ the Incarnation possible, who carried in her womb and brought into the world the Word made flesh, and whose association with Christ during His life and sympathy in death were the most intimate conceivable- her efficacy at the throne of God must be, without fear of exaggeration, "almost immeasurable in power." If we compare Mary's mddiation with the sacraments of the New Law, we gain a further insight into her place in the economy' of salvation. We know that on the level of sanctification nothing is more internal than heavenly 'grace which begets holiness; and yet the ordinary and chief means of obtaining grace are external, in the form of sacraments administered by men specially chosen for that purpose and by means of external rites. In baptism 212 July, 1959 MARIOLOGY OF PIUS XII there is pouring of water; in confirmation and extreme unction, anointing with oil; in orders, the imposition of hands; in matri-mony, the expressed acceptance by the two spouses; and in pen-ance, the vocal and visible absolution by the priest. All these actions are external and their agents are all human, but condi-tioned on their performance in the spirit of faith, such trans-cendent changes occur in the spiritual world as the removal of a life[ime of sin by a sign of the cross and the conversion of a piece of bread into the Body of Christ. ' The more clearly we see ho.w the Blessed. Virgin shares in this type of sacramental effciency, the less scandalized we shall be to say that "as God is the Father and Lord of the universe, preparing all by His power, so the Blessed Mary, repairing all things by her merits, is the ruler and mother of all." While re-maining subordinate to her Son as a creature to her Creator, she was instituted by Him on the cross as the great sacrament of His mercy and the visible sign of internal grace which He promised to those who, like Plus XII, "approach with confidence to the throne of our Queen and Mother to beg help in difficulty, light in dark-ness, and solace in trouble and sorrow." 213 Practice ot: t:he Noly See ,Joseph F. ~llen, S.,.J. CANON 509, § 1, obliges all superiors to inform their sub-jects of all decrees of the ~Holy See concerning religious and to enforce such decrees. The activity and mind and will of the Holy See are also revealed, and sometimes in a more practical manner, by approved constitutions and com-munications addressed to individual religious institutes. article drawn from these sources was published in the REVIEW FOR RELIGIOUS in 1953. This article is based on the same sources concerning lay institutes ~ from January 1, 1954. The order of material followed in the article is the usual order the chapters of constitutions of lay institutes. This is the third part of a series of three. 14. Dismissal. It is canonically interesting that the con-stitutions of an order of women, who recently received permis-sion to resume solemn vows, contain the following article: "A professed of either perpetual simple vows or of solemn vows who is dismissed from the institute is by this very fact dispensed from her vows of religion.''3° 1 5. The general chapter. (a) Convocation and members. A most interesting fact canonically is the appearance of a procuratrix general to handle the affairs of a pontifical congre-gation of women with the Holy See. The article in a set of constitutions recently approved by the Holy See reads as follows: "The procuratrix general resides in Rome and transmits the affairs of the congregation to the Roman Curia according to the intentions and directions of the institute. The procuratrix general has the right to attend the general chapter and to give her suffrage.''31 (b) Invitation of non-capitulars to the general chapter. Several constitutions of recent date empower the IBM., 16-1957-282. Ibid., 16-1957-114-16. 214 PRACTICE OF THE HOLY SEE superior general, either alone or with the advice or consent his or her council, to summon or invite the following non-capitulars to the general chapter: one or more religious ot: the same institute to .assist the secretary of the chapter as steno-graphers, other religious of the same institute to any session, and a priest or lay person to present and discuss a question of interest to the capitulars. It is evident that none of these are permitted to vote and that all such religious of the same institute are obliged to secrecy in the same manner as the capitulars. It seems prudent to add the observation that the capitulars should have sufficient time for discussion of a matter after such a consultant has left, since often they would at least hesitate to express their opinions fully before such a person, particularly if he or she is not a member of the same institute. I have seen such provisions only in recent constitutions; but some of them, for example, that on the stenographers, have been followed in fact by some institutes. Unless expressly forbidden by the particular constitutions, these ~. provisions may be followed by any institute, since they are not contrary to canon law and are entirely reasonable in themselves. In any revision of the constitutions, art institute should consider ar~ article of the following tenor: The superior general (or with the advice or consent of his or her council) may summon other religious to assist in the clerical or similar work of the chapter. He may also summon such religious and even invite an extem for consultation or to present and discuss questions with the chapter. None of these are permitted to vote, and all such religious have the same obligation as the capitulars to secrecy. (c) Delegates. i° Necessity of delegates. The Holy See de-mands a system of delegates for the general and provincial chapters and does not permit in centralized institutes what we may style a universal chapter, for example, that all the religious pf perpetual vows be members of the general or provincial chapter. This necessity was repeated in a recent reply to a quinquennial report. A system of delegates is also necessary 215 JOSEPH F. GALLEN Review for Religious now for the general and regional chapters of nuns. The neces-sity of delegates was emphasized in the REVIEW FOR RELIGIOUS, 10-1951-187-90. The elected delegates from a province to the general chapter are almost universally two, most rarely three or four. The Holy See has approved, eoen recently, variations of this norm, for example, "one or two delegates according as the province has less or more than a hundred members"; "one delegate for each province but two delegates for any province that exceeds three hundred." 2° Added delegates from larger houses. It has been practically universal that a larger house elected only one delegate, no matter l~ow many religious of active voice it contained. Added delegates were very rarely admitted, for example, one delegate for every twelve religious. There has been a greater willingness on the, part of the Holy See in recent years to permit such added delegates. However, one of the defects of the house system is that it puts a large and unwieldy number in the general or provincial chapter as the institute increases in size. This difficulty is evidently intensified by the system of added dele-gates. Furthermore, proportional representation is not de-manded. The business of a general chapter is not the interests or the affairs of a particular house or province but only those of the institute as a whole. The same principle is true of the provincial chapter. 3° New systems. A fundamental variation of the group system recently approved by the Holy See is as follows. A first list is made of all local superiors and a second of all the subjects with passive voice. The latter are arranged in groups according to horizontal precedence, that is, each group has a proportionate number of older and younger re-ligious~ Copies of the two lists are sent to every religious with. active voice. Each of these votes for a determined number of local superiors and a determined number of subjects from each group of the second list. Those with the next highest number of votes are the substitutes. Therefore, every such religious votes for all the local superiors and subjects who will 216 July, 1959 PRACTICE OF THE HOLY SEE be members of the general or provincial chapter. The system may be further varied by sending out the list of superiors first and including in the second list all local SUl~eriors not elected in the first election. The following is an example of another new system, which has been approved for at least two institutes by the Holy See. The superiors of all houses of at least twelve religious are members of the general chapter in virtue of their office. The number of delegates from the houses is apparently established by the superior general with the consent of his council. Let us suppose that twenty is the established number. Each religious Who has active voice votes for twenty delegates from the entire institute. A graduated value is given to this vote: for example, if Brother Francis is the first name voted for, he receives twenty points; Brother Robert, the last name on the same ballot, receives one point. Or the relative value can be computed as one and one-twentieth. The votes are necessarily sent in to the general council, and thus a relative majority decides the elections. Those with the next highest number of votes are the substitutes. One objection to this system is the complicated computation of the votes. Some have objected also to the fact that the local superiors are members of the chapter in virtue of their office and to the power of varying the number of delegates from the houses. Another institute proposed the same system to the Holy See; but the number of delegates, twenty, was fixed by the constitutions, no local superior was a member of the chapter in virtue of his office, the delegates could be either local superiors or subjects, and the same value was given to a vote for a religious no matter in what place his name was found on the individual ballot. The Holy See approved this proposed text with two exceptions, the number of delegates was reduced to fifteen, and the local superiors of houses of at least'twenty subjects were made ex officio members of the general chapter. (d) Preliminary sessions. Some recent constitutions, as also several approved in the past, command the superior general to give the general chapter a 217 JOSEPH F. GALLEN Review for Religious copy also of the last quinquennial report ~o the Holy See. (e) Postulation of superior general. The Holy See admitted the postulation of a mother gerieral for a third successivd six-year term but expressly excluded further postulation of the same religious. (f) Election of the general officials. 1° Election or appointment of the secretary general and bursar general. In a fairly recent communication to one institute, the Sacred Congregation stated that these two officials should be ex officio members of the general chapter because of their general knowledge of the institute. The validity of this reason is evident. .~It could be well appliedto some other offices, for example, the general supervisor of schools and studies. If elected, these two officials uniformly have such membership. The Holy See, also in recent years, has sometimes approved the appointment of either or both of these officials by the superior general with the consent of his council, in some cases with and in others without ex officio membership in the "general chapter. I personally doubt that a general chapter is a good judge ~f the specialized abilities demanded by these offices~32 It seems to me that the preferable policy is to appoint both of these officials with ex officio membership in the general chapter. 2° Incompatible offices. In the Former practice of the Holy See, one of the general councilors, except the first, could be elected also as secretary general; but the bursar general could not be a general councilor. Constitutions that contain this provision must evidently be observed. In constitutions more recently approved, the Sacred Congregation permits any of the councilors except the first to be also either secretary, or bursar general. One institute received an indult permitting the first councilor, or assistant general, to be also bursar general, provided that no inefficiency resulted to the first office. (g) Chapter of affairs. 1° Committees. An article of the following type is more efficient than the one usually found in constitu-tions: "At least two .weeks before the opening of the chapter, 32 Ibid., 10-1951-190-91. 218 July, 1959 PRACTICE OF THE HOLY SEE a committee of three or more chapter delegates, appointed by the mother general in consultation with her council, shall examine and prepare for the chapter all the matters submitted by the hohses for which the decision of the chapter is necessary. This committee shall classify all questions submitted and present them to the general chapter for action." 2° Public voting. The general norm of public rather than secret voting in this chapter is also more efficient and is contained in some recent constitu-tions, for example, "The business of the chapter will be settled by the majority of votes, by secret ballot if the majority of the chapter requests it." 3° Duration of ordinances of general chapter. The following norm of a set of constitutions recently approved is more reasonable than the one commonly found in constitutions: "The decisions and enactments of the general chapter remain in effect permanently unless amended or rescinded by subsequent chapters." 4° Duration of ordinances of a ,superior. At least two recent sets of constitutions state: "Every order gi~,en by a superior ceases to. bind on the expira-tion of his term of office." This should have been qualified. As Van Hove well states: "Many ordinances enacted from dominative power continue to exist on the cessation from office of the superior who established them, because they are im-plicitly renewed by his successor, who is presumed to intend that the customary order in a community continue to be observed until he changes it.''33 16. The superior general. The quinquennial report. The only article in this chapter of the constitutions that needs com-ment is that on the quinquennial report to the Holy See. Every religious institute is now obliged to make this report, for example, independent monasteries, independent houses, and diocesan congregations of men and women are also held to the report.34 The following comments were i:ound in the replies of the Sacred Congregation to several reports. Whenever a Van Hove, .De Leglbus Ecclesiasticis, I, n. 359, note 4; cf. Jone, Commen. tarium in Codicem Iuris Canonici, I, 46. REVIEW FOR RELIGIOUS, 15-1956-156~57. 219 JOSEPH F. GALLEIq Review for Religious pontifical document is mentioned, its date and protocol number should be given, for example, March 19, 1955, Prot. N. 6097/54. Each house should have a book of chronicles in which the principal events of the house are recorded and should also have its own files and archives. The acts of the general chapter, that is, the elections made and the ordinances enacted, not the minutes, should be sent to the Sacred Congregation by pontifical institutes. The following question also caused difficulty: "How do superiors see to it that the decrees of the Holy See which concern religious be known and observed by their own subjects?" This obligation is incumbent on all superiors by the prescription of canon 509, ~ 1. The Sacred Congregation was dissatisfied with many replies to this question. It seems to me that the answer was easy with regard to knowledge, i. e., all houses subscribe to the REVIEW FOR RELIGIOUS, in which such documents are explained, and all houses have the fol-lowing work, in which the text of such documents is given in Eng-lish, Bouscaren, Canon Law Digest, I-IV (The Bruce Publishing Company, Milwaukee). Circular letters of higher superiors should call the attention of their subjects to such documents and insist their observance. Their enforcement should also be part of the ordi-nary government of all superiors, should be included in the reports of lower to higher superiors, and be investigated and insisted on in the canonical visitations of higher superiors. Since the Sacred Congregation insists even on local archives, it seems to me that a religious institute should always be given the original rescript from the Holy See that concerns it or at least a photographic copy of such a rescript, and not a mere summary in English of the contents of the rescript. The names of the prefects and officials of the Roman congregations who sign rescripts are often most inaccurately stated and trans-lated into English by lay religious. This is true of the name, the title, and the office. These mistakes are frequently quite public, for example, on the documents appended to the con-stitutions. Those who transmit rescripts should translate these 220 July, 1959 PRACTICE OF THE HOLY SEE names into English for .lay religious. An indecipherable signa-ture can usually be. determined by cgnsulting the Annuario Pontificio. It would help if the signature were fully typed out on the original document below the written signature. 17. The general council. (a) Superior alone governs. Many constitutions, old and new, contain an article of the following tenor: "The congregation shall be governed by a superior general and four councilors." This is an error. The superior alone governs an institute, a province, or a house. The councilors are not associates in authority but advisers. Therefore, such an article should be more accurately phrased, as in the following recently approved constitutions: "Although the superior general must ask the opinion of the general council in matters of greater importance and must sometimes secure its consent, nevertheless, she issues all ordinances in her own name because she alone possesses the right to govern the congregation." (b) List of what a superior may do without the advice or consent of his council. Several constitutions, even some recently approved, contain such a list. This seems to me to be entirely superfluous. It is immediately evident that a superior has the right to govern completely unassisted except for the matters reserved by canon law or the constitutions to higher authorities or that from the same sources demand the con-sent or advice of his council. 18. The secretary general. Many constitutions keep repeat-ing, especially of the secretary, secondlyof the bursar, and lastly of the novice master, that he has no right to vote in a general or provincial council unless he is also a councilor. Isn't this evident? Are we vdry likely to affirm that anyone has the rights of an office that he does not possess? 19. The bursar general. Even recent constitutions continue to speak of a safe locked by three different keys in general-ates, provincialates, and local houses. One of those keys is to be kept by the superior, the second by the assistant, the third by the bursar. All three must therefore be present to open the 221 JOSEPH F. GALLEN Review for Religious safe. How efficient is such a safe? How possible is it even buy such a safe? Religious institutes continue also to put determined sums in their constitutions, for example, the amount in extra-ordinary expenses for which recourse is necessary to the superior general. The changing of such an amount is a change of the constitutions and will demand the permission of the Holy See for a pontifical institute and that of all the ordinaries in whose dioceses the.institute has houses in the case of' a diocesan con-gregation. It would be sufficient and more practical to say, "according to the norms established by the general chapter." Such amdhnts may then be changed by any subsequent chap-ter. A recent set of constitutions enacts: "In the houses en-trusted with parish schools or other establishments which are responsible to ecclesiastical or lay administrations and where the sisters receive a fixed salary, the funds shall be .kept and admin-istered as indicated in article . ., except that any surplus shall be paid annually into the provincial fund." This matter was explained in the REVIEW FOR RELIGIOUS, 14-1955-329. The article on alienation no longer contains the 30,000 t~rancs or lire, or $6,000, of canon 534, § 1 but is phrased, "of a value that exceeds the sum established by the Holy See." 20. Local houses and superiors. A recent set of constitu-tions states: "Though the sisters ought to be desirous of embrac-ing all human misery and of drawing the whole world to the service of God, nevertheless, the congregation shall not establish new houses if, in those already existing, there is not a sufficient number of sisters to insure that not only the works of mercy can be carried out adequately but also that religious observance can flourish." The last clause might well have been amended to: that religious observance and a normal human life can flourish. This very practical matter was commented on in the REVIEW FOR RE~LIGIOUS, 17-1958-121-22. Canon 516, § 1 demands that councilors be had in every formal house and favors or recommends councilors also in smaller houses, In several replies to quinquennial reports, the Sacred Congregation insisted on 222 July, 1959 PRACTICE OF THE HOLY SEE the appointment of local councilors and that local council meet-ings be held with the frequency commanded by the constitu-tions. Insistence was also placed on the law that a local superior should not be the local bursar except in a case of necessity (c. 516~ § 3). A recent set of constitutions makes the prac-tical and necessary observation that everything said about local superiors applies also to the local superior of the 'mother house. The presence of a higher superior does not diminish the author-ity nor lessen the duties of this local superior. One order of nuns and two congregations of sisters have indults that dispense them from the law of canon '1306,§ 2, that is, that purificators, palls, and corporals used in the sacrifice of the Mass must be first washed by a cleric in major orders.3~ 21. The constitutions. The only thing noteworthy under this chapter in the present practice of the Holy See is a fre-quent addition to the norm on the obligation of the constitu-tions. It has always been evident that a divine or ecclesiastical law repeated in the constitutions retains the obligation it has in itself, that is, it obliges under sin according to the matter. The same obligation is equally evident of any action that falls under the vows. It has been the universal practice to declare that the other articles of the constitutions did not immediately oblige under sin but under the penalty imposed for their infraction. It was also universally stated that sin was committed in the violation of such articles by a sinful motive or by a violation that caused scandal. The following qualification is now fre-quently appended to the norm for these other articles: "The articles concerning government and the fundamental norms that determine the necessary functions or the duties and offices by which government is exercised, as also the articles that enact and consecrate the nature, spirit, and special purpose of the congr.egation oblige immediately in conscience according to the matter." This qualification is evidently taken verbatim from Ibid., 15-1956-101. 223 JOSEPH F. (~ALLEN Muzzarelli, Acta et Documenta Congressus Generalis de Statibus Perfectionis, I, 540. It does not seem to me to be too clear nor too precise. It "should be added here that a considerable number of both pontifical and diocesan congregations have made a general revision of their constitutions in recent years. 224 A Lit:e Table t:or. Religious Priest:s 1953-1957 Francis C. Madigan, S.J. THE JANUARY 1955 REVIEW FOR RELIGIOUS carried an article by Sister Josephina, c.s.J., on the average age at death of sisters in two communities of religious women, presumably of her own congregatmn1 . In view of the interest of religious, and particularly of religious superiors, in Sister Josephina's stat", s"tLcs, the writer believes that readers of the REVIEW will be equally interested in a life table setting forth the mortality experience of a large community of religious priests2 whose headquarters are located in New York City and whose principal field of operations embraces New York State ¯ and northeastern New Jersey.3 Some comments on life tables and their use are in order. First of all, they are based not on death records only, but on the proportion of deceased members to living members, for each age gr6up and calendar year studied. The present table gives average figures t:or the calendar years 1953-1957. Secondly, life tables are an accurate barometer of health conditions prevailing in the particular group to which they relate. They permit direct and unbiased comparisons of the mortality of this group with that of other groups through the mortality rates and expectations of life developed in the tables. Superiors of similar groups of priests should find these mortality rates and expectations of life helpful in coming to decisions about the number of men that must be prepared to keep certain lines of work adequately staffed. The table will also prove useful in determining whether health conditions in 1Sister Josephina, C.S.J., "Longevity of Religious Women," Review [or Religious, XIV, I (January, 1955), 29-30. 2Priest was defined for the purpose of the study to mean. both ordained priests, and religious seminarians ("scholastics") studying for the priesthood. 3There were 1247 priests in this community on June 30, 1955, which was the midpoint of the study. The main work engaged in by the members is education. 225 FRANCIS C. MADIGAN Review for Religious their community are satisfactory both in general and in regard to any particular age group. Some time ago through the use of such a table the superiors of a certain religious community found that the number of deaths yearly experienced in their scholasticate was entirely out of line with expectations, and upon investigation they found that certain health measures relating to diet and housing were being overlooked. Correction of the situation resulted in an immediate lowering of the death rates for the affected age groups. The table may also be of assistance to superiors, in another way. Of late a number of communities have been consider-ing or have actually bought group insurance for their members. The mortality rates and expectations of life in the table should prove helpful both to these communities and to insurance companies in determining what is a fair premium. The use of the table is simple. In the leftmost colunm one finds the age in which he is interested. Following this age across .its row, he comes first to the mortality rates. These are given for both five-year and one-year periods, and for the five-year periods, in terms of both observed and graduated rates. The observed rates are placed next to the age beginning the precise period to which they refer, as are the one-year graduated rates. The graduated five-year rates are placed in parentheses two lines below the observed rates and refer to precisely the same period of time as the observed rates. These mortality rates are probabilities of dying during the period 'specified for those priests who were alive on the birthday mark-ing the beginning of the period. In using the table to compare the probabilities of dying at any particular ages, it is better to use the graduated rather than the observed rates. This is because the latter rates con-tain fluctuations from age to age due to chance variation, whereas the former represent, as closely as can be determined by study, the general law of mortality, which seems to underlie the observed fluctuations of a particular set of rates. A priori we would expect mortality to follow a smoothly rising curve 226 July, 1959 A LIFE TABLE with the advance of age, and graduation is based on this expectation, while at the same time it attempts to keep very close to the original rates observed at each age. For example, if the age-specific mortality rates observed during the period 1953-1957 should continue in effect, we would expect an average oi~ 5.5 priests to die (on the basis of the graduated rates) before their fortieth birthday, out ot~ every thousand priests alive on their thirty-fifth birthday. However, in the general public we would expect thirteen out of every thousand to die during the same period.4 During the one-year period from their thirty-fifth to their thirty-sixth birthday, we would expect only one priest to die out of every thousand. The reference, of course, is only to priests of the community studied. How might a superior compare the experience of his own community with that of the priests described? He could do this by relating the number of deaths at any particular age in a calendar year to the number of persons in his community who had been of that precise age on their last birthday. Divid-ing the i~ormer by the latter would give the one-year probability of dying. Similarly, he could find the five-year probabilities of dying by relating members who had died within a specific five-year age bracket in the calendar year to the number of members of his community who were between these ages at the start ot~ the year. Rough approximations could be used if only ~ general picture of the mortality rates of the community is ~lesired, while more careful methods might be employed to nvestigate the records of age-groups which seem to have un- _~sually high mortality. Of course, unusually high mortality rates for a particular ~-ge-group may represent simply fluctuations due to chance. ~,ccordingly, it is well to combine the results of the observation ,f several calendar years, as these average rates will show fewer --xtremes due to mere sampling variation. It would not be 4The comparison is not perfect since the rates of the general public are "or 1954, rather than 1955 which is the mid-year of the period studied for ¯ riests. However, it is close enough to make differences inconsequential. 227 FRANCIS C. 1V[ADIGAN Review for Religious wise, however, to average more than ten years' experience be-cause of the change in medical techniques that takes place over that length of time. These affect the death rates. The column next after the white male mortality rates fifth column) shows the number of priests who survive to each quinquennial birthday out of 100,000 priests alive on, their fifteenth birthday. By mentally shifting the decimal point, can be converted into the number left alive out of 100. (Multi-plying by the proper multiple would give the number left out of 200, 300, 400, and similar numbers.) This column might prove helpt~ul to superiors in endeavoring to forecast size of a certain age group some years from the present. For example, one might get some idea from it of the number priests ordained today who would be expected to be still alive in twenty or thirty years, if we assume that these priests roughly of the same age. The following column (sixth), which gives the number of priests dying in each successive five-interval out of the original group of 100,000, might also prove helpful in this connection. The seventh column will probably not be particularly use-ful to superiors or other interested religious. It is included because of its relation to the following column. This seventh column presents the remaining total number of years of to be lived by the surviving members of the original 100,000 priests up to the time when the last survivor dies. The last column presents probably the most useful set figures in the table. These expectations of life are found dividing the total number of years to be lived (column by the number of persons surviving to start the period (column 5) at any particular age. The first expectation, at age 15, sums up the entire mortality and longevity experience of whole cohort of 100,000 priests, and is directly comparable t.h~ experience of other groups of persons at age 15. Expecta-tions of life at succeeding years sum up the entire experience t~rom that age onward to the death of the last member. 228 July, 1959 A LIF~- TABLE The expectation of life is the average remaining number of years to be lived by priests surviving to some particular specified age. For example, priests studied in this table had at 30 years of age an average remaining lifetime of 38.5 years while white males of the general public had only 36.4 years of life remaining. Care must be observed, however, in drawing conclusions from column eight. Because one has noted that the average lifetime of priests is greater than that of white males of the general population, he should not conclude that the oldest ages reached b)~ individual priests necessarily exceed those of the most long-lived members of the general population. As a matter of fact, the opposite is true because of the greater numbers in the general population and the greater resultant probability of extreme cases. The difference in average length of life is pri.ncipally due to the fact that a larger number of the general population die before reaching old age. For this reason one will notice that the expectations of life at ages above 60 do not differ as much as do the expectations at the younger years. A second caveat refers to the fact that the mortality rates and the expectations of life refer to statistical averages. We cannot be sure of any particular person or persons that their lives will be as long or short as the mathematical averages. For example, the expectation of life of priests aged 30 is 43.5 additional years of life. However, any particular priest might be killed tomorrow in an automobile accident, or on the other hand he might live considerably beyond the average expecta-tion of life. The same is true of any small group of priests, where sampling variations due to health or accident might be very large. In addition, one should bear in mind that as time goes on, health conditions continually improve. At least this has been the experience of the past hundred years. Thus one would expect that in 1958 a priest's expectation of life would be slightly better for any particular age than it was between 1953 and 1957, and that his chances of dying during any one-year or five-year interval would be correspondingly less. 229 FRANCIS C. ~V[ADIGAN Review for Religious Table 1. Life Table of Large Community of Religious Priests with Headquarters in Northeastern United States, for the Period 1953-1957, with Mortality Rates For Five-Year and One-Year Periods and Expectation of Life by Single Years of Age, Compared for Five-Year Age Groups with United States White Males, 1954. Priest Priests Total Survivors Dying Years Expectation MortaLity Beginning During Lived by of Rates Each Each Priesr~ Life Age 5-Year 1-Year 5-Year Five-Year Five-Year at Ages ¯ Priests U~S. Interval Observed~ Graduated U.S. Male Interval, Interval and Above Male 15-16 .00000 .00068a .00610b 100,000 0 5,797,816 57.98 55.0 16-17 .00068 56.98 17-18 (.00339)c .00068 55.98 18-19 .00068 54.98 19-20 .00068 53.98 20-21 .00549 .00068 .00890 I00,000 549 5,297,816 52.98 50.3 21-22 .00069 52.04 22-23 (.00349) .00070 51.09 23-24 .00070 50.15 24-25 .00071 49~20 25-26 .00578 .00073 .00800 99,451 575 4,799,069 48.26 45.7 26-27 .00074 47.31 27-28 (.00379) .00076 46.36 28-29 .00077 45.42 29-30 .00079 44.47 30-31 .00000 .00082 .00900 98,876 0 4,303,365 43.52 41.1 31-32 .00085 42.52 32-33 (.00439) .00088 41.52 33-34 .00091 40.52 34-35 .00094 39.52 35-36 .00628 .00099 .01300 98,876 621 3,808,975 38.52 36.4 36-37 .00106 37.57 37-38 (.00549) .00111 36:61 38-39 .00115 35.66 39-40 .OOll8 34.70 40-41 .00683 .00125 .02080 98,255 671 3,316,009 33.75 31.8 41-42 .00136 32.79 42-43 (.00757) .00149 31.83 43-44 .00166 30.88 44-45 .00186 29.92 45-46 .03874 .00214a .03530b 97,584 3,780 2,825,753 28.96 27.5 46-47 .00248 28.17 47-48 (.01490)e .00290 27.38 48-49 .00342 26.60 49-50 .00404 25.81 50-51 .03177 .00484 .05600 93,804 2,980 2,346,801 25.02 23.4 51-52 .00566 24.17 52-53 (.03333) .00661 23.32 53-54 .00773 22.46 54-55 .00899 21.61 July, 1959 A LIFE TABLE Mortality Age ~-Year l-Year 5-Year Interval O~serveds Graduated U.,S Male 55-56 .02900 .01058 .08380 56-57 .01231 57-58 .06765) .01374 58-59 .01545 59-60 .01727 60-61 61-62 62-63 63-64 64-65 65-66 66-67 67-68 68-69 69-70 70-71 71-72 72-73 73-74 74-75 Priest Priests Total Survivors Dying Years Beginning During Lived by Each Each ~ Priests Five-Year Five-Year at Ages x Interval Interval and Above 90,824 2,634 1,885,471 .09036 .01960 .02205 ¯ 11805) .02450 .02750 .03051 .12700 88,190 7,969 1,436,896 .28666 .03586 .03795 .19084) .04125 .04452 .04795 .13382 .05225 .05650 .273.10) .06150 .06685 .07150 ¯ 18570 80,221 22,996 1,011,626 ¯ 24920 57,225 7,658 668,076 75-76 76-77 77-78 78-79 79-80 80-81 81-82 82-83 83-84 84-85 Expectation of Life Priests U.S. Male 20.76 19.6 19.87 18.97 18.08 17.18 16.29 16.2 15.54 14.82 14.08 13.35 12.61 13.1 12.42 12.23 12.05 11.86 11.67 10.5 10.95 10.24 9.52 8.81 .45904 .07650 .35440 49,567 22,753 401,147 8.09 8.2 .08200 8.04 .35495) .08500 7.98 .08750 7.93 .08870 7.87 .36387 .09051d .48470 26,814 9,757 209,757 7.82 6.3 .O9149 7.46 .38689)e .09311 7.12 .09452 6.76 .09642 6.41 85-86 .39950 .10116 17,057 6,814 103,400 6.06 5.1 86-87 .10653 87-88 (.45904) .11340 88-89 .12299 89-90 .13367 90 and 1.00000e Above 1.0000e 10,243e 10,243e a The life table is based on the observed rates. These rates are for five-year periods. b The mortality rates for U. S. males, 1954, are for five-year periods. In the source they are given only to four places. A zero was added to each to assist the eye in comparisons. e The rates given in parentheses are five-year, graduated rates for priests. They are for the iame five-year period as the observed rate immediately above them. d The one-year graduated rates give the probabilities of dying during the next year, for persons of this exact age. ¯ o This final interval is not one if five years, but continues till the death of the last survivor. Source for the life table values of United States white males, 1954: National Office of Vital Statistics, "Abridged Life Tables. United States, 1954," Vital Sta-tistics- Special Reports, National Summaries, 44, 2 (May 15, 1956), 38. 231 Survey Roman Documents R. F. Smith, S.J. IN THE FOLLOWING survey those documents will be summarized which appeared in Acta Apostolicae Sedis through February and March, 1959. All page references throughout the survey will be to the 1959 ~AS (v. 51). Synod and Council On the Feast of the Conversion of St. Paul, January 25, 1959, His Holiness John XXIII, together with the cardinals present in Rome, participated in the closing of the Church Unity Octave at the Basilica of St. Paul Outside the Walls. After the ceremonies the Vicar of Christ delivered a private but solemn allocution (AAS, pp. 65-69) to the assembled cardinals. After telling them of his awareness of his duties both as Bishop of Rome and as Pastor of the universal Church, the Pontiff remarked that the diocese of Rome needs an increase of energy as well as a coordination of individual and collective efforts, if a more abundant harvest of souls is to be gathered. Moreover, he continued, the entire world has its needs; for though the grace of Christ continues to achieve its victories, still there are many who refuse to believe in Christ, immerse themselves in exclusively eartldy pursuits, and under the inspiration of the Prince of Darkness wage active opposition against what is true and good. To meet these needs, the Pope. said, there must be revived certain ancient forms of doctrinal affirmation and ecclesi-astical discipline which have in the past proved their ability to clarify thought, to increase religfous unity, and to reanimate Christian fervor. "Venerable Brothers and beloved Sons! Trembling a little from emotion but nevertheless with a humble resoluteness of purpose, We announce in your presence the name and proposal of a double celebration: that of a diocesan synod for the City and that of an ecumenical Council for the universal Church." After mentioning briefly that among other results of these two endeavors, there would be effected the hoped for revision of canon law, the Pontiff concluded his allocution by recommending his two proposals to the care of the Blessed Virgin and the saints of heaven. Previously on the same day and during the Solemn Mass that closed the Unity Octave, HIS Holiness had delivered a homily (AAS, pp. 70-74) in which he emphasized that the Church's linking of St. Paul with St. Peter should be a symbol of the unity of the bishops, 232 I~OMAN DOCUMENTS successors of the apostles, and of the faithful with the successor of St. Peter. It is from this unity, he concluded, that there will flow to the world the liberty and peace it desires. Closing of the Lourdes Centenary On February 15, 1959 (AAS, pp. 135-39), the Holy Father delivered an allocution in the Basilica of St. Mary Major to mark the end of the Lourdes centenary for the city of Rome. After reminding the Romans that the adoration of Christ is always the center of every form of devotion to Mary, HIS Holiness once more recalled to his listeners the permanent message of Lourdes: confident prayer of petition, exercise of penance, and solid piety manifested in the form of pilgrimages. These pilgrimages, he continued, whether to Lourdes or to the thousands of other shrines of our Lady, are not to be regarded as pleasure trips nor as the satisfying of some vague religious feeling; rather they should recall the eternal truths of life and- purify the soul so as to better fit it to appreciate the eucharistic banquet. In our prayer of petition, he went on, we need not fear to ask for temporal gifts; but our requests should not begin or end with these, for the goals of our life and the means thereto far exceed such things. Finally, he pointed out, because of the threefold concupiscence to be found in man, human beings need disci-pline and penance; accordingly there can be no Christian without the exercise of penance. The Holy Father concluded the entire allocution by lamenting the moral disorders that are multiplying at the present time and urged the faithful to petition heaven that good sense may return, that the faith may revive, and that perseverance never grow slack. Three days later on February 18, 1959 (AAS, pp. 144-48), the Pontiff sent a radio message to Lourdes and to the entire world for the conclusion of the centenary year, considering in it the message to be found in the life of St. Bernadette. Bernadette, he said, once more proves the statement of St. Paul (1 Cor 1:27-28) that. God chooses the weak things of this world to ~onfound the strong. Our generation, tie continued, has made admirable scientific progress, and humanity has been seized with a sense of pride at the possibilities now opening to the power of man. But, he added, St. Bernadette recalls to us our need for humility and prayer and reminds us that from Lourdes there comes a call to penance and to charity, a call to detach ourselves from riches and to teach us to share with those poorer than ourselves. Later during the same day (AAS, pp. 140-43) the Pope delivered an allocution to a group of Frenchmen in the Church of St. Louis, King of France. He recalled the long and noble history of Catholicism in France, noting that that history had culminated in the appearances of 233 R. F. SMITH Review for Religious Mary at Lourdes. Having remarked that in the plans of Divine Provi-dence each nation has its own special mission, he went on to describe the mission of France in the phrase: The country of France is the country of Mary. He concluded by reminding his listeners that the last previous Pope who bore the name of John was a Frenchman. Further Documents and Speeches Under the date of February 6, 1959 (AAS, pp. 129-35), John XXIII sent an epistle to the archbishops, bishops, and other local ordinaries of Italy in commemoration of the twentieth anniversary of the death of Pius XI and thirtieth anniversary of the Lateran Pact. In the epistle John XXIII recalled that in the last months of his life Plus XI had planned a plenary meeting of all the bishops of Italy and had in fact begun the composition of the talk he intended to give at the meeting. Sickness and death prevented the completion of the speech, but the unfinished manuscript furnishes us with sufficient knowledge of the last thoughts.of Pius XI. The first subject Pius XI had chosen to consider was that of the care that bishops should have for their seminaries. He reminded them of the need to watch over their seminaries vigilantly even in little matters; he particularly stressed the necessity of sustaining the rectors of seminaries in their severity in admitting candidates and in later promotions to orders. The next p.oint in the projected speech was a warning to the bishops that they should not be surprised if their words were often twisted and misinterpreted. (It should be remembered that Pius XI was writing when Fascism was at its height in Italy.) At this point in the manuscript, John XXIII noted, the writing becomes shaky and confused. But there was still enough strength in the dying pontiff to write a paragraph on the tenth anniversary of'the Lateran Pact. The paragraph is a moving and eloquent one, the dying Pope addressing the relics of the Princes of the Apostles, calling on them to exult because God has returned to Italy and Italy to God, imploring them to prophesy the perseverance of Italy in the faith, and ending with a desperate plea for peace for the entire world. These, remarked John XXIII in conclusion, were the last recorded thoughts of a great Pope. On January 18, 1959 (AAS, pp. 74-79), John XXIII delivered an allocution at the Gregorian University to the assembled professors and students, emphasizing how the very name of the institution recalls the glorious memory of Pope Gregory XIII, who during his pontificate from 1572 to 1585 effected the full restoration of Christian discipline in the Church. 234 July, 1959 ROMAN DOCUMENTS On January 30, 1959 (AAS, pp. 80-81), the Pope addressed members of the Christian Union of Business Executives and Managers. I-Ie regretfully reminded his audience that th~ ~rror still persists that industrial production inevitably involves the conflict of divergent interests. Actually, he said, executives, managers, and workers are not irreconcilable antagonists; rather they are cooperators in a common work which requires mutual comprehension and a sincere effort to overcome the temptation to seek only one's own profit. Under the date of January 17, 1959 (AAS, pp. 149-51), the Vicar of Christ sent a written message to the school children of the United States. His message, the Holy Father wrote, was one of love: God's love for all mankind and man's duty to love God in return and his neighbor for His sake. He urged the children to show their love for children less fortunate than themselves by praying for them and by giving them all possible material aid. Miscellaneous Matters In the issues of AAS under consideration there¯ are several docu-ments which concern Catholics of the Byzantine rite. By the apostolic constitution Singularern huius, dated May 10, 1958 (AAS, pp. 97-98), an exarchate was erected in Australia for Ruthenians of the Byzantine rite; Sydney was designated as the see of the exarchate. A later decree of the Sacred Congregation of the Oriental Church, dated December 12, 1958 (AAS, pp. 107-108), extended the jurisdiction of the exarchate to Ruthenians living in New Zealand and Oceania. A second decree of the same congregation and under the same date (AAS, p. 108) changed the see of the exarchate from Sydney to Melbourne. Byzantine Rite Catholics of Ukrainian origin living in the United States were the object of the apostolic constitution Apostolicam hanc, issued July 10, 1958 (AAS, pp. 156-57). The constitution raised the exarchate of ~Philadelphia to metropolitan status, while the exarchate of Stamford (Connecticut) was made an eparchate. The two together now form a new ecclesiastical province. AAS, pp. 112-13 and pp. 163-64, gives the original texts of two prayers composed by John XXIII for the Church of silence and in honor of the Eucharistic Christ. An English translation of the prayers is given elsewhere in this issue. The last document to be considered is a decree of the Sacred Congregation of Rites issued on August 11, 1958 (AAS, pp. 160-62). The decree approves the introduction of the cause of the Servant of God Clara Fey (1815-1894), foundress of the Sisters of the Poor Child Jesus. 235 Views, News, Previews FROM JULY 31 to August 7, 1960, there will be held the thirty-seventh World Eucharistic Congress, in Munich, Germany. The first four days of the Congress (Sunday, July 31, to Wednesday, August 3) will consist chiefly in conventions of Catholic organizations and g.roups, while the last four days (Thursday, August: 4, to Sunday, August 7) will emphasize liturgical and devotional services centered around the Mass and the Blessed Sac~:ament. Catholic associations who intend to hold meetings during 1960 are requested to hold the meetings in Munich during the days of the Eucharistic Congress. Inquiries about the Eucharistic Congress should be directed to the following address: Generalsekretariat des Eucharistischen Weltkongresses, Maxburgo strasse, 2, Munich, Germany. A community of sisters in New Hampshire has asked that the following communication be printed in the pages of REVIEW FOR RELIGIOUS. "Perhaps some of the religious superiors of sisters in the eastern states would appreciate knowing of an ideal rest and nursing home for sisters desiring complete rest and an opportunity of regaining lost health. As far as we know, it is unique, in that regular medical attendance forms one of the necessary advantages of this quiet and well organized rest home . This home is well furnished and comfort-able, but not luxurious -- so that sisters would quite naturally feel right at home. Rates and information will be furnished on request from Reverend Mother Superior, St. Margaret's Convent, Rest-a-While Building, Gabriels, New York." The twentieth annual North American Liturgical Week will be held under the patronage of Most Reverend Leo A. Pursley, Bishop of Fort Wayne, at Notre Dame University, from Sunday afternoon, August 24, to Wednesday evening, August 27. The theme of the Week will be "Active Lay Participation in the Liturgy according to the Instruction of September 3, 1958." A guest of distinction, who has announced his attendance at the Week, will be James Cardinal Lercaro, Archbishop of Bologna. Room accommodations during the Week will be provided at nominal charge. F.or information regarding such accom-modations write to: Father William Leonard, S.J., Boston College, Boston 67, Massachusetts. It is a pleasure to announce a new magazine which will be of interest to religious. The title of the magazine is Lasallian Digest, a quarterly which began publication in Fall, 1958. The quarterly not only provides informative articles concerning the history, spirituality, 236 VIEWS~ NEWS, PREVIEWS and educational philosophy of the Brothers of the Christian Schools; but it also includes general articles that will be of value to all religious" engaged in educational work. The address of the magazine is: Lasallian Digest, Mont La Salle, Napa, California. The second World Sodality Congress will be held from August 20 to August 23, 1959, at Seton Hall University, South Orange, New Jersey. All sodalists, directors, and moderators, whether members of federations that are affiliated to the World Federation of Sodalities or not, are invited to send representatives to the Congress. Youth sodalities are requested to send only members who are at least sixteen years of age. The theme of the Congress will be "The Vocation of Sodalists of Our Lady in the Crisis of the World Today." Further information concerning the Congress can be obtained by Writing: World Congress of Sodalities of Our Lady, 101 Plane Street, Newark 2, New Jersey. A special leaflet missal containing the Mass of St. Joseph the Workman and designed especially for use at Labor Day Masses is being published by the Catholic Council on Working Life (21 West Superior Street, Chicago 10, Illinois). The missal will be set in large, easy-to-read type with special drawings of men and women at work in a variety of occupations and professions. The leaflet will be ready for shipment on August 1, 1959. Single copies of the leaflet will cost fifteen cents; reduced prices on quantity orders may be obtained by writing the Council at the address given above. The Little Brothers of Jesus hope to begin a new quarterly to be called ~lesus Caritas; the title was a favorite phrase and emblem of P~re de Foucauld whose spirituality the Brothers continue and prolong. A French magazine of the same title has been in existence for some time and in the fall of 1958 a trial issue of an independent but similar English magazine under the same title was issued. The theme of the first issue was "The Gift of Friendship." The new magazine promises to enrich English spiritual reading, since it will mediate the spirituality of the famed Pbre de Foucauld. Persons interested in the magazine should contact: Brother Roger, 24 Autumn Grove, Leeds 6, England. Marquette University, 1131 West Wisconsin Avenue, Milwaukee 3, Wisconsin, announces an Everett Curriculum Workshop which will grant three semester hours of graduate credit in education. The Work-shop, under the direction of Sister Elizabeth Ann, I.H.M., of Immaculate Heart College, Los Angeles, will explore the application of the Everett Report on Sister Formation to the needs of communities of sisters. 237 QUESTIONS AND ANSWERS Review for Religious It has been designed specifically for directresses of study and for the administration and faculty of juniorates and scholasticates (college level) of sisterhoods. The Workshop has been scheduled for the mornings and afternoons of August 6 to August' 26, 1959. It is open only to sisters; the fee is $36. Inquiries concerning the Workshop should be directed to Dean John O. Riedl of the Graduate School of the University. ( ues!: ons and Answers [The following answers are given by Father Joseph F. Gallen, S.J., professor of canon law at Woodstock College, Woodstock, Maryland.] --20-- The constitutions of our pontifical congregation, approved recently, state three times that a religious who is legitimately dismissed is by that fact freed of all her religious vows. This statement is found after the articles on the dismissal of a professed of temporary vows, those on the dismissal of a professed of perpetual vows, and finally after the article on the automatic dismissal of canon 646. I thought that repetition was to be avoided in constitutions. Wouldn't it be much simpler and less confusing to state once that a sister professed of perpetual or temporary vows who has been legitimately dis-missed is by that very fact freed of all her religious vows? The Code of Canon Law itself, in virtue of canon 648, frees a professed of temporary vows, as soon as the dismissal is effective, from all the vows of his religions profession. The code itself (c. 669, § 1) does not free a religious of perpetual vows from the vows of religious pro-fession by the very fact of his dismissal. Such a liberation may be effected by a provision of the particular constitutions, and constitutions approved in more recent years usually contain this provision. (REVIEW FOR RELIGIOUS, September, 1957, 275, 282, 288) The evident reason therefore for the threefold statement is that the Sacred Congregation is opposed to the admixture of canonical with non-canonical matter in the one sentence. However, excessive repetition is to be avoided in the constitutions, and the present repetition is especially unfortunate because it occurs within the same chapter of the constitutions. In one official document, the Statutes for Extern Sisters of Monasteries of Nuns, n. 121, the Sacred Congregation of Religious itself stated this effect in the one article: "A sister legitimately dismissed according to the norm of the preceding articles is by that very fact freed of all her religious vows, whether temporary or perpetual." The Sacred Congregation of the Propagation of the Faith follows exactly the same principle in its typical constitutions for diocesan missionary congregations, n. 128. 238 July, 1959 QUESTIONS AND ANSWERS 21 Our pontifical constitutions state: "The written declaration of the profession, whether temporary or perpetual, signed by the professed sister, by the mother general or her delegate, in whose presence the profession was made, and by two other sisters as witnesses, must be preserved in the archives of the congregation." (Cf. c. 576, § 2.) What is the meaning of the phrase "in whose presence the profession was made"? If it means the one who received the profession, why doesn't it simply state this? The wording of your article in this respect is that of the canon. It does mean the one who received the profession, and it would have been much better if the canon had simply stated this. This meaning is clear from the nature of the act of profession, since canon law itself demands the presence only of the one professing and the one receiving the profession. Furthermore, the rest of the canon, evidently referring to the same person, speaks explicitly of the superior who receives the profession. The unwillingness to repeat a word, phrase, or clause in the same context is a frequent cause of ambiguity in canon law. We do not change the wording of the canons, even when one finds an evidently better and more accurate wording. The Sacred Congregation of Religious itself changed the wording in the Statutes for Extern Sisters of Monas-teries of Nuns, n. 48, to "who received the profession or renovation." --221 You advocate fewer trifling permissions. So do I. What about monthly permissions? We first assemble for this purpose. Each sister then kneels individually before the superior and says, "Please, may I ask my permissions?" Isn't it sufficient to ask permissions? Why must I ask to ask them? She then asks the permissions. "Please, may I rise, dress, wash, say my prayers, perform my community exercises, go to different parts of the house, do my charge, prepare my work, use books, borrow and lend, give away and keep small articles, and bathe when necessary? Please, may I have these permissions?" Don't I already have at least implicit permission for things I am directed or commanded to do, e. g., to rise, perform community exercises, do my charge, and to read at least the books neces-sary for my work? How can I go to the chapel without washing and dressing? If I have permission to wash, doesn't that include all of me? Why do I need pe~-mission to bathe? This ritual consumes from ten to forty minutes. Is it necessary or profit-able, especially when we cannot keep up with our duties? We are told that it is an occasion for increasing merit, but it seems 239 QUESTIONS AND ANSWERS Review for Religious to me to be a very dumb one. Aren't there sensible ways arriving at perfection? This thing of becoming a fool for the sake of Christ can he taken too literally. Impatience has sharpened the style of the questioner and, I hope, has exaggerated the content of her question; but this is not a sufficient reason for de.nying her a hearing. A monthly renewal of such things as dispensations from any of the duties of common life is reasonable. It would also be reasonable to have a less frequent renewal. I have never been able to see the profit of the formalistic monthly permissions, of which the present case is a sufficiently good example. As the questioner says, she already has at least implicit permission for many of the things she is requesting in these monthly permissions. Such monthly per-missions are, in my judgment, an unnecessary, unprofitable, and formalistic detail. A woman's ability to handle details is a valuable talent, but in the religions life she often perverts it and grinds the spiritual life into a smothering dust of details. I believe it is a sound spiritual maxim that artificiality in spiritual matters is an infallible sign of error. Why should we need artificiality to follow perfectly the most reasonable and most highly integrated person who has. ever existed, Jesus Christ? It is not possible nor does obedience demand that we have the expressed will of a superior for every action. If the motive of our action is the vow of obedience (and it is presumed to be such), any action in conformity with the Rule, the constitutions, cnstoms, usages, and the tacit or presumed will of the superior has the merit of the vow. "In many cases, especially of sisters, one finds a manner of governing, a way of conceiving discipline and obedience that reduces the life and religious observance to an arid and oppressive formalism, a negation and death of the religious life itself and of zeal." Rev. J. Alberione, S.S.P., Acta et Docurnenta Congressus Generalis de Statibus Perfectio~nis, I, 270. 23 When is a vote uncertain and consequently invalid (c. 169, § 1,2°)? A vote is certain when the person voted for can be known without any fear of error from the vote itself. A vote for Brother Francis is invalid if there are two or more religious of that name. It cannot be argued that the elector intended to vote for the elder Brother Francis, who will very likely, be elected, rather than for the younger Brother Francis, for whom it is very improbable that anyone would vote. The vote itself must be certain. The family name or other identification must be included when .there is more than one religions of the same name. It is the almost universal custom always to append the family to the religions name. The vote is also uncertain when the writing cannot be deciphered or the sense understood. 240 July, 1959 QUESTIONS AND ANSWERS Our monastery of nuns recently resumed solemn vows. Was I, the superioress, obliged to inform the pastor of the parish of baptism of each of these nuns that she had made profession of solemn vows? Yes. Canon 576, § 2, prescribes: " . . . . and moreover, in the case of solemn profession, the superior who received the profession shall inform the pastor of the place of baptism of the solemn profession, in con-fortuity with the norm of canon 470, § 2~" The latter canon reads: "In the register of baptisms there shall'be noted also the record of the baptized person's confirmation, marriage (unless it was a marriage of conscience, as stated in canon 1107), reception of subdiaconate, or ~olemn profession; and these facts are always to be included in baptismal certificates." Canon 576, § 2, should be and usually is included in the constitutions of nuns. The evident reason for the obligation is that solemn religious profession is a diriment impediment to marriage. Therefore, the notification of the solemn profession of any religious is to be sent to the pastor of the parish of baptism. According to the canon, this duty falls on the superior who received the solemn pro-fession; but he or she may do it through another. In fact, the notification is the duty of the superioress of the monastery, even if she did not receive the profession; and this is the usual wording of the constitutions. The notification should contain the full secular and religious name, the place and date of the solemn profession, the full names of the father and mother of the religious, and at least the approximate date of the baptism. Complete and accurate data for the notification can be obtained from the baptismal certificate, if this is in the files of the house where solemn profession was made. --25-- Our general motherhouse is in France. Our constitutions underwent a general revision. Is an ~mprlm~t~tr re~iuired in France for the printing of the constitutions in French? Is another imprimatur necessary for the English translation of these constitutions from the French? The answer to both questions is yes. Prudence demands that any translation of the constitutions, also and especially of the original approved text, be submitted to the examination of a priest conversant with the canonical terms on religious. If this is not done, awkwardness, inaccuracy, and errors of translation are very likely. Canon law com-mands previous censorship by a local ordinary for determined works but only if they are published (c. 1384). Publication means that the work is made available to the general public. Therefore, works that are destined solely for the members of a religious institute are not published; 241 QUESTIONS AND ANSWERS Review for Religious and there is no obhgation of submitting them to the previous censorship of a local ordinary. However, it is the common practice of lay institutes to submit the constitutions to this censorship of the local ordinary. According to this practice, there should be an imprimatur for the constitutions in French and another for the English translation, because canon 1392, § 1, requires another censorshilJ for a translation. The granting of an imprimatur appertains to the proper local ordinary of the author, the ordinary of the place of publication, or the ordinary of the place of printing (c. 1385, § 2). A compiler or translator is included under the term of author. Strictly speaking, the author or legislator of constitutions of lay institutes is the Holy See or the local ordinaries; the official compiler is the general chapter. Constitutions are translated and distributed (published) under the authority and direction of a higher superior. Therefore, the imprimatur for these constitutions may be requested from the ordinary of the place of the general chapter, of the residence of the higher superior, or of the place of printing. In fact it is practically always given by the ordinary of the residence of the higher superior. m26-- Brother X, professed of solemn vows, was a lay brother in our order. He became an apostate from religion. Both his local and immediate higher superior were earnestly striving to persuade him to return to the order. We learned later that he had met a woman, a Catholic and previously unmarried, two weeks after he left his religious house. A week later he got a priest to marry himself and this woman. He concealed the fact of his solemn vows. The constitutions of our order explicitly state that a professed of solemn vows who is legiti-mately dismissed is by that very fact freed of his solemn vows. Was the marriage of Brother X and this woman valid? If Brother X had been a religious cleric in sacred orders (sub-diaconate, diaconate, priesthood) or if a legitimate dismissal, in virtue of the law of the constitutions, did not free him from his solemn vows, his marriage would have been certainly and evidently invalid by reason of the diriment impediment of sacred orders (c. 1072), or solemn religions profession (c. 1073), or both. Therefore, the case of a solemnly professed described above is possible also with regard to a nun or a religious man destined for the priesthood but not yet in sacred orders. The automatic dismissal of canon 646 is a legitimate dismissal, since this canon explicitly states it to be such and it is effected according to law and by law. This dismissal therefore produces the effects of a legitimate dismissal. The code itself (c. 669, § 1) does not free a dismissed religious of perpetual vows, whether solemn or simple, from the vows 242 July, 1959 QUESTIONS AND ANSWERS of religious profession by the very fact of the dismissal; but such a liberation, as in the present case, may be effected by the constitutions. We presuppose that the only possible source of invalidity in this case is the solemn religious profession. If, prior to the Catholic celebration of marriage, this religious had publicly apostatized from the Catholic faith, or had run away with a woman, or had attempted marriage outside the Church, he would have been immediately and automatically dismissed in virtue of canon 646. His own constitutions would have freed him in the same instant from all his solemn vows. Since the diriment impediment to marriage is attached to his solemn vow of chastity, which would have ceased to exist, his former solemn profession would in no way have interfered with the validity of a later Catholic celebration of marriage nor would the impediment in question have had to be dispensed. It would simply have ceased to exist. No such previous crime occurred in the present case. Brother X did not even, know the woman until two weeks after he had left the religious house. Canon 646 automatically dismisses any religious who attempts or contracts marriage. It is therefore certain that Brother X was automatically dismissed by canon 646 and freed of his solemn vows, and consequently of the diriment impediment, by the constitutions at the moment that he and the woman gave the marriage consent. There-fore, the precise question is: does a simultaneous freedom from a diriment impediment suffice or is a freedom previous in time necessary for the validity of marriage? I believe that a simultaneous freedom suffices and that the marriage was valid. Canon law does not solve this individual case nor does it explicitly state any general principle on the matter. The case should therefore be decided from analogy (c. 20). There are at least two analo-gous cases in the code, and it can also be maintained that these cases implicitly affirm the general principle of the sufficiency of si~nultaneous freedom. Canon 1126 states that the bond of a former marriage con-tracted in infidelity is dissolved by the Pauline Privilege only when the conv.erted party actually contracts a new and valid marriage. Therefore, in the Pauline Privilege the simultaneous freedom from the diriment impediment of a valid and still existing marriage suffices for the valid contracting of marriage. By the prescription of ecclesiastical law, a marriage is invalid if one of the parties is free and believes the other party to be free when in fact the latter is a slave in the strict sense of this term (c. 1083, § 2, 2°). The common interpretation of this canon is that the marriage is valid if the slave obtains freedom by marriage. Therefore, we again have a case in which simultaneous freedom from an invalidating cause suffices for the validity of marriage. It cannot be objected that this solution offends against the principle that no one should profit by his crime. This principle cannot be main- 243 QUESTIONS AND ANSWERS Review for Religious tained against an expressed declaration of law. The code itself (c. 648) frees from his vows a religious of temporary vows who commits any of the crimes listed in canon 646, and canon 669, § 1, and positively and explicitly permits the particular constitutions to grant the same freedom to a professed of perpetual vows, whether solemn or simple. --27-- I read the constitutions of a lay congregation that has recently been made pontifical. Their definition of an ordinary and extraordinary general chapter differs from our own, which I enclose. Which of these definitions is correct? In older constitutions, an ordinary general chapter is one convoked regularly at the intervals determined in the constitutions for general elections. This interval is usually every six years, because in the modern practice of the Sacred Congregation of Religious th~ term of office of the superior general is six years. An extraordinary chapter in the same constitutions is one convoked outside of such regular intervals. The first reason for such a chapter is the vacancy of the office of superior general by reason of death, resignation, or deposition. The second is a serious matter affecting the entire institute. The latter is therefore only a chapter of affairs and only for determined matters, such as approval of a revision of the constitutions. This latter chapter in pontifical lay congregations demands a serious reason, the deliberative vote of the general council, and the permission of the Holy See. (Bastien, Directoire Canonique, n. 240, 2; Battandier, Guide Canonique, nn. 341, 346; Schaefer, De Religiosis, n. 452.) In very recent years, the Sacred Cong~'egation has changed this definition in the constitutions of lay congregations that are being made pontifical but not in revisions of constitutions of congregations that were already pontifical. The change consists in the fact that any chapter for the election of a superior general is termed ordinary, any other is extraordinary. The following article typifies this change. "A general chapter is called ordinary whenever it convenes for the election of a superior general, whether a~ the expiration of the ordinary term or when the office becomes vacant for any reason at another time. Any other chapter is said to be extraordinary and may not be convoked without special authorization of the Holy See, upon request by the superior general with the consent of his council." Both definitions are therefore correct, that is, all institutes retain the definition given in their own constitutions. 28- We have a common or public devotional renewal of vows twice a year. The renewal is made before the reception of Holy 244 July, 1959 QUESTIONS AND ANSWERS Communion. Do we by this renewal gain the indulgence men-tioned in the R~ccolta, n. 756? The Raccolta reads: "The religious of any order or congregation who privately renew their religious vows with at least a contrite heart, after celebrating Holy Mass or receiving Holy Communion, may gain an indulgence of three years." It can be argued that the essential condition is a devotional renewal, not necessarily a private renewal, or that an indulgence granted to a private renewal afortiori applies also to a public renewal. Therefore, the indulgence is gained by a public or private'devotional renewal of religious vows. However, the text clearly demands that the renewal be made after the reception of Holy Com-munion. Therefore, a public or priva, te renewal before Communion does not suffice. On the days of such public devotional renewals, the indul-gence may be gained by again renewing the vows privately after Com-munion. No determined formula is required; and brief formulae, such as "I renew the vows made at my profession," "I renew my vows of poverty, chastity, and obedience," would suffice. The condition that the renewal be made after Holy Communion seems strange, because in two documents, issued before the Code of Canon Law, the Sacred Congregation of Rites had prescribed that professions and public renewals were to be made before Holy Com-munion by religious of congregations who took or renewed their vows during Mass (S. R. C., 3836, 3912). This rite has been retained after the code as a prescription of their own law by at least most of the same religious institutes, and the natural tendency of a religious is to renew his vows privately at the same time during Mass that professions and public devotional renewals are made in his institute. 29 Our constitutions demand an absolute majority for the ejection of the superior general on any of the first three ballots. If such a majority has not been obtained, on the fourth and last ballot only the two religious who had the highest number of votes on the third ballot may be voted for. Of these two, the one who receives the greater number of votes on this fourth ballot is elected. In our last chapter, there was no doubt about the one elected. The constitutions also are clear on the matter; and the president of the chapter gave a brief, simple, and clear exposition of the article. However, on the fourth ballot a vote was cast for a religious who was not one of the two highest on the third ballot. We simply did not know what to do about this vote. This one vote was invalid, because it was in' favor of one who lacked passive voice absolutely, that is, one who simply could not be 245 QUESTIONS AND ANSWERS Review [or Religious elected. The constitutions clearly restrict eligibility on the fourth ballot to the two who had the highest number of votes on the third ballot. There was also no question whatever of postulation. The constitutions of our congregation demand merely thirty years of age and ten years of profession for a regional superior. Is this correct? Is it sufficient? Any part of an institute that fulfills the canonical requisites for a province is in fact and in law a province, no matter by what name it may be designated in the particular constitutions. The essential canoni-cal requisite for a province is that. of being a distinct moral person, distinct as such from the institute and the houses. A provincial superior is necessarily a canonical higher superior. We presuppose that your regions are not in fact canonical provinces, as is at least practically always the case. The authority of a regional superior may be delegated by a superior general or provincial. If so, he is not a higher superior. The regional superior may possess ordinary authority, that is, authority given by the law of the constitutions. If so, he is a higher superior (c. 488, 8°). In the former case, your constitutions are correct. Canon law does not legislate on the matter~ and the thirty years of age and ten years of profession are prescribed entirely by your own constitutions. If, however, the regional superior is a higher superior, canon 504 must be observed, that is, for the validity of his appointment or election he must be Of legitimate birth, have been professed for at least ten years in the institute computed from his first prQfession (August 15, 1955 -- August 16, 1965), and have completed his thirtieth year (January 1, 1930 -- January 2, 1960). 31 Our pontifical congregation is very large. For many serious reasons, we hesitate to make an immediate division into provinces. We believe it would be more prudent to begin instituting several regions. Do we need the permission of the Holy See to do this? No. Obviously your regions will not be pro~vinces. Therefore, the canonical norms (c. 494) on the erection of provinces do not apply. The establishment, delimitation, change, and suppression of regions may be made by the general chapter or the superior general. Since the matter is so important, the latter ~hould at least consult and preferably have the consent of his council. The latter is practically always de-. manded for these acts when the constitutions make provision for regions. Cf. Larraona, Commentarium Pro Religiosis, 5 (1924), 263-64; Schaefer, De Religiosis, n. 325; Toso, Commentaria Minora, II, 246 July, 1959 QUESTIONS AND ANSWERS De Religiosis, 17; Vromant, De Personis, n. 375; Vermeersch-Creusen, Epitome Iuris Canonici, I, n. 603; Coronata, Institutiones Iuris Canonici, I, n. 519. Our constitutions state only that a professed religious who commits any of the crimes listed in canon 646 is by that very fact legitimately dismissed. It seems to me that it would be only sensible for the constitutions to tell us what these crimes are. I think also that canon 646 should be given fully in the consti-tutions. It has not been the general practice to do so in lay institutes, as it has been in clerical institutes. However, some constitutions of the former type of institute do contain the complete canon. Canon 646 was given fully and explained in the REVIEW FOR RELIGIOUS, 16 (1957)~ 283-89. The canon reads: § 1. The following religious are considered as automatically and legitimately dismissed: 1° Public apostates from the Catholic faith; 2° A religious man who ran away with a woman or a religious woman who ran away with a man; 3° Those who attempt or contract marriage, even the so-called civil marriage. § 2. In these cases, it is sufficient that the higher superior with his chapter or council according to the norm of the constitutions make a declaration of fact; but he must take care to preserve the collected proofs of the fact in the files of the house. 247 Reviews [Material for this department should be sent to Book Review Editor, aEVIEW FO~t RELIGIOUS, West Baden College, West Baden Springs, Indiana.} PORTRAIT OF A PARISH PRIEST. By Lancelot C. Sheppard. Westminster: Newman, 1958. Pp. 183. $3.50. One hundred years ago, on August 4, 1859, died St. John Vianney, Curl of Ars. A living inspiration to laymen and religious as well as to the secular clergy, he had become almost a legendary figure in his own lifetime. Today, his name calls to our mind a student so slow that only the shortage of priests and the insistence of an influential friend made it possible for him to be ordained. We think of a preacher who spent hours of agony in composing commonplace sermons, and then would forget them once he got into the pulpit only to speak with such zeal and intensity as to move his hearers to tears. Contrasting images of Ars come before us -- the out-of-the-way village of 1818, where there was a dilapidated old church, sixty houses, four taverns, and "no great love of God"; and the place of pilgrimage of 1859, with a restored church, no tavern, but one school for girls and one for boys, and crowds of the devout and the curious. Portrait of a Parish Priest treats of a man in whose life the extraordinary seems to be the ordinary thing. Living for years on two or three potatoes a day, with but two hours sleep a night, the CurLkept up a strenuous apostolic life. He could size up the most delicate cases of conscience in a moment and even knew the problems of many penitents before they entered the con-fessional. Many a distressed sinner was singled out from the crowd by the saint's voice and called in to penance ahead of a long line. Scoffers eventually prayed. Diseases were often cured. Add to this the almost nightly rappings, voices, and even the burning of the bedclothes, which the Curl was convinced was the work of the devil, the Grappin, and we have a picture of a truly remarkable man. None of these facts ar~ new, and all have been well treated in previous biographies. The unique feature of Portrait of a Parish Priest is its interpre-tation of the facts. For besides giving us a portrait of a great saint, the author paints a picture of a man. And the life of John Vianney was not a series of interludes between one extraordinary event after another. A man capable of deep discouragement and subject to great psychological tensions, he had been tempted to give up his studies for the priesthood, to desert Napoleon's army, and to flee from the responsibility of his parish. He was convinced that he was not fit for his job and feared greatly for his own salvation. It was his heroic perseverance in the face of these obstacles that was truly remarkable. In the author's opinion, the psychological tension under which the Curl worked was responsible for the "diabolical" disturbances in the saint's life. Whether or not the reader agrees with this explanation, he will find it thought-provoking and will welcome the insistence upon the fact that it was the Cur~'s heroic virtue and not the extraordinary events (whatever their expla-nation) that made him a saint. 248 BOOK REVIEWS St. John Vianney was a man filled with the horror of sin, because he was a saint filled with a love of the living God. But he was also a man who poured out condemnations of pleasures Which can be legitimate in themselves, a man who would refuse absolution to those who would not promise to give up dancing. Fie could, it is true, appreciate the humor of a situation; but on the whole he tended to see the dark side of things. Yet this should not be surprising in a man who grew up in a France in which the Church, was being persecuted and in which clouds of Jansenistic thought still darkened the moral atmos-phere. One new fact which the author brings to light

Issue 13.6 of the Review for Religious, 1954. ; Review for Religious NOVEMBER 15, 1954 Xaverian Pioneers . Brother Alois Address to Mothers General Arcadio Larraona ' Psychology .and Judging Others . Just November~r Always7 . Sister Mar~ Joseph N. Tylenda News and Views Book Reviews Communications Questions and Answers A Good Superior Index for 19S4 VOLUME XIII NUMBER 6 REVIEW FOR RELIGIO.US VOLUME XlII NOVEMBER, 1954 NUMBER CONTENTS XAVERIAN PIONEERS---Brother Alois, C.F.X .2.81 SOME SPECIAL PUBLICATIONS . 289 A GOOD SUPERIOR . 290 VOCATIONAL LITERATURE REQUESTED . 296 ADDRESS TO MOTHERS GENERAL-- Most Reverend Arcadlo Larraona, C.M.F. 297 OUR CONTRIBUTORS . 305 FATHER LARRAONA'S ADDRESS. . 306 FAMILY DAY . 306 THAT 'JUDGING OTHERS' HABIT IN THE LIGHT OF MODERN PSYCHOLOGY~ister Mary, I.H.M .307 NEWS AND VIEWS-- American Founders' Series; Congress in Canada; Notre Dame, 1953 310 JUST NOVEMBER---OR ALWAYS?~oseph N. Tylenda, S.J. 311 COMMUNICATIONS . ~ . 315 BOOK REVIEWS-- The Promised Woman; Pio Nono; These Came Home; Mediaeval Mystical Tradition and Saint 3ohn of the Cross . 317 BOOK'. ANNOUNCEMENTS . 321 NOTICE FOR PUBLISHERS . 324 QUESTIONS AND ANSWERS-- 31. Establishing Dowry after Solemn Profession . 325 32. Plenary Indulgence "in the form of a Jubilee" . . 325 33. Relatives on General Council . 326 34. Mistress of Novices as General Councilor ." . . . 327 35. Retaining Office because of New Constitutions . 327 36. Books on Obedience . 328 INDEX FOR 1954 . 332 REVIEW FOR R~LIGIOUS, November, 1954. Vol. XIIL No. 6. Published bi-monthly: January, March, May, Ju!y, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office. Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Augustine G. Ellard, S.J., Adam C. Ellis, S.J. Gerald Kelly, S.J., Francis N. Korth, S.J. Copyright, 1954, by Adam C. Ellis, S.J. Permission is hereby granted for quota-tions of reasonable length, provided due cre~tit be given this review and the author. Subscription price: 3 dollars a year: 50 cents a copy. printed in U. S. A. Before writing to us, please consult notice on Inside beck cover. Xaverian Pioneers Brother A1ois, C.F.X. THE motto ,,o,f the Xaverian Brothers, Concordia res parvae crescunt--by harmony little things grow"--has been so perfectly fulfilled and demonstrated in [the history of the con-gregation that it is difficult to signal out o,ne Brother who was in any large way responsible for the growth ~f the order. It had no Saint Francis or Saint Bernard to attract !followers by the very force of his magnetic sanctity, no counterp.art of Mother Cabrini or Saint Teresa to solve financial difficultie~ with a holy wizardry and bring forth numerous foundations at ithe touch of his wand of faith. Theodore Ryken (Brother Francis Xavier), the founder of the institute, was indeed a man of gr~at holiness and of the deepest faith. To him alone must be the hqnor and glory for hav-ing conceived the idea of the Brotherhood land having brought it into actuality despite difficulties that wer~ unusually great even when compared with the hardships religio~,s founders have gener-ally met. But it cannot be said that he large!y influenced the growth of the congregation. In the plan of God tl~e very existence of the new foundation was insecure as long as Brother Francis Xavier ruled it and it became firmly established onl~r after BroW:her Vincent had succeeded him as superior general. The growth and spirit of the congregation can really be accredited only to a cooperative ef-fort. Down through the years and even n'ow it has been and is difficult to select many Xaverians who stan~d out from the others. Yet the body religious has achieved a certain prominence and has developed a particular spirit of~ Which it can be proud¯ Still it cannot be said that like a spiritual Topsy the Xaverian Brothers just grew. In this centennial year ih America the members of the congregation pay tribute not only to~ the group but also to some specific predecessors¯ And characterlstxcally most of the honor ~ . goes tO tWO heroic souls who were outstanding for neither their learning nor influence nor high positions no~ great achievements but only because they were holy, humble, obedi,ent, and loyal: Brother Francis Dondorf and Brother Stephen ~Sommer. To understand these men we must re)giew the not-too-well-known story of the foundation of the congregation. Theodore James Ryken was born in Elshout, North Brabant, 281 BROTHER ALOIS Review for Religious Holland, in 1797. Left an orphan at an early age he was brought up by a.pious uncle who instilled into theboy's character a great zeal for souls. He seems always to have been drawn to the work of Christian education, for he worked in his native land as a cate-chist and a lay.teacher in an orphanage. In 1828 Mr. Ryken entered th~ Trappist monastery at Stras-bourg, France, but in 1829 the monks there had to disband and abandon their monastery because of the anticlerical laws of the time. He did not choose to return to Holland for a long period, however, fo~ in 1831 he journeyed to America, planning to act as a lay cate-chist in this country. What he did during all of his three-year stay in the United States has not been completely established. We do know from extant letters that he spent at least three months work-ing with the renowned missionary Father Stephen Baden among the Potawatomi in the area around what is now South Bend. In private papers left by Brother Ignatius, th~ founder's first' disciple, we learn that Mr. Ryken supported himself at one time by work-ing as a porter on a lumber barge, carrying planks from dawn until dusk; at another time he sold oil as a street peddler in New York City. At still another time he served as an attendant on a bishop, probably Bishop Edward Fenwick of Cincinnati. In private papers that he left Brother Ignatius sums up this period thus: "Though his vicissitudes were many and great, he still took delight in structing those about him in the truths and practices of our Holy Religion whenever a favorable opportunity presented itself." The Founding Seeing the great need for Catholic teachers, Mr. Ryken con-ceived the idea of a brotherhood devoted to this work. He returned to Belgium and laid his plans before Bishop Boussen of Bruges. The latter favored the idea but seems to have required the founder to get the approval of the American bishops, because in 1837 Mr. Ryken again went to the United States for that purpose. In six months he had obtained letters of. approval from seven members of the American hierarchy and several prominent priests and he re-turned with these to Europe. He journeyed to Rome and from Pope Gregory XVI he obtained a blessing on his p~oposed foun-dation. He then went to Bruges, secured the necessary episcopal approval, and entered the novitiate of the Redemptor!sts at Saint Trond to prepare himself for his work. At the end of his probationary period the Redemptorists re- 282 November, 195~ XAVERIAN PIONEERS ported.favorably on Mr. Ryken's fitness, and on June 5, 1839, he established himself in a house on Ezel Street in Bruges and began to seek disciples. This date is celebrated as Fo'undation Day. But for a year Mr. Ryken was a founder without an order. Then on June 9, 1840, one, Anthony Melis, joined him and, as Brother Ig-natius, was always considered by the founder as his eldest son. But growth continued to be slow; in 1842 there were seven members, in 1846 only ten. In the original plan he drew for the foundation of the order, Mr. Ryken had innocently written: "Ten or twelve months after the foundation of the Congregation in Belgium, one of the Brothers is to proceed to America to prepare the house, buy ground and ar-range everything for the arrival of the first Brothers sent to Amer-ica . " Those "ten or twelve months" were actually to extend to fifteen years before the aim of the order could begin to be realized, but in the long meantime Ryken's faith, courage, and determination wavered not a bit. Brother Ignatius gives us a picture of the destitution the little group endured. "House furniture of any kind and the merest home comfortg were luxuries they enjoyed not. Even the very necessaries of life were sometimes wanting. The floor was for some time their only bed, old clothes their covering; an old deal box, their table; old bed-sheets, their curtains; and an empty, stove their winter's warmth." The founder made shoes to. obtain some income but for the most part they existed entirely on charity. They lived in an unpaid-for house hourly expecting eviction. The free school they opened in 1840 prospered but only added t.o the financial burden. Bitter criticism and strong opposition even from quarters where they had a right to expect encouragement added to the difficulties. Yet the band did grow. Another primary school was opened at Bruges and men were sent to a normal school at Saint Trond for professiohal training. In 1848 a school was opened in Bury, England, not to take the place of the American mission but be-cause Catholic education in England at that time was a true mis-sionary work and because the Brothers could improve their English there before being sent to America. In 1853 the Bishop of Louisville, Kentucky, Martin John Spalding, visited the Bishop of Bruges and through him met Brother Francis Xavier Ryken. Learning of his desire to send men to the United States, the Bishop contracted then and there for six 283 BROTHER ALOIS Reoieto [or Religious Brothers to teach in the parochial schools of Louisville. But when the Brothers reached Louisville they found that all their previous training in enduring hardships, and more, was needed to withstand the difficulties they encountered in the new country. Here they met a new kind of opposition, bigotry. Anti-Catholicism, instigated and spread by the "Know-nothings" and members of kindred organizations, was strong and active. In Louisville the fanatics who a year later, on August 5, 1855, were to instigate the terrible riots that resulted in the butchering of twenty-two Catholics and the burning of numerous Catholic homes, were thoroughly aroused by the coming to the city of these six mysterious-looking foreigners. Reports were circulated and even published in the news-papers that these men had come to train up an army to wage a bloody war on Protestants, that they had ammunition and arms stored in" their school. A thorough search of the place was demanded. After hiding their altar vessels in a cemetery, the Brothers dispersed. and lived a while with private families. Only after their school and living quarters were ransacked and the utter simplicity of their mode of life was proved to even the most fanatic opponent, could they reassemble. In contracting for the Brothers' services, Bishop Spalding had agreed to pay one hundred and thirty dollars a year for each Brother. This proved to be too little and it was impossible to get more; hence after four years the Brothers had to be recalled. But because funds were not available for passage for all and because--so tradi-tion goes--they were the most expendable, Brother Francis Don-doff and Brother Stephen Sommer were left in Louisville. Brother Francis That Brother Francis Dondorf was a Xaverian Brother was a miracle of grace--a flood of grace that attracted him to a very unat-tractive institute when he could have joined many more promising ones, and which maintained and developed that attraction when even the congregation itself misunderstood and rejected him. He was born in 1816 in Aix-la-Chapelle. His family was well off; his home and school training were good. At twenty-six he held a good position in the post office of his native city. But his heart was not at rest and he prayed for light to know what God had in store for him. Always most devoted to the Blessed Sacra-. ment, he was accustomed to make a visit when he passed a church. One day in 1842 on leaving the Cathedral of Aix-la-Chapelle after 284 November, 1954 XAVERIAN PIONEERS one of these visits he struck up .a conversation with another man leaving at the same time. This was Brother Ignatius, Theodore Ryken'g first disciple, sent by him to Catholic- centers to seek re-cruits. As a result of this providential meeting, Francis Dondorf shortly after presented himself to the founder seeking admission to the new congregation. He was accepted and, following a pro-bationary period of a year and a half, received the habit on Easter of 1844. For two years Brother Francis attended the normal school at Saint Trond but was recalled then because of a shortage of teach-ers at Bruges. With Ryken and nine others he pronounced his temporary vows on October 22, 1846, but. when these vows ex-pired he was considered by the founder to be unsuitable for the life and told to leave the congregation. What later proved to be char-acteristic unobtrusiveness in community had been taken as morose-ness; what was only inexperience was judged to be lack of ability in the classroom. Grief-stricken, but with a wonderful courage and an unslackened devotion to and love for the congregatio.n, Fran-cis Dondorf returned home. Resolutely he enrolled at the normal school at Langenhorst in Rhenish Prussia to fit himself for his chosen and determined vocation. Two years later, without previous arrangement, he presented himself again to the founder for readmis-sion. He was accepted and pronounced his perpetual vows on De-cember 3, 1853. The next July he was chosen as one of the pioneer band emigrating to America. Brother Stephen Brother Stephen was born andreared in Attendorn, Westphalia. At fifteen he was apprenticed to a tailor and after four years took up that trade in Muenster. Attracted to youth work, even then, he formed a club for the young men of his area. He interested others in the work and they formed similar groups in other cities. Their achievements came to the attention of a priest, Father Adolph Kolp-ing, who offered to take over the direction of the work. The well-known and widespread Kolping Institute grew from this beginning. A chance reading of a newspaper story of the taking of vows by the founder of a new education society,in Bruges was the instru-ment of grace that awoke in Stephen Sommer a desire to make a like immolation of himself. He pondered the decision prayerfully for a year and at length applied for admission. He was accepted and arrived at Bruges on December 8, 1848, a very significant.date in view of his deep love of and abiding devotion to Our Blessed 285 BROTHER ALOIS Revleu~ for Religious Mother. He received the habit on April 2, 1850, and pronounced his vows on February 2, 18521 A man of great humility, Brother Stephen at first gave no ~n-. dication of the keen mind he possessed and was put to work as a tailor. The discoverer.of his intellectual ability--so the story goes-- was by one of those incidents that seem to be repeated in the histgry of every religious order. He was scrubbing a floor one day when two Brothers who were unable to solve a mathematical problem asked him jokingly whether he could help them. He arose from his knees, quickly and nonchalantly solved the problem, and returned to his menial work. When Brother Francis Xavier was informed of the incident, Brother Stephen was enrolled immediately at the normal school. In 1854 he was not chosen to accompany the band that set out for America but in 1856, when one of the original six died in Louisville, Brother Stephen was sent as a replacement. However, after Brother Stephen had left Bruges, the founder had written to Louisville recalling two of the men. The letter ar-rived before Brother Stephen and when he got there he found only three where he had expected five. Then, in 1858, because of the im-possibility of getting an increase in the annual, salary, two more Brothers were recalled. Brother Stephen and Brother Francis were assigned to Immaculate Conception school. They took up their abode in two small rooms at the rear of the classrooms and settled themselves to carry on in the face of any difficulties that could present themselves and for as long as obedience required them. For two years these valiant souls held the fort alone. Both humble, quiet, prayerful men, they must have been a pleasing sight in the eyes of heaven as they went through.their daily spiritual ex-ercises, did their househoId chores, cooked and ate their meager re-pasts, prepared their lessons and taught their classes. Heroically ig-noring every cause of discouragement; steadfastly resisting those who tried to persuade them to cast themselves off from the European foundation, which was precarious in itself and so very distant, and to join the priesthood or another band of Brothers; humbly living on the charity of a kind curate of the parish, they kept burning the flame of Xaverianism in America. In 1860 the pastor of Immaculate Conception parish visited Bruges to try to obtain an addition to the.community of two which was doing such fine work at his school. Brother Francis Xavier had by this time handed over the reins of government of the congrega- 286 No~embet', 1954 XAVER/)kN PIONEERS tion. By offering a salary of two hundred and fifty dollars a year instead of the one hundred and thirty, the priest won Brother Vin-cent's, promise of eight more Brothers; and soon these set out for the new land. It does not require much power of imagination to picture the joy of Brothers Francis and Stephen when they were again united with their Brothers in Christ. God was good, their faith had been justifie!! As His instruments they had labored as He saw fit, and great things could now come of His work. Of course a great new day did not dawn bright and clear at once. The Brothers still had to undergo numerous hardships. The ten of them, with several additions that came later, lived in ex-tremely cramped and poor quarters for four years. Knowing that financial conditions in Bruges were worse (in twenty years not a cent had been paid on the mother house), they made every sacrifice to save. Their usqal lunch was coffee and bread with molasses. They fasted on non-school days. Ultimately they were able to send to Brother Vincent the money needed to establish the congregation firml~ in its birthplace. On March 19, 1861, Michael Sullivan (later Brother 3oseph) entered the congregation as the first American postu-lant. 3ohn Quill (Brother 3ohn) entered before the year was over and others followed. Never startling, the growth nevertheless con-tinued steady. Brother Francis lived thirty-two years in religion; Brother Ste-phen sixty-six. They both had terms as novice master, but in those days that was hardly more than a side line. Brother Stephen, for instance, besides being novice master, was house tailor and a full-time teacher, too! They were both very successful teachers in class and in community. But it was their example as religious that, as far as we can judge, bad its greatest effect and for which they are held most in esteem in the congregation today. Closing Years Brother Francis was a stern character. One of the Brothers who taught with him as a young man tolff how, as they walked the half mile to school every morning, Brother Francis would ask him how he intended to teach his classes that day, would give him valu-able suggestions on the lessons, and supply him with anecdotes on 'the subjects involved. As a man of prayer and recollection he spoke only when good would be the result. In fact the Brother used to tell how a little, boy who had frequently seen them pass hollered one 287 BROTHER ALOIS Review for Religious day: "Look! that old man and his son never talk!" In class he was a model of efficient activity. Outside of class his only pleasure was in more work. On both Saturdays and Sun-days he gathered his boys for Mass just as he did on school days. The only difference was that Sodality and games rather than classes filled in the remaining time of the week-end days. He possessed a. good voice and delighted in teaching the boys hymns and songs, not.for the music's sake but because he loved the hymns and had a fund of songs that inculcated virtue and lauded goodness. Brother Francis, we are told, grew always in that love and de-votion to the Blessed Sacrament which we saw was the occasion of his first contact with a Xaverian Brother. In chapel he was an inspiration to all; after Holy Communion so rapt in love was he that he almost seemed to be in ecstacy. In. singing hymns the deep devotion of his soul was evident in his sincere voice, his intense expression, in the tears that frequently flowed down his cheeks. The Blessed Sacrament was the core of his existence, and the Brothers spoke often of how their own devotion to the Eucharist increased through just living with him. Like Brother Francis, Brother Stephen had a passion for work. A little man, weighing less than a hundred pounds, he nevertheless was always active. Even at the age of eighty-six he was the treasurer and bookkeeper for the large community in Louisville; he had charge of the bookstore of the high school and was tailor as well--"tailor" meaning not only that he repaired all the Brothers' clothing but made their habits too. This latter duty he had for fifty-one years in Louis-ville, Performing the tasks far into the night after a full day of teach-ing, paper-correcting, and lesson-planning. He was tenderly devoted to our Blessed Mother. One had only to see him recite her rosary or say her office to realize his heart was consumed with love for her. It is said that at the mention of her name such a look suffused his face that one would think he really saw her in glory. Brother Stephen possessed an excellent memory until the time of his death. He was extremely modest, refusing always to acknowl-edge he had done anything great in the obedience he had performed. Above all he was humble. Even as an old man past eighty, when-ever he thought he had been uncharitable to another he would kneel in the dining room before meals and publicly accuse himself and ask pardon of the one he thought he offended. Scrupulously conscious 288 No~ember, 1954 X&VERIAN PIONEERS of his vow of poverty, he opposed any innovation that smacked of luxury or worldliness. Even on his deathbed he was so distressed at the use of an electric fan which the Brothers rented to offset the terrible Louisville heat that it had to be sent back. He. objected, too, to a screenthey put in the window, fearing he would suffer in p,ur-gatory for the softness it indicated. He wanted to die as be had lived, a poor man of prayer. And so he did, breathing his last on September 19, 1911, revered by all as a saint. Brother Julian, the historian of the American Province of the Xaverian Brothers from whose work most of the information here is taken, fittingly sums ~ap the work of these two pioneers: "With the knowledge of saints, Brothers Francis and Stephen knew that God works silently and slowly: that perseverance in a cause, holy in itself, must bring success in time if faith but dominates the works. Today proclaims that they were right; and the present success and standing of the Community in AmeEca may be traced to these two holy men, who had naught but faith to sustain them, but hav-ing that had all that was necessary." (Men arid Deeds, by Brother Julian, C.F.X. [Macmillan, New York, 1930], p. 20.) SOME SPECIAL PUBLICATIONS Some twenty years have n.ow elapsed since Father T. L. Bouscaren, S.J., pub-lished the first volume of Canon Law Digest. The purpose of this work was t~ present the busy priest with all the official decisions on matters pertaining in some way to the canons in the Code of Canon Law and to present these in readable Eng-lish. The material was arranged in the order of the canons, and everything w~is carefully indexed and--wherever useful-~cross-indexed. After the publication of Volume I, supplements were published periodically: and finally, about ten years after the appearance of the first volume, the second ~,ol-ume was published. This second volume contained not only the material of the supplements but other new material as well. It is a pleasure for us to announce that Volume III of this interesting and valu-able collection of documents is now available. (Bruce: Milwaukee, 1954 Pp. xii+ 762. $11.) A special feature of this new volume is that it contains cumulatioo "indices, both chronological and general, of all three volumes. For religious, in par-ticular, we might note that the present volume contains the complete texts of the Allocution of Pope Plus XII on the religious life (Dec. 8, 1950), the quinquen-nial report, and the annual report. It also contains the text, without the foot-notes, of the Apostolic Constitution Sponsa Christi, together with the "General Statutes for Nuns" that were included in the papal document and the Instruction of the Sacred Congregation of Religious "for putting into practice the Constitu-tion Sponsa Christi.'" These are merely indications of the valuable material con-tained in the present volume of Canon Law Digest. (Continued on Page 306) 289. A ood perior ]N our March number (.pp. 61-62) we suggested that superiors and subjects pool their experiences regarding things that they had found to be of genuine help in the proper governing of a religious community. Response to this suggestion was very slow; and even up to this time we have hardly begun to get what we really wanted. Yet we have had some responses: one in the form of actual experiences, and two in the form of suggestions to print por-tions of notes that were found to be particularly helpful. We are publishing these now, with the hope of stimulating further re-sponses. A. Tributes of~ a diocesan communitg to a former superior general: Two years ago death claimed one of our sisters. She had been ~uperior general (for twelve years), mistress of novices, and a local' superior in our young diocesan community. We .asked our sisters to send us tributes to c6mpile a memory book, to be signed or not as preferred. ~ The traits that made this sister a successful superior, to judge by frequent mention in the tributes, were: Her kindness and under-standing, her personal interest in each individual, her respect for con-t~ dences, her punctuality and observance of rule, her sense of humor, her personal neatness. The following are some extracts from the sisters' tributes: "She was always keenly interested in every detail of the mis-sions, and she never forgot to ask about any of our dear ones at home who were iII or unfortunate. How she could remember about such details was amazing when one recalls how busy and overbur-dened with cares she was, and it shows the love and tenderness of her heart. "No matter how busy Mother was she wa~ always ready to listen to any 6f us--at any hour--when we approached her with problems and difficulties. Her words of comfort and encouragement have helped man~ a one over trying times. When an apology was made for taking up her time, she said, 'My time is for my sisters first of all.' " . . . "For various reasons Mother will ever be an inspiration, to me. Her great spirit of self-forgetfulness, her resignation and calm-ness in meeting with trials, and her great courage in facing diffi- 290 November, 1934 A GOOD SUPERIOR culties will be an incentive to all the sisters who wish to imitate her virtues ahd to some extent her great zeal for the honor and glory of God. "Her love and admiration for perfection in church music and singing will also be an inspiration to the sisters who appreciate the privilege and opportunity of practicing or teaching sacred music and liturgical chant. "Mother fully understood the meaning of the words, 'There is a time for work, and a time for play,' for she ever took a keen interest in the sisters' recreations, adding much to them herself. Indeed, her cheerfulness and hearty laughs would help make a sister forget her little trials and helped many a one to go back to her duties with new courage and vigdr." . . . "Nothing was too small for Mother's attention and consider-ation. When a sister had any kind of problem, she could feel that Mother would be sympathetic and would tell her candidly what she thought was best. She always showed the greatest prudence and discretion in each individual case and did not attempt to destroy what God and nature had begun, but tried to build upon it and perfect it." . . : "Mother was a shining example to us. In all her trials she set us an example to smile an'd be cheerful no matter what troubles we had. She practiced a holy resignation and child-like trust in God. It-was when the angel of death visited us and took from us one of our family that she showed her true spirit of charity and sympathy. In her conversation she would talk to you just the same as if they were her own." . . . "What I liked most in Mother was her interest in each siste) and her work. She was always ready and willing to listen to a tale of woe and sometimes made you laugh at. yourself. Her love for Our Lord in the Blessed Sacrament was clearly shown in the manner in which she prayed; and to listen to her read the medi-tation aloud was a real incentive to devotion to all." . . . "Thoughtfulness is a virtue that everyone admires. I think Mother's life Was a shining example of thoughtfulness. She never forgot nor overlooked the simple, little things. She seemed to take a personal interest in even the unimportant things about the sisters' life. She always remembered to ask about loved ones who were. absent or ill. She never gave the impression of being too busy with more important things to bother with a.ny sister's small worries. 291 A GOOD SUPERIOR Rewiew [or Religious "Her meticulous observance of the rule was ever a source of' admiration to me, while her soul-searching gaze filled me with awe and reverence." . . . "Mother had a most profound respect, for the encyclicals of the Holy Father; and her thoughtful treatment of all employees estab-lished good customs in the community. A man who had ~vorked for her years ago made the following statement: 'When I began working for the sisters I came in a borrowed suit; Mother bought me a shirt to go on duty. She had confidence in.me; she taught me to have confidence in myself and made me feel that I could be a success in life if I really wanted to be. I hope I will always feel that she would be proud of me.' " B. From the notes of a priest, experienced as a superior and retreat-director: 1. Obedience:- Superiors interpret the will of God to their subjects: this is a fundamental tenet of the religious life. When speaking to subjects, therefore, we always insist on the necessity of both exterior and interior obedience. But when speaking to su-periors we must insist on this: "Since your subjects must see ir~ you the representative of God, see to it above all tbing~ that you do not make this unreasonably difficult. Your conduct should be always edifying and above reproach, and your orders should be such as you have prayerfully concluded to be the will of God, not an ill-considered whim of your own. Christ said to Pilate: 'Thou wouldst have no authority over me if it had not been given thee from above'--meaning: the authority you have is not to be used independently, at your good pleasure; but it is given to you by God as a sacred trust." 2. Primac~j of the spiritual:--The chief duty of the superior is, in and through his government, to maintain the spirit of the institute, the .faithful observance of the Rule, so that he can hand on to his successor a community which has suffered no diminution of the religious spirit as embodied in this particular institut6. For this reason the superior must know the Rule thoroughly, the written rules, their implications, the tradition of the community; consequently he should fre~quently meditate upon the RuJe in his' mental prayer, endeavor to pentrate the mind of.the founder, whom he should look upon as one inspired by God to lead souls to per-fection along this .particular path. This maintenance'of the religious spirit is particularly difficult 292 Nouember, 1954 A GOOD SUPERIOR in our times. A revolution is going on, not'only in politics, art, and industry, but aIso in the moral outlook of men. There is a revolt against tradition, against submission, a craving for ease and comfort, for independence in judgment. Parental authority is at a low ebb. Men are eager for news, for sights and sounds. Calm of spirit, control of the imagination are diffcult; worldliness is in the air we breathe. Hence mental prayer is extraordinarily diffcult. Self-denial, "a desire to have less rather than more," is ~qually difficult. Even if these thingsare acquired in the novitiate they are apt to be a mere veneer that does not wear well amid the worldli-ness of modern life. Yet it remains true that the two props upon which the spiritual, and therefore the religious, life ,rests are prayer (chiefly mental) and penance (self-denial). Without these there can be no religious spirit. Therefore in his government the superior must see to it above all things that the spiritual life is in a flourishing condition. The spiritual life is not self-sustaining. It is kept alive and vigorous' by the constant, faithful, .daily use of the means, which are the spiritual exerdses prescribed by rule and custom. Therefore, again, every superior, in the interests of his own government, and in the highest interest of the institute, must see to it as a sacred duty that each and every one ot: his subjects is given the full time each day to attend properly to his spiritual exer-cises. No superior may, in conscience, assign such an amount of work, or such hours to a member of the community that the orderly performance of the community spiritual exercises becomes habitually or even frequently impossible. The call to the religious life is a call to religious perfection, first and foremost, and only secondarily to perform a certain kind of work to which this community devotes itself. 3. Interest in ~lounger members:- The training of young re-ligious is not completed when they leave the novitiate. Their ear-liest years in the active labors of the community may make or mar their whole future career as religious. All too often they are left more or less to their own devices, just as long as they do their work well. A good superior should be per,sonally concerned in furthering the development of the religious spirit in these young religious. I. 4. Interest in lagt brothers and s~sters:- Also, of special con-cern to the superior should be the lay brothers or sisters, those who do the housework. They and their bard work are sometimes not 293 A GOOD SUPERIOR Reu2ieu2 For Religious sufficiently appreciated by others. The superior should, try to hav~ first-hand acquaintance, with their peculiar difficulties, "and should see to it that they baye sufficient time for their spiritual exercises, that they get their regular periods of recreation, that they get suf-ficient rest, and that their living and working quarters are ~ade attractive and hygienic. 5. Interest in the whole communit~!:- A superior should not be absent too frequently from the community, and never for long periods. His subjects should know that be is around, keenly" and intelligently interested in all the departments of the house, and, though never snooping, .yet has his eyes open to observe what is going on. The members of the community should know that at certain hours, at least, they can always find him in his room or office, where he is easily approached (without any red tape) and ready to discuss their problems with paternal interest. Very likely there will always be some (especiaIIy in a large com-munity) who find it hard to deal with the superior. He should not be surprised at this or take it amiss; let him r~ther with un-feigned and unfailing kindness try to gain the confidence of such persons. Above all, he should not be swayed by human feelings against them. They are very quick to observe this, and it will ruin his chances of doing them good. 6. Aooid undue influence and imprudent talk:--A superior should keep in mind that he has been appointed superior, and there-fore that he should govern the community, and not another. Hence, be should avoid beifig unduly influenced by anyone--e.g., a former superior, or a flatterer, or one who tries to patronize, or one who "hangs around" his room or office and would like to "discuss" higher superiors or the retiring superior and his regulations or the shortcomings of the other members of the community. Let the superior wisely suspect those who, whether consciously or uncon-sciously, are "feeling him out" and trying to gain influence over him. Let him be very discreet in what he says about others (never gossiping with busybodies, and being cautious and strictly factual in information passed on to other superiors) as be may be quite certain that what he has said will before long reach the ears of the persons spoke'n about. Subjects resent fiercely being thus "discussed" behind their backs by the superior, especially with persons who have no business whatever to be parties to such a discussion. 7. Not too long in office :--The principle, "Once a superior, 294 November, 1954 A GOOD. S.UPERIOR always a superior," is wholly wrong and where followed it does great harm to community life. Being moved around from one house to another as superior is a selfish proceeding, detrimental to the best interests o.f the institute. It forms a sort of nobility, a caste; it k.eeps down excellent talent for governing among the younger gen-eration; it makes subjects lose respe9t for superiors who all too plainly like their position of eminence and will probably manage never to return to the ranks. An unselfish, humble, spiritual-minded religious who has served at most twelve years in office will be eager to go back into the ranks and into active work. If he is too old to do active work, then he is also too old for the exercise of strong, efficient, sympathetic gov-ernment in this modern world of rapidly-changing ideas. ~ A good superior who has deeply at heart the welfare of his in-stitute should esteem it one of his chief privileges to develop govern-ing talent in such of his subjects as he observes give promise of becoming good superiors. ,By judiciously" trying out the younger members in positions of trust and .responsibility, be should pick out those that show good judgment, tact, and resourcefulness: give them helpful, constructive criticism and endeavor to make them solidly-spiritual religious, humble, prayerful, self-sacrificing, de-voted to regular observance. To have been instrumental in develop-ing two or three such sterling characters for posts of authority is perhaps the greatest single.contribution a good superior can make to the welfare of his institute. C. A section from a retreat to superiors. This material "is based upon notes taken during a retreat gfuen b~t a French Jesuit, Father Thibaut. The heading of this particular section is: "He knoa)s not boa) to gouern a)ho ttnoa)s not boa) to love.'" If one does not love he does not know bow to govern others. Our Lord is our model in this kind of love: 1) In dealing with His apostl'es He ~hows us His solicitude for their spiritual life: "Keep them from evil." 2) He defended them against the Pharisees. 3) His love for His ~postles was paternal. 4) He radiated peace. 5) He tried to bring borne to them His iove for them. 6) He corrected them, but was always kind to them. 7) His love was evident in the externals: He fed the apostles: He foresaw their needs in order to care for them. 295. GOOD SUPERIOR 8) He brought out the relationship between governing and love in His thrice-repeated question to St. Peter: "Lovest thou Me?" Our love of our subjects should be paternal-~but, of course, on a spibitual basis. It should not be based on services rendered, but on the fact that they are children of God, consecrated to Him. It should not be partial because of their attractiveness or even because of their cooperation. Then we must give ourselves to them unselfishly. This de-mands great self-sacrifice, dominated by a great love for God. Not a cold love, but also not effusive to such an extent that it would seem to call for sensible return. Our love should be universal. This calls for limitless patience. Our sanctification may lie along these lines. Pray and tr~r to imitate Our Lord's love for them. Look be-yo. nd their defects and see their good qualities and bring them out. Encouragement is more conducive to good than corrections. All this calls for a great ideal. The supernatural must always sustain the ideal and influence others too. More is expected of a superior. "He who loves Me will be loved by My Father." "My little children . . . " etc. Note the warmth in these words. Our duty "is to represent God to the community. Not even infidelity "on the part of the subject is to take that love away. Christ loved often in the face of disloyalty, e.g., Judas. Jesus gained the affection of all the eleven apostles despite their differences. A superior may have to show more love to one than another, e.g., when a subject is in sorrow, or depressed, or in case of death in a family. Do specia! things f~r subjects at such times. This is not contrary to universal love. VOCATIONAL LITERATURE REQUESTED Sisters who have vocational literature in the form of booklets, pamphlets, or leaflets are earnestly requested to send samples of their literature to: The Mother General, Presentation Convent, Clyde Road, Rawaldini, Pakistan. These mission- . ary sisters wish to prepare some literature of their own to try .to attract aspirant~ in their" missionary ~erritory, as well as in Europe. Their work is mainly teaching, with a limited amount of dispensary work and visitation i~a refugee camps. Thiey have a novitiate in Ireland; their missionary work at present is confined to Pakistan and Northern India. 296 Address !:o Mot:hers General Most Reverend Arcadio Larraona, C.M.F. [EDITORS' NOTE: This address was given' by Father Larraona at the conclusion of the meeting of mothers general in Rome, September, 1952. We are publishing it with the permission of Father Larraona. For further information about the ad-drdss and about the proceedings of the meeting, see page 306.] !,~is not without deep emotion that I address you this morning. behold in you the hundreds of thousands of consecrated souls for whom you are responsible before God. Your presence here shows that you feel the full force of this great responsibility. Never-theless the thought of it should not excludi deep and trustful feel-ings of confidence. In your administration strive to imitate those qualities which we find in God's administration of ,the world, if we may so speak, that is, the qualities of understanding, far-sightedness,. kindness, and patience. If you work in this spirit, then have con-fidence that God will work for you and in you. I. REVISION OF CONSTITUTIONS:' In 1922, the S. Congregation of Religious ordered all approved religious communities to send in their constitutions for revision and, if need be, correction in the light of the provisions of the recently published Code of Canon Law. But even after this general obliga-tory revision of some thirty years ago, the S. Congregation does not necessarily feel that all the details of all constitutions must remain forever unchanged. Rome is ready to consider the advisability of, changes on certain points, provided the individual communities show good reasons for the modifications they wish to introduce. Rome wants this" evolution to be without spurts,or shocks--a genuinely vital evolution, imitating the growth and development of a human being[ Hence, the usual procedure is to require that all proposed modifications be first submitted to a general chapter, and that the. changes be approved, not merely by an absolute majority, but even by the moral unanimity of the capitulants. In this connection, the following particular points might be mentioned: Custom-Books The custom-books of religious communities, sometimes called "directories," are not approved by the S. Congregation of Religious except in a negative sense. That is to say the S. Congregation'ex- 297" ARCADIO LARRAONA Reoiew for Religious fimines these books in order to make sure that they contain nothing theologically or canonically erroneous, but does not approve them in the strict sense of the term. In this, the custom-books differ from the constitutions. Notwithstanding all their good qualities, it.is undeniable that custom-books, because of their detailed regulating of many aspects of" daily life, can and do become oppressive, or at least embarrassing. There are superiors of all types and temperaments, and some of them are unduly'a'ttacbed to the letter of the prescription, without con-sidering the spirit, and without thinking sufficiently of the end ar which they aim, an end which frequently can be obtained through the use of different means. Superiors may therefore legitimately make known their wishes to the S. Congregation of Religious. They should not fear to request such changes on the grounds that they will be thought to be unfaith-ful to their community traditions. Change in itself is not heresy, but it goes without saying that no changes should be proposed merely because they fall in line with the caprices or personal likes of an in-dividual superior. All changes submitted to the S. Congregation must usually bare the morally unanimous approval of the general chapter. In case of urgent modifications, the S. Congregation will take action even between general chapters, but with the obligation to submit the matter to the next chapter. The Religious Habit The Holy See leaves to every individual community full freedom of action regarding all the details of its.specific habit. The S. Con-gregation is interested mainly in maintaining the peace of mind of all religious. Peace and charity are of much higher importance than the advantages to be gained through 'improvement in some detail of the habit. Rome's only question in such cases will be: "Are you all agreed?" The modifications will be approved, provided they are supported by the general chapter, and provided the minority, if there be one, is not unduly obstreperous in its opposition. If that should be so, Rome would counsel patient waiting. The Abolition of Class-Distinctions The same principles are followed when there is question of re-moving from the constitutions the articles which set up different classes among the religious of one same community. Peace is the paramount consideration. Rome will approve the elimination of 298 November, 1954 ADDRESS TO MOTHERS GENERAL class-distinction, but only on the three following conditions: (a) that the change insures absolute equality of rights and obligations; (b) that the superiors be fully empowered to appoint any religious to any office, due regard being given to the .individual capacities of each one and the needs of the community; (c) that all the religious, irrespective of the class to which they may have previously belonged, contribute their share of effort in providing for the common needs of the community. Saving these principles, the abolition of the dis-tinction between classes will be approved by Rome, but the S. Con-gregation. will never use any pressure in order to bring this about in any particular institute. II. SUBSTITUTION OF THE DIVINE OFFICE FOR THE LITTLE OFFICE OF THE BLESSED VIRGIN: Through the constantly growing liturgical movement, there is an increasing tendency among religious communities of women to introduce the recitation of the Divine Office in the vernacular instead of the Little Office of the Blessed Virgin. Needless to say, the S. Congregation is favorable in principle to all proposals which' will insure a deeper and richer participation of religious in the sacred liturgy, since such participation brings them into more living contact with the Church. Nevertheless, all innovations must be worked out in a spirit of good balance and discretion. Again, nothing is com-parable to the advantages of peace in a community. The S. Congre-gation does not grant any general permission for substituting' the Divine Office in the vernacular for the Littie Office. Each individual institute must ask for it and submit its own particular reasons for so doing. Proponents of the change oftentimes forget that it is hardly possible that an entire community will react favorably to the innova-tion, and it is the responsibility of the S. Congregation of Religious to forestall discontent and opposition as far as possible. Consequently, the permission for the Divine Office in the vernacu-lar instead of the Little Office will be granted on request, with due regard to the following conditions: (1) that the reqfiest be sup-ported by morhlly unanimous agreement of the general chapter-- what causes trouble is not from God; (2) that the request be not in opposition with either the constitutions or the tradition of the community involved--sometimes the recitation of the Little Office is in conformity with a vow or promise made by the founder or foundresss; (3) that the apostolate of the sisters allow them time 299 ARCADIO LARRAONA Re~ieto [or Religiotts for the recitation of the Divine Office without unduly 6verloading their dhy. This does not mean that the S. Congregation always . drives with its brakes on--but everyone knows that it is dangerous to drive without brakes. III. THE DIFFERENT STAGES OF FORMATION: 1. Apostolic Schools Apostolic schools are of comparatively recent origin, the earliest of them dating from about the middle of the last century. They were first introduced in institutes of men: but they have now become increasingly common in reiigious communities of women. The Holy See has issued practically no legislation on the organization of such apostolic schools. The S. Congregation is patiently awaiting, the guidance of experience. These apostolic schools are not permitted by the S. Congregation for cloistered nuns or for religious whose lives closely approgimate to that of cloistered nuns. This is not a real law of the Holy See, but rather a guiding norm, based on Rome's desire to avoid any sem-blance of pressure ' when there is question of a vocation calling for such special qualities as those required by the contemplative life. The S. Congregation regards apostolic schools as internal schools of a religious community. This point is of canonical importance in determining the degree of freedom to be allowed the community in the organization and administration of these schools: (a) those which do not require any actual, signs of vocation to the religious life; (b) those which demand at least the seeds of vocation to the religious life; (c) those which require signs of a vocation to a speci-fic type of religious life. In any case, the organizati6n and rules of an apostolic school should not lose sight of the fact, that the girls in them are young. The atmosphere as far as possible should be that of a family. The apgstolic school should not be turned into a noviciate in miniature. There should be nothing to interfere with the full freedom' of the candidates in the final determination of their vocation. The pro-gram of studies should not be so highly specialized as to make ad-justment to a different type of life outside difficult. Teach the girls, first of all, to live good Christian lives. No asceticism at the expense of the moral law. Avoid whatever might even remotely result in deformation of the natural qualities and virtues of the candidates. 30O November, 1954 ADDRESS TO MOTHERS GENERAL 2. The Postulate The postulate is obligatory for all women religiousl It must last at least six months. If .the constitutions prescribe a postulate of one year, the six months' prolongation is still permissible. The maxi-mum length of the postulate in any community is eighteen months. Rome does not want the decision as to admission to be delayed too long, and this is why the time limit is imposed. 3. TOe Noviciate Rome will easily grant permission to have two years of noviciate instead of one, if the same conditions are complied with as those pre-viously mentioned in other connections. But if such permission is granted, the chan~e becomes obligatory and superiors have no faculty to dispense from any period of this two-year noviciate. It makes a bad impression on the S. Congregation when a community advances good and cogent reasons for two years in noviciate, and then almosf immediatHy begins to ask for dispensations from the change which the community itself requested'. The S. Cgngregation permit~ the employment of novices in works of the institute during the second year of noviciate. This was a courageous step, which at first seemed to some people to be in 9pen conflict with the fundamental spiritual purpose of the noviciate. The reason is that today no formation can.be regarded as complete with-out some concrete, contact with the apostolate. During such employ-ment the novice remains a novice. She must be given to understand that she is still on probation, even though she be outside the novici-ate. She should be under the supervision and guidance of an ex-perienced sister, since the superior of the house, unless it be a small house, will ordinarily be too absorbed with administrative details to give her tbeOtime and attention required by her special situation. Tbe use of novices during the second year must be motivate~t by the wel-fare of the novice, not by the needs of the community. During this period she is given a chance to prove bet qualities, and to learn un-der supervision how to use the apostolate as a means of personal sanctification. She should be protected and safeguarded without be-ing mollycoddled. Superiors should not forget that when young religious are taken from the hothouse atmosphere of the noviciate and sent out indiscriminatdly into houses where, so to speak, all the windows hnd doors are open, they cannot fail to catch cold. 4. The duniorate In the' noviciate the formation of the religious is begun. In the 301 ARCADIO LARRAONA Review For .Religious juniorate it is continued, though not with the detailed program of the noviciate year. The juniorate is an initiation into the apostolate, while the young nun still remains under the safeguarding influence of supervision and guidance. The juniorate is intended to forestall/ the catastrophes which have sometimes befallen young professed sis-ters who were sent into the active life without any transition period to prepare them for the special problems confronting them in that life. Sisters in the juniorate are in a kind of middle stage of forma-tion, in which they are not subjected to the restrictions of the novici-ate in all their rigor nor yet allowed all the freedom of perpetually-professed religious. At the same time they are provided with an op-portunity to integrate their technical training with the demands of their religious vocation. During the juniorate, whatever may be the special form it may take, the sisters should be under the close-range guidance of experi-enced and capable religious. Unless a house is specifically set up as juniorate, the superior will ordinarily not be in a position to carry out the functions of mistress of juniors. The duration of the juniorate will depend on its intensity, the duration increasing accord-ing as the juniorate is less intense. All communities could at least provide their temporarily-professed sisters with special courses and help during the summer vacation. There is no objection to the juniorate's lasting for the entire period of temporary profession. The ideal is a specifil house, for those communities which can provide one. The threefold aim of the juniorate is: formation, practice, pro-bation. IV. RELIGIOUS PROFESSION: The S. Congregation is ready to allow up to five years of tem-porary profession, ~vith the possibility of an extension of one year. No temporary profession can be extended beyond six years, according to the Code of Canon Law. The reason is that if a sister has not succeeded in satisfying her superiors as to her vocation during the period of postulate, noviciate, and six years of temporary vows, it is hardly probable that she will be able to pro.vide this satisfaction in an extended period of probation. Rome views with favor the so-called "third year of probation," which can be organized either immediately prior to perpetual pro-fession or at some later period after time spent in the apostolate. In whatever form it is organized, the third year of probation has in- 302 ADDRESS TO MOTHERS GENERAL calculable advantages. Nevertheless, although it is highly recom-mended, it is not in any way 'imposed by the S. Congregation. V. THE VOW OF POVERTY: I should like to have time to go over with you each of the vows of religion. Time does not permit, but I cannot resist the desire to say something to you about the vow of "poverty, which is the bul-wark and safeguard of the religious spirit. At the Congress at Notre Dame, after a splendid paper on poverty and the common life in present-day America, a sister asked whether custom could justify the keeping of personal gifts, etc. The speaker, a Dominican Father, replied immediately that neither custom nor any superior could legiti-mately give a permission which might run counter to the demands of the common life. No superior can allow what is against the spirit of poverty. It is important to cultivate disinterested motives for zeal in the apostolate. The ministry, in no matter what form it is ex-ercised, should be emptied completely of all concern over personal gain. It is a fact. of experience that zeal oftentimes diminishes in proportion as interest in personal aggrandizement increases. VI. GOVERNMENT : 1. Elections Sisters often fall into one or the other of two extremes in chap-ters: either they organize a real electoral campaign for or against a religious, or they go around in a state of unconcerned passivity. Canon Law forbids electioneering or anything approximating it. But good sense demands, especially in congregations with worldwide ex-pansion, that the electors take means to assure themselves of the qualities (health, virtue, experience, ete.) bf the candidates for the various offices. The line of demarcation between asking for infor-mation and organizing a campaign is not always too clear, but it can usually be made clear by the good sense and virtue of the religi-ous themselves. It should not be forgotten that a half-vote is sufficient to con-stitute the absolute majority (for instance, 17 votes out of 33 is an al~solute majority). It is not required that the majority be con- 'stituted by one vote more than half. 2. Re-elections Canon Law sets no limit to the' terms of major superiors but leaves this to the constitutions. The S. Congregation is not only ~ 303 ARCADIO LARRAONA Reoiew for Religious not favorable to election beyond the terms provided in the constitu-tions, but it is opposed to it on principle. Superiors and capitulants should remember that they, no less than their subjects, have in ob-ligation to observe the law of the Church. Perpetuation of indi-viduals in office tends to prevent the formation "of capable superiors or makes it necessary for them to be chosen from within a closed circle. Other things being equal, the S. Congregation definitively prefers the election of a new superior rather than the re-election of the one inoffice, when the term fixed by the constitutions l~as ex-pired. In case of a superior general, this re-election is called postulation, and requires a two-thirds majority of the chapter. Some constitu-tions forbid all postulation. The fact of having the two-thirds ma-jority must be accompanied with sufficiently serious reasons to influ-' ence the judgment of the S. Congregation. The reasons will be judged with severity, and the confirmation of re-election after the term fixed by. the constitutions will constitute a rare exception. 3. Admission to Profession The freedom to refrain from perpetual profession is mutual on the part of both the institute and the subject. The sister may leave, and the community may refuse to admit h~r to perpetual profession. Such refusal may not be motivated by ill health, unless there is proof that the illness was fraudulently concealed or d~ssimulated prior to first profession. It is not necessary that this deceit or dissimulation should have come from the religious herself. A religious suffering from some hereditary disease which has been concealed from her by her parents may be refused admission to profession on this score, even though the deceit did ndt come from herself. The language of the Code is purely impersonal. There are difficult cases of ineptitude coupled with ill health. If the ineptitude is in any way connected with the ill health, then the rule is the same as for a religious in poor health; she cannot be dismissed 6r refused admission to final vows. If it be simply inepti-tude for the works of the community, then the community enjoys perfect freedom, since the period 'of temporary profession was in-tended precisely to determine whether or not the subject is able to make a' contribution to the apostolate of the institute. 4. Exclaustration An indult of exclaustration suspends the canonical obligation of 304 November, 1954 ADDRESS TO MOTHERS GENERAL the common life for an individual religious.It entails dispensation from the points of rule incompatible with the new status of the re-ligious, forbids tier to wear the religious habit, and deprives her of active and passive voice for the period of her stay outside the com-munity. If there is no scandal, and especially when the reason un-derlying. the exclaustration is not one for which the religious is re-sponsible, 'Rome may, with the recommendation of the superior, permit the religious to retain the habit. The religious, however, has "no right to demand such peimission. Exclaustration is a favor, not a right, and the religious has the obligation, to return whenever the superiors so wish. Superiors cannot allow subjects to remain outside the com-munity, except for purposes, of study, for more than six months. This residence outside the community is not the equivalentof ex-claustration and thus does not entail a.ny o'f the restrictions men-tioned in the., preceding paragraph. Such residence is not favor~l. Any situation demanding the residence of a religious outside her ~ommunity for more than six months is, generally speaking, a dan-gerous situation. Exclaustration "ad nutum Sanctae Sedis"--at the good pleasure of the Holy See--is a measure adopted to cope With those situations in which a religious shows enough malice to be impossible to live with and yet not canonically sufficient to justify dismissal. Often-times these cases involve a eertain degree of mental weakness: un-balanced enough to be impossible, and not unbalanced enough to be locked up.' In such cases the S. Congregation orders exclaustration, with all the above-mentioned restrictions, and the exclaustration perdures as long as Rome so wishes. The institute is obliged to assist in the maintenance of the religious. The present practice of the S. Congregation demands, under pain of subsequent invalidity of the rescript, that all rescripts for dispen-sation from vows be definitely accepted or rejected within ten days of the date the subject is notified of the granting of the rescript. OUR CONTRIBUTORS BROTHER ALOIS is an instructor in religion and Spanish at Archbishop Stepinac High School, White Plains, New York. SISTER MARY is professor of psychology at Marygrove College, Detroit, Michigan. JOSEPH N. TYLENDA is making his philosophical ~tudi~s at the Jesuit House of Studies, Spring Hill Sta-tion, Mobile, Alabama. 305 SOMI~ SPECIAL PUBLICATIONS ¯SOME-SPECIAL PUBLICATIONS "_. (Continued from Page 289) One further observation about Canon Law Digest. Volume III includes docu-ments published up to December 31, 1952. Hereafter an annual supplement will. be issued in loose-leaf form. The supplement for 1953 is now in the press. An exceptionally useful book for all who catalogue Catholic books is An Al-ternative Classl/ication /:or Carbolic Books. This book, originally prepared by 3eann~tte Murphy Lynn, was first published in 1937. Previous to that, libraries with large collections of Catholic literature had to fit the. books into inadeq;u~a:te' classification schedules. An Alternatit~e Classitication offered a new and satisfa~t.~ry" way of cataloguing Catholic books that could be used with 'the Dewey Decimal or, especially, the Library of Congress classifications. A second, and revised, edition, of this valuable technical work has now been brought out by Father Gilbert C. Peter-son, SJ. A special feature of this new edition is the fact that the index, originally fifteen pages, is now forty-two pages. Also the list of religious orders and coiagre-gations is extensive; in the case of institutes of women, the date and place of founding is given, and, if they came to the United States from another country, the date of the first foundation in this country is given. The price of the book (cloth, 512 pages) is $10.00. It can be,obtained from the Catholic University of America Press, 620 Michigan Avenue, N.E., Washington 17, D.C. FATHER LARRAONA'S ADDRESS Fatfier Larraona's address to the mothers general is one of the clearest and most important statements of the mind of the Church concerning the government of re-ligious. In publishing it we have followed, ~ith some slight changes, the English version that appeared in Acta et Documenta Congressus lnternationalls Superiori.s-saturn Generalium (Rome, 1952). This publication of the Sacred Congregation of Religious is printed and distributed by the Pious Society of St. Paul. which has establishments in many countries. The volume contains the proceedings of the convention of the mothers general in five languages: Italian, French, English, Spanish, and German. In this country it can be obtained from the Society of St. Paul, 2187 Victory Blvd., Staten Island 14, N.Y. For a more complete understanding of the mind of the Church, one should also read three addresses of Pope Plus XII--to religious men (Dec. 8, 1950), to tezch-ingsisters (Sept. 13, 1951), and to the mothers general (Sept. 15, 1952). The last-mentioned address was published in REVIEW FOR RELIGIOUS, XI (Nov. 1952), 305-308., We hope to publish the other papal addresses later. FAMILY DAY The Family Communion Crusade is again sponsoring an international Family Communion Day. The Feast of the Holy Family, ,lanuary 9, 1955, will be ob-served by hundreds of thousands of families in more than forty countries, with family group Communion and family consecration to the Holy Family. The aim this year is particularly to obtain prayers for the persecuted nations behind the Idgn Cuitain. Those who wish to join in promoting the Family Commimion Day can obtain further information, literature, etc., from: Family Communion Crusade, 10 Farm .View" Road, Port Washington, N.Y. 306. . That: ",Judging Ot:hers" Habit: In t:he Light: ot: Modern Psycholog Sister Mary, I.H.M. THE ideal of religious life suffers from many weaknesses in our | human nature, but it" probably suffers from none more than in the ever-present desire to judge the other person. Our Lord l~as warned us against l~his weakness with a threat--Judge not that ~,9u be no~ judged--and yet we persist in doing it. Sometimes it becomes so much a part of the daily fabric of life that we are no longer aware that we do jti~lge other people. Habits of judging are usually formed in childhood, long before what can really be called "social feeling" has debeloped. Only the most careful and spiritually enlightened training offsets the forma-tion of such habits--and even then probably only partially. With the dawn of conscience and still later in adolescence with the de-velopment of social insight and appreciation, charac(~r, training can do much to eradicate or, perhaps better, to supplant the "judging-others" habit. Su?ely, a realization of the doctrine of the Mystical Body and of Our Lord's own commandment which He has made the first law of living together, "that you lox~e one another as I have loved you," should sound the death-knell of unkind judgment for all Christians, and especially for r.eligious._ Yet, as we know so well, it does not. It has always seemed to me that in the pettiness of mind and interest in trivialities which follow the "judging-others" habit the devil gets in his most successful innings. How-ever, this is not the aspect of the problem I am interested in dis-cussing. This aspect is rather, what the "judging-habit" means psychologically. The understanding of. this will, I think, throw light on wbg Our Lord condemned it so rbundly and wb~t, also, He makes our judgment ofothers the norm 5ccording to which He will judge us. ¯ Modern psychiatry has a useful technique which it u~es. ih analysis. This te[chfiiqfie. is from Freud, incidentally, although" the mechanism.itself is part of even Aristotle's psychology. I refer to the mental-mechanism which w~e learned to call .association. in' psy-chology. Freud cMled his tech'nique "tYee association. His theory is that if a person allows his mind to wander freely it will con~i~ct 307 SISTER MARY Revietu for Religious up with past experiences which, though normally forgotten, are still much alive in the unconscious mind. Every religious knows this process well--it seems to be at its best durihg meditation. In setting forih his theory of analysis t'hrough free association Freud liked to start with the material of a dream. Psychiatrists today use many other types of material: daydreams, memories, emotionally toned experiences, etc., as starting points for analysis. Apparently what we start with is not too important. But all who use the tech-nique are agreed with Freud's basic principle: the person who makes the association is the person who is anal~tzed. In this connection, a story once told me by Dr. Thomas Verner Moore (now Dora Pablo Maria) will illustrate the principle. A young doctor, a fallen-away Catholic, read a paper analyzing Charles Darwin at a psychiatric meeting. The young man was well known to Father Moore as one who had repudiated all moral principles both in his professional practice and in his private life. Moreover, lie seemed to take a special delight, whenever Father Moore was present at any rate, in finding some way of ridiculing the Church and Cath-olic. beliefs. However, in his paper on Darwin he limited himself to the subject. He had taken passages from Darwin's writings and, using free association on these, bad built up an astounding picture ot: Darwin as a libertine and even a pervert. (The facts of Darwin's ¯ \ private life actually reveal him a~ a loving father and husband who devoted himself to his family through and outside of his scientific work.) Discussion was limited to remarks expressing surprise and even admiration of psychiatry's revelation of Darwin's inner soul, until the chairman called on Father Moore for his comment. He, too, expressed great surprise at the immorality attributed to Dar-win and then said: "But I must in defense of the absent Darwin call attention to the very important principle at the heart of all analysis by the method of free association which apparently Dr. X has overlooked. It is this: in an analysis the person to be analyzed must make the associations. Since in this analysis, Dr. X made all the associations, the analysis is, by definition, that of Dr. X rather than of Darwin." " Now in our judgments of one another we begin, at least usually, with some action, or look, or statement of our neighbor. Then, as we. say, we "interpret" it. Really this interpretation is.a free asso-ciation of its meaning to us. The material .for it is drawn from our own experiences, our own feelings, attitudes, and ideas, our own 308 November, 1954 JUDGII'~IG OTHERS unconscious mind. And so in the judgment, we have revealed no~ our neighbor but ourselves. The injunction of Our Lord then is intended to protect our neighbor--and He threatens that He will place the judgment back squarely upon our own shoulders. The psychiatrist would say today, "Justly so. For you have judged yourself." How much th~ little-heSS, the jealousy, the short-sightedness, the bitterness, the hostility of human nature can give vent to (and at the same time do the devil's work')" through this simple mechan-ism! It, as we said before, can become so easily a part of our every-day- way-of-doing things. We use it on equals; alas, we use it on superiors, our spiritual fathers or mothers in religious life; and--a ¯ greater alas (because of their greater grace of state), superiors use it on their subjects, their spiritual children. Snap judgments; judging a whole area of life and intention from a single fact or incident; setting in movement a whole set of causes which shape a life and its work for Christ on the personal interpretation of a word, an action, an idea, or even a fault, are ways in which the mechanism works practically. If this one principle of Our Lord's, together with the mechanism of free association whereby.we violate it with such blind security, could be understood, what a difference it could make in social living! The application of that commandment whereby all men are to know that we belong to Christ would be much easier ! Psychology would give us another helpful hint in this matter. Since, when I judge another (let us say Sister Y), I do not really judge Sister Y but rather myself, this judging-others habit becomes an open book in which I can read myself and know 'my weaknesses and strengths. Our Lord is good to let us have so simple a revela-tion' of self always handy. Used aright, that is on one's self instead of on one's neighbors, the motives and the matter for speeding along the road of virtue should be plentiful. Our Lord exhorts us in another place to "judge just judgments." A true'judgment requires not "free association" but objective.truth and sound reasoning on prir;ciples. This is probably why the Holy Spirit in Ecclesiasticus so definitely connects wisdom and justice: He that possesseth justice shall lay hold of her . . . with the bread of life and understanding she shall feed him and give him the water of wholesome Wisdom to drink. "Judging just judgments" will require: (1) that we use all natural sources of knowledge, (2) 309 NEWS. A.ND V~ IE.WS ., t.ha.t we discipline the tendency to use undisciplined association, imagining it to be understanding, and (3) that. we call upofi those g!fts of the Holy Spirit, which we all possess, supernatural knowledge, .u.nderstanding, and wisdom. So often these lie like great untapped r.e.serves of grace and power on the outskirts of an all too busy and natural life. Certainly the first step towards this final goal of "just judgment" is to master completely the "free association-- judging-~babit." News and Views American Founders' Series "Xaverian Pioneers," in our present number, is the first response to our suggestion for an American Founders' Series (cf. REVIEW FOR RELIGIOUS, XIII- [March, 1954], 62). We should like to re-peat the suggestion that good biographies of American founders would make both interesting and profitable reading. But we must also repeat that what we want is the story of American founders: that is, religious who either founded an institute in the United States or Canada or extended an already-existing institute to these coun-tries. For instance, the Xaverian BrotBers were founded in Belgium, but stress is rightly laid in the present article on the brothers who pioneered the establishment of the congregation in this country. Of what should such biographies consist? To answer the ques-tion negatively, let us say that the objective of this series is not to have panegyrics or pious table reading. The biographies should be factual and should bring out the character of the founder and the spirit of the institute, as well as the purpose or purposes that the institute is supposed to serve in the mission of the Church. Length of biographies? For our purpose, about four or five thousand words would be ideal. Nevertheless, we do not wish to confine authors to such a strict limit; after all, the real limit of an article ought to be ~the space required in order to do justice to the subject. Hence, shorter biographies would be acceptable, and so would loffger ones--up to, perhaps, eight thousand words. It seems advisable, also, to repeat here some of our previous sug-gestions regarding the style of the manuscript. 1) Every manuscript should be neatly typed, at least double (Continued on Page 329)" 310 '.Just: November--or Always? Joseph N. Tylenda, S.J. DOWN through the centuries, the Church Militant has pr'ayed for the souls in purgatory; this is evident, above all, from' the history of the Mass. However, it is not our purpose here to discuss the historical aspect of the devotion, but rather to show that this devotion should be an. integral part of the life of every religious. All religious, by profession, strive not only for their own sal-vation and spiritual perfection, but also for that of their neigfibor~ Reality is such a mesh of complex intertwining threads, each strength-ening and supporting the other, that we cannot divorce striving for personal sanctification from working for that of our neighbor. It is not in the tradition of the saints that we should first become per-fect and then work for the neighbor; rather the two should normally proceed simultaneously. Here we wish to stress that it is by work-ing for the sanctification of all souls, not only of those on earth but also of those in purgatory, that we ourselves reach our perfection and attain our salvation. It is by giving that we receive; by leading others to sanctity we can help sanctify ourselves. The need to pray for the Church Militant and those still not members of the Mystical Body is quite apparimt, and no one ~vould deny it. Equally so, no one would deny that the ~ouls in purgatory have need of our prayers; but is the need of the latter as, apparent as that of the former? Because members of the Church Militant still run the risk of losing heaven, some may conclude that they need all our prayerful efforts. As for the members of the Church Suffering, they are assured of beatitude--they have only to wait for it. It would be idle to argue which group needs our prayers more, but we can at least point out that the members of the Church Militant can help themselves, whereas those of the Church Suffering are en-tirely dependent upon the prayers of the living. In this article, then, we are going to consider the reasons why prayer for the souls in pu.rgatory has a place in the spiritual life of a religious and, coupled with this, we shall examine the effects that such a practice has upon the spiritual life of the religious himself. ' Itcan be said that the suffering souls have a claim ~o Our prayers in their behalf. Some of them may found this claim on certain spe- 31i 'JOSEPH N. TYLENDA Review for Religious cial ties; others can appeal o61y to our charity. We are not bound by any special ties to pray for all the dead, but surely we do have such special ties to our dead relatives, fellow religious, extern friends, benefactors, students, and others; and as a consequence, we are under some sort of obligation to pray for souls, their appeal is directed rather to our ~pecifically, to our sense of pity. We offer for them out of mercy and fellow-feeling, whose image we recognize in them. them. As for the other general charity or, more prayers and good works or out of love of God Can gratitude oblige us to pray for the dead? If we are bound to show gratitude and give thanks to the living for their goodness to us, are we any less bound to be grateful to the dead for the good-ness they have shown us while living, and which we, in our pride and envy, have perhaps refused to recognize? The religious order or. congregation to which we belong is a human instrument, and its present progress and perfection is owing in great part to the dead of our order that have gone before us. We, their spiritual children, now enjoy the fruits, without ourselves hav-ing done the sowing. To give but one instance--and this of the more tangible sort--the charity shown to us by our benefactors was enkindled by those now dead; nit is because of them that the living still enjoy many favors first meant for them. Can it be denied, then, that we owe them gratitude, that our fellow religious who have al-ready gone from this life still retain a claim on our prayers? We, as members of a religious community, are supposed to help our fellow re-ligious work out their salvation. Can we say that our task is done when they have died--when as y~t we cannot be sure that their souls are enjoying the blessed vision of God? While alive they gave us generously of their love and friendship, their kindness and help; furthermore, we may reasonably presume that they prayed for us; for our sanctification, our pe.rseverance. Again, these breth-ren of ours were by the good example they set us often our incen-tives to love God and practice virtue; in fact, their very presence ~tcted as a continual reminder of God's goodness and love. Praying for them is now our only way of thanking them. And we do owe' them thanks. In the light of this it is easy to understand why re-ligious institutes require that all their members offer certain definite suffrages for those who have died. Another important reason why we owe certain particular souls prayerful remembiances is that these souls may now be suffering 312 Ploverober, 1954 JUST NOVEMBER-~OR ALWAYS? because of us. Certain actions. ~of ours, either before or after our entrance into religion, may have caused them,, when still alive, to offend the just God, and now in .purgatory they .are .suffering in atonement for those offenses. In such a case, can we derby that we are partially re]ponsible for their sufferings? Are 'we not bound to help such souls? Shouldn't we atone for those faults together? It may be that our parents themselves have already died; there is no question but that for them at least we shall pray much. They gave us our earthly life, our shelter, and our food--gratitude demands that we see to it that they now speedily attain to eternal life, sure refuge and refreshment in their heavenly home. All of us, too, have other relatives and friends for whom we wish to pray and ought to pray. Many there are, therefore, for whom we are obliged in gratitude to pray; ~nd every one of us will, no doubt, be able to think of still other groups or individuals for whom he has some obligation to pray. Besides our duty towards many Holy Souls by reason of these special ties, al! the souls in purgatory excite our charity. Charity is giving of self to others, not because we owe it to them, but simply because they are in need and we can alleviate that need. The Holy Souls cannot leave purgatory until they have been purified and made ready for the beatific vision. This can be effected only through their suffering, or through the prayers and sacrifices offered for them by the living. Not without reason are the Holy Souls often called the "Poor Souls," for they cannot merit anything for themselves. From this' point of view, they are utterly dependent upon the liv-ing. It is charity that incites us to do what we can to lessen their punishments by praying for them and suffering with them. Prayers for the dead are as alms to the poor. Of themselves the dead are helpless to hasten the end of their suffering; but through our passing charitable acts they can come more quickly to the treasure heaped up for them in heaven. The Holy Souls are our 'brethren in distress; we must not close our eyes to their misery. The pre-cept of lovi.ng one'~ neighbor applies to the dead as well as to those that are alive. The mandate is "Love thy neighbor," and, as we know, this is equivalent to "Do good to thy neighbor"; in the present case it means "Pray for thy neighbor," for prayer (with sacrifice) is now the only thing good for them. Charity is also, and primarily, the love of God; but assuredly, to pray for the dead is to love God, for has He Himself not said, "As long as you did it 313 JOSEPH N. TYLENDA ' Reoiew for "Reli~iou's for one of these, the least of my brethren, you did it for hae"? Even from these brief considerations we may come to realize that constant prayer for the Holy Souls has.a necessary place in the life of every religious. However, an obje(tion may be raised that "helping the souls out Of purgatory is a selfish and rather mer-cenarY affair, since we know that they will, both now and upofi their entry into. glory, pray in turn for us." But this objection is wholly unwarranted, for this interchange of prayers between the members of the communion of the saints is not self-seeking in any bad sense of the term;, rather it is a perfect friendship based on a community of grace and charity, and manifesting itself in an ex-change of precious gifts." For doing good there is always a reward; heaven itself is the great and final reward for all our good actions. Can we doubt, then, that there is a special reward for the religious who prays for the dead? There will, surely, be more joy for him hereafter, but is there no more immediate reward which he will receive even while still here below? We believe there is: we be~lieve, for our part, that it consists in an enlivened desire to go to God, a deepened u'ndersta~ad-ing and appreciation of those words of Saint Augustine: "Our hearts were made for Thee alone, O God, and they shall not rest until [hey rest in Thee." Another reward that should come with praying for the dead is a greater de.testation of sin, which, even when forgiven, may still deserve such punishment, and with it a clearer understanding of the sanctity of God, who may not be seen face to face by any soul not wholly pure. Finally, this devotion should inflame us with the desire to have as much as possiblg of our own "purgatory" here on earth so that after death, with little or no delay, we may enter into the joy of Our Lord. Nor is it presumption for a religious to have the desire to avoid purgatory, for it is not in God's primary providence that any soul should go there. Christ would have us be perfect as our heavenly Father is perfect, and the perfect will have no need of the cleansing fires of purgatory. We ought not close this article without recalling the means we have at hand for helping the Holy Souls. These are, to be sure, prayers and indulgences, "works of penance, and, above all, the Holy Sacrifice of the Mass with its unlimited graces. However, these means and their efficacy are so well known to all religious that we do not need to e~plain ther~ here. We conclude in the ~ords of Sacred Scripture that "it is a holy 314 Nou.ernber, 1954 COMMUNICA@IONS and a wholesome thgught to. pray :~or. ~he.de.ad:i' Eve, ry soul out. of purgatory', through:.gur pr~yers,means another saint in heaven~a deeply'consoling thoughl~. Ought we,' then," to remember the souls in. purgatory only at the very end of our almost endless li~t of in~ t~ntions and as a matter of mere routine, or should we not rather .make our petitions f0~ them an integral part of-our prayers for the salvation and sanctification of our neighbor? With all this in mind,. can we maintain that such a devotion ought to receive emphasis ~luring one month only? Can we so confine our charity and our love of God and neighbor? ommun{ca -{ons Reverend Fathers : I have just finished reading Ft. Aumann's excellent article on "Religious and Modern Needs" in the July issue. May I congratu-late him for it? ' Fr. Aumann's article answers a definite need for establishing the correct relationship between contemplation and action. Many of us are unfortunately so engrossed in teaching and the other works of the apostolate that we are fatigued and overworked and cannot give the needed efforts and time to the so necessary life of prayer and meditation. As'a result everything suffers thereby. Thus we cannot insist enough on personal sanctification as the end of religious life. However, I would like to call your attention to another as-pect of the problem which struck me in reading Ft. Aumann's article. Some religious, I am afraid, misunderstanding this primary aim of personal sanctification over the apostolate, go to the other extreme and risk believing themselves good religious if they are materially faithful to their spiritual exercises. In this regard a fellow priest of mine ironically d~fined the good religious as one "who is regularly on time for all his spiritual exercises, punctual at meal time and other community gatherings, and who obeys his superior." But, as my friend pointed out, such a religious may not have begun to under-stand the spirit 'of his vocation. Bishop Ancel, of Lyons, France, pointed out in a conference to religious that the prime purpose of any vocation is to. continue the task that Christ lived while on earth--thus the reason for the 31~5 COMMUNICATIONS oows. We are, in other words, to have at the root of our spiritual lives the building up of "the Mystical Body. We are to have in us "the sentiments that were in Christ Jesus," 'at St. Paul put it. We must eat, drink, and sleep in terms of the growth of the Whole Christ. We must make our own the words of Christ, "I am come tO cast a fire on earth and what will I but that it be enkindled.".Religious must make their own St. Gregory's warning, "Nec castitas ergo magna est sine bono opere, nec opus bonum est aliquod sine castitate." (Cf. the whole homily for Confessors; 3rd Noct.) The reason I am writing this letter is that I believe too many of us do not have the proper sense of responsibility for the Mystical Body of Christ. We are content to let the pope, bishops, and superiors.worry about that. And in the meantime we are not pool-ing our collective heads to anM~rze the current situation, the needs of the Church, whether or not we are getting anywhere with our efforts, etc. A typical example of what I mean is that although classroom teachers are working harder than ever nowadays to do their .work, the pupils seem to be groffcing in secularism, etc, Influ-ences outside the classroom seem often to be gaining the mastery of them. And we are producing practically no apostles from our schools. Thus, I think that something should be done to awaken per-sonal responsibility for the future of the Mystical Body. Each one of us should constantly be saying to himself as the late Cardinal Suhard did, "What can we do, what can we do?" Too many of us, misunderstanding what is meant by the primacy of personal sanctification, are content to do merely what we have been ap-pointed to do, forgetting that we are religious to be other Christs, to "restore all things in Him," and that we must do this. We must be the salt of the earth or we shall be trodden under fo6t. I almost forgot to mention the need of a proper understanding of the relationships between th'e spiritual life and action. All action must come from contemplation--the "contemplata tradere" of St. Dominic. The thing is that contemplation and the primacy of the personal sanctification element properly understood mean that prayer and the Mass must drive us to action, and thought, and a sense of responsibility for the Mystical Body; and that vice versa action must push us constantly to more prayer and contemplation. That has always been the rule of the saints--the more they did the more they prayed, and the more they prayed, the more they did.--A PRIEST. 316 THE PROMISED WOMAN--An Anthology of the Immaculate Concep-tion. Edited by Brother Stanley G. Mathews, S.M. Pp. 3lb. The Grail. St. Meinrad, Indian~. 19S4. $4.00. "From the beginning then and befbre all ages .God selected and set aside a mother for His Only-Begotten Son." As he penned these momentous words one hundred years ago, Pius IX began to list the arguments for Our Lady's Immaculate Conception in the long-awaited Bull Ineffabilis Deus. Not only was this solemn pronounce-ment at once the welcome climax to centuries of belief in the doc-trine and the complete,satisfaction of the ardent desires of the faith-ful and their pastors, but it proved to be the impetus for a new and brilliant age of Marian literature, inspired largely by this definition. In spite of the abundance of books about Mary in the past cen-tury, however, there has been a notable lack of English literature on the Immaculate Conception. The present outstanding work has been designed precisely to fill that need. Acquainted with the best in Mariology in his capacity as li-brarian at the remarkable Marian Library in, Dayton, Brother Mathews has selected thirty-four of the finest tributes to the Im-maculate Conception for his anthology. They are divided into five sections. The eight opening articles stress the dogmatic theology of the doctrine. We, ll-written and short enough for some stimulating per-iods of spiritual reading, they give a good cross-section of contem-porary and recent authors: Vassall-Phillips, Neubert, Sheen, Zundel, Giordani, Bourke, and Feckes. Father Connell gives a short sum-mary of the historical development of the dogma. Part two features six monographs on the inspiration and apostolic influence man has derived from the Immaculate Conception. Espe-cially interesting is Father Ralph J. Ohlman's article on the Im-maculate Conception in the history of the United States. How St.Epiphanius and Bossuet extolled Our Lady is shown in part three, as well as more recent writers like Gueranger, Knox and Leen. A valuable section, part four, gives the answers of Newman, ¯ Ullathorne, Gibbons, and others to Protestant misconceptions about 317 BOOK REVIEWS Revieu; for Religious the Immaculate Conception. ¯ ~ In the final division are included0 six important papal documents from Sixtus IV (in 1476) to Plus XII, as well as two significant Pastoral Letters from the Councils of Baltimore. The scope and worth of this volume can be seen at a glanc'e. Brother Mathews is to be commended for his short introduction to each article--pithy enough not t6 be passed over unread, and yet entirely adequate. His apt section titles, too, are cleverly chosen from among the praises of the Blessed Virgin. It would have been of advantage to the reader to indicate more precisely in the table of contents the type of material in each of the six sections. The index, too, especiaIIy in an anthoIogy which will be used for ready reference, could have been much more complete. A bibliogral~hy of the better works on the Immaculate Conception in French, German, Spanish, and Italian would be of value to the scholarly reader. A final note on typography: Though the type-face for the text is well chosen, the indented quotations would look better in a smalIer case (perhaps itaIicized) than that used. --T. ~,V. "~/'ALTERS, S.J. PIO NONO. A Study in European Politics and Rellcjion in the Nine-teenth Century. By E. E. Y. Hales. Pp. 3S2. P. J. Kenedy and Sons. 1954. $4.00. The scope of this eminently readable account of the ItaIian Risorgimento is indicated in the volume's sub-title: A Study in European Politics and Religion in the Nineteenth Century. The argument the author proposes is that prince and pope in the mind of Plus were not distinct entities. As did his opponents, Mazzini, Cavour, Napolean III, and Bismarck, so too did Pio Nono con-ceive of a close interdependence of politics and religion. Hence his intransigent attitude toward "a free church in a free.state." Mr. Hales has not written "spiritual reading" for his English readers. He is concerned to present "the other side" to his. com-patriots whose views of Pio Nono have been slanted by Dr. Tre-velyan, and who, thanks to Lord Acton and The "-Ffmes. have al-ways looked on the Vatican Council with horror, and its offspring, papal infallibility, with contempt. Gladstone's letters on the Nea-politan prisons and'Palmerston's unabashed references to the Papal Government as the "worst of governments" fanned tempers already b, oiling over the restoration of the English hierarchy in 1850. The author's point is well made: "Has sufficient allowance for English 318 Nooember, 19.54 BOOK REVIEWS' enthusiasm for the risorgimento ever been madein disciassiohs bf.tlse' reactions in this country to the P@e'sSyilabus of Errors. in 1864. or his proclamation of the Dogma of Infallibility in' 18707" Considering the readers Mr. Hales bad in mind, we are npt sur-prised to find some elab6ration of the definition of the Imrfiactilate Conception--the only spiritual accomplishment of Pio Nono treated iridependently of political repercussions. Since the book bears the imprimatur of the Archbishop of New York, the theologian will find nothing censurable here, although he may wince at the,. author's ~eflection that it was. unfortunate that Plus "thre~ his personal 15restige into the scale" at the delicate weighing of papal infallibility. The select bibliography has additional value in that the author has noted the bias of the various authors. --THOMAS N. MuNsON, S.J. THESE CAME HOME. Compiled and edited by Gilbert L. Oddo, Ph.D. The Bruce Publishing Co. Milwaukee. 19S4. Pp. 179. $3.00. The drama of life is played in the concrete struggles of the in-dividual person with the problems which are uniquely his; and the greatest act of this drama is his wrestling with God. Though our faith teaches us that God acts out His part by pouring His grace into the soul, not in many places do we see this grace visibly operating. The fight against sin, which is certainly a work of grace, is not an experience many care to expose to the public. The qdyssey of a convert, however, provides matter which few are ashamed to tell about and is an excellent manifestation of the work of grace. Fifteen university graduate converts narrate their stories in These Came Home, presenting a persistent search for truth away from the shallow and illogical eclecticism in which they were raised. The discovery of a personal .God, the realization that there could be only one true Church established by Christ, the unmasking of the falsehoods and misrepresentations which surrounded their young minds about the Catholic Church, the realization of Our Lord's presence in the Blessed Sacrament are some of the stages on their way home. Some were Protestant ministers and had to abandon their professions; others net obstacles in their families and friends; but all of them endured the mental anguish of realizing that their lives were empty because they had not properly found God. The reader of this book will better appreciate his own faith and under-stand those who do not shar~ it.:~ALBERT J. SMITH, S.J. 319 BOOK REVIEWS MEDIAEVAL MYSTICAL TRADITION AND SAINT JOHN OF THE CROSS. By aBenedic÷ine Of S÷anbrook Abbey. Pp. 161. The New-man Press, Westminster, Maryland. 19S4. $2.75. The author of this l~ook, by defining its scope with precision, has lightened the reviewer's pains. It is a historical study of medieval and sixteenth-century spirituality, culminating in that of the Mysti-cal Doctor, St. John of the Cross. After.h valuable sketch of the early Spanish period, successive chapters present Hugl~ and Richard of St. Victor, St. Bonaventure and his school, the German and Fle-mish mystics. The last chapter, "Spain Again, and Saint John of the Cross," brings the investigation to its goal. Within these bounds, the essayist has traced the theme of mysti-cal prayer. SlOe has read her sources with attentive care, and aligns their'yield with a steady eye to the main object. There is no over-load of learning, no pretentiousness whatever yet anyone, who has handled the tools of literary research will hold this specimen in high respect. The theory of the life of prayer, followed by the author, falls within a general scheme now widely accepted. The indispensable role of asceticism is pr~supposed.~ Vocal prayer, including petition, is taken for gbanted. To liturgical prayer is reserved its unique precedence. The writer's subject is mental prayer, and especially contemplation, acquired and infused. Acquired contemplation is the prayer of simple regard, and may be attained in some degree by a good will with the aid of ordinary grace. The inf.used forms of contemplation depend on God; they may be holily desired, but not counted on, in this world. Purgation, an essential process in the discipline of the senses and of the mind at every stage of pra~er~ takes a higher and severer form, if one is raised to the life of in-fused cgntemplation. What this historical essay has chiefly done for the present reader is tw6fold. It elucidates persuasively the unity of the mystical ex- ¯ perience (to adapt Gilson's phrase) in the Christian tradition, and the continuity, under a bewildering diversity of description, of the teaching of the mystics. Against this background, it sets the doc-trine of St. John of the .Cross in its proper focus as our Summa of mystical theology. In particular, it is he, as the author points out, who has studied with care the nature of acquired contemplation and of the approaches to mystical prayer, as distinguished from the great gift itself. 320 November, 1954 BOOK ANNOUNCEMENTS The Benedictines of Stanbrook are accustomed to give us works of solid worth. The present small volume is an honor to-their tradition.---EDGAR R. SMOTHERS, S.J. BOOK ANNOUNCEMENTS BRUCE PUBLISHING CO., 400 N. Broadway, Milwaukee I, Wis. A Man Born Again. St. Thomas More. By John E. Beahn. Once you begin to read this book, you will find it diffic.ult to lay it aside. It is a fictionalized biography written in the first person: Pp. 208. $3.00. CAPUCHIN FATHERS, 220 37th St., Pittsburgh 1, Penna. The Lagbrother According to the Heart of St. Francis. The Lagbrother Manual. Both books are by Clarence Tscbip-pert, O.F.M.Cap. The first is a translation.and the second an adap-tation from the German, In the German original they have been popular for many years among German-speaking Capuchins and have led many a Capuchin brother along the ways of perfection. The first book is a brief treatise on perfection from the practical point of view. Much of the doctrine is embodied in prayers. The second book is a vade mecum for the brothers. It takes a brother through all the actions of the day. It contains both,instruction and prayers. Both books may well serve as models as to what can be done to h~lp lay brothers in their difficult vocatibn. God's honor and glory would be increased if every brother of whatever order or congregation had similar aids to lead him to perfection. THE GRAIL. St. Meinrad, Indiana. The Jogs, Sorrows, and Glories of the RosarV. By Raphael Grashoff, C.P. This is a small book. It measures only three and a half by five and a quarter inches. In mandscript form it was used for public reading during laymen's week end retreats at Holy Cross Passionist Monastery in Cincinnati. Its purpose is to help indi-viduals to say the rosary as our Lady wants them to say it. Each of the fifteen chapters is preceded by a full page pen-and-ink draw-ing depicting one of the mysteries of the rosary. The excellent drawings are by Sister Augusta Zimmer, S.C. Pp. 173. $1.00. School Teacher and Saint. A Biography of ~Saint Lucy Filippini, By Pascal P. Parente, S.T.D., Ph.D. The foundress of the Re-ligious Teachers Filippini died on March 25th, 1732. It was°not until June 22, 1930, that she was canonized: It was 1910 before 321 BOOK ANNOUNCEMENTS" Reoieto "[or ~ R~ligioug. ttie'first five Religious Teachers Filippini opened their first gchooI in the United States i~t Trenton, New Jersey. It is not remarkable, therefore, that she is little known in this country. The present volume, the first biography in English, should do much to bring her the honor and reco.gnition she so richly deserves. The book is generously illustrated with pen-and-ink drawings by Paul Grout. Pp. 170. $3.00. Teen-Agers' Saint. St. Maria Goretti. By Mgr. James Morelli. Edited by William Peil. The book gives a brief account of the life, martyrdom, and triumph of this "Saint Agnes of the Twen-tieth Century." The illustrations by Gertrud Januszweski add con-siderably to the attractiveness of the book. The work should prove quite appealing to teen-agers, especiall~ grade-school and early-high-school students. Pp. 84. $2.00. B. HERDER BOOK CO., 15 South Broadway, St. Louis 2, Mo. The LitanF o[ Loreto. By Richard KIaver, O.S.C. That the Litany of Loreto is beautiful, and is really a poem in blank verse, all users of this litany will admit. Many, however, may not realize that it is an epitome of MarioIogy. Father Kla~ier proves this point in l~is commentary on the Litany, for to explain the various invo-cations he draws on the whole of Marian theology. The book should contribute much to make the recitation of the Litany more meaningful. Pp. 227. $3.75. Catholic Liturg~t-~Its Fundamental Principles. By the Very Rev. Gaspar Lefebvre,O.S.B. Translated by a Benedictine of Stan-brook. Here is an old classic in a new revised edition, the third in English. It should be on the shelves of the library of every religious community. Pp. 300. $3.50. The Rosary1 in Action. By John S. Johnson. A layman who knows from experience the difficulties that laymen have in the reci-tation of the rosary, soIves those difficulties. There are sections on the history of the rosary and on mental prayer. A very useful book. Pp. 271. $1.75. Neu~ Testament Stories. By Rev. C. C. Marfindale, S. J, It is a child's l{fe of Christ. All who have the care of children will wel-come this well-written book. Pp. 140. $2.25. P. J. KENNEDY AND SONS, 12 Barclay St., New York 8, N. Y. "Marg's Part in Our Redemption. By Msgr. Canon George D. Smith, D.D., Ph.D. This is a revised edition of a book which first 322 November, 1954 BOOK ANNOUNCEMENTS appeared in 1937. Its author is an eminent professor and theologian, who, in this instance, writes not for theologians but for the faithful: Thi~ Rev. Wm. G. Most characterizes the book as one "that co-or-dinates and integrates the dogmatic truths behind devotion to Mary with a solid, unsentimental, and balanced application of these truths to the life of the soul." Pp. 191. $3.00. 'THE LITURGICAL CONFERENCE. Elsberry, Mo. Proceedings of the National Liturgical Conference, 1953. Th£ celebration of a National Liturgical Week, each year in a different place, is one of the most effective means employed by the Liturgical Conference to make both clergy and laity liturgical minded and so to promote a deeper and more solid piety. The present volume re2 ports the National Liturgical Week at Grand Rapids, Michigan. Its central theme was St. Pius X and Sqcial Worship. It contains not only the papers read at the conference but a stenographic report of the discussions whidh followed. Rea~ing the volume one can catch. the enthusiasm which prevailed at the meetings. Pp. 199. $2.00. THE NEWMAN PRESS. Westminster, Maryland. Talks to Teen-Agers. By F. H. Drinkwater. The book is not for teen-agers but for those who are responsible for their spiritual and gemporal welfare. It consists of outlines arranged topically, and should prove very helpful as a rich source of material for talks and discussions. Pp. 110. $2.00. " All Things ir~ Christ. Encyclicals and Selected Documents of St. Plus X. Edited by Vincent A. Yzermans. Thirteen encyclicals and ten other documents are presented in this volume. Each docu-ment is prefaced by an explanatory note which gives the theme ~f the document and its setting: it is followed by a list of pertinent references. Pp. 275. $4.00. J. S. PALUCH CO., INC., 2712 N. Ashland Ave., Chicago 14, Illinois. The Imitation of Christ. The translation' is new and into mod-ern English. The cover is a reproductic;n in color of a portrait painting of Christ by Jerome Gibbons. This is a Lumen book. Pp. 173: $0.50. THE SCAPULAR PRESS, 339 E. 28th St., New York 16, N. Y. Union With Our Lad~ . By Ven. Marie Petyt of St. Teresa. Translated by Rev. Thomas E. McGinnis, O.Carm., S.T.L. That Our Lady has a part to play in the salvation and sanctification of 323 BOOK ANNOUNCEMENTS each individual soul is a truth all religious accept. Some may not be aware how large that part is. The present volume of excerpts of the letters of the Ven. Marie petyt show how very large that part was for her., They show too how a religious may grow in devotion to Our,Lady and so make greater progress toward perfection. The . letters are followed by an excellent one-page outline of the Marian doctrine of Mary Petyt and her spiritual director Fr. Michael of St. Augustine. Twelve one-page meditations on the Blessed Virgin conclude the volume. Pp. 75. Paper $I.00. TEMPLEGATE, Springfield, Illinois. Guide to the Bible. By the monks of Maredsous. Translated from the French by Gerda R. Blumenthal. To read the Bible, par-ticularl~ r the Old Testament, without guidance almost inevitably means to miss the meaning intended by God its author. All that an intelligent reader must know about the Bible will be found in this volume of less than a hundred pages. It should do much to promote the reading of the Sacred Scriptures. Pp. 92. $0.85. All My Life Love. A commentary on St. Th~r~se's poem Vfvre d'Arnour. By Michael Day, Cong. Orat. The translation of the poem is by Ronald Knox. In the poem we 'have a treatise on the love of God as conceived by a saint and poet. Each stanza of the poem, together with the commentary that follows it, can very profitably be used as subject matter for meditation. Pp. 56. $1.25. NOTICE FOR PUBLISHERS Our Book Re~,iew .Editor is Father Bernard A. Hausmann, S.J., of West Baden College. Publishers fire requested to send all books intended.for review in this periodical to: Book Review Editor, Review for Religious, West Baden College, West Baden Sprlncjs, Indiana. 324 Questions and Answers m3 I~ A slsterwith solemn vows in a contemplative order was received without a dowry. It is not clear whether this dispensation was to be con-ditional at that time. The sister wishes now to establish a dowry. Will she need the perm[sslon of the Holy See, or will the superlor's permis-sion suffice? By. taking solemn vows sister gave up her right to ownership of temporal things, hence also the right to acquire anything in the future by way of inheritance, legacy or gift for herself. Here is what canon 582 of the code has to say on the subject: "After solemn profession, likewise without prejudice to any special indults of the Apostolic See, all the property which comes in whatever manner to a regular [that is, to one who takes vows in an order, can. 488, 7°]: "1 ° In an order capable of ow.nership, goes to the order, prov-ince, or house, according to the constitutions; "2° In an order incapable of ownership, it becomes the property of the Holy See." Sister, therefore, must turn over to her monastery whatever money or other temporal goods may come to her from any source whatsoever after she has made her solemn profession. Superiors will then have a free disposition of this money or other goods, since it " now belongs to the monastery. In case the monastery is incapable of ownership, superiors may ask the Holy See for permission to put aside that amount of money required for a dowry by the constitu-tions, and use it for that purpose. According to our constitutions a novice who becoms gravely ill may be admitted to profession . . . and a plenary indulgence in the form of a jubilee is also granted to her mercifully in the Lord. What is % plenary indulgence in the form of a jubilee?" As far back as 1570, Pope Saint Pius V, a member of the Order of Preachers, allowed any novice of the second order of Dominican nuns who was in danger of death to make her religious profession. In the course of time this privilege was extended to other second orders. 325 QUESTIONS AND ANSWERS Reoiew [or Religious In 1912 (September 3) Pope Saint Plus X extended this privi-lege to all novices of. every religious order.or congregation or society, and his grant was published in. a decree of the Sacred Congregation of Religious, dated September 10, 1912 (AAS. IV, [1912], 589- 590) which laid down detailed regulations regarding this profession of a novice at the hour of death (see REVIEW FOR RELIGIOUS, I, [March, 1942], 117-122). In this decree, under number 4, occur the words: "to him is granted mercifully in the Lord a plenary in-dulgence and remission of all his sins in the form of a jubilee." This phrase, "in the form of a jubilee," adds nothing to the plenary in-dulgence granted but is merely gn honorary title, so to speak, which indicates the generosity of the Roman Pohtiff in granting this extra-ordinary indulgence (se~ de Angelis: De Indulgentiis, ed. 2, Rome, 1950, p. 128 n. 176). m33m Our constitutions state: "two members of the same family, for ex-ample, two sisters, two cousins, or an aunt and a niece, may not at the same time be members of the general council." Now the father of our. newly elected mother general is a first cousin of the father of the sister elected to be the fourth general councllor. May this sister act validly and licitly as a member of the general council together with our recently elected mother general? Canori 19 of the Code.of Canon Law tells us that laws which restrict the free exercise of rights are to be interpreted strictly, that is: "the words are taken in their proper meaning, but in a narrower sense than must necessarily be attached to them; an interpretation is broad when the proper meaning of words is retained, but it is taken in a wider sense than the word bears at all times." (Lydon, Read~l Answers in Canon Law, ed. 3, 1948, p. 336.) Webster's New Collegiate Dictionary, 1950, ~lefines "cousin" as: "2. Specif: a son or daughter of one's uncle or aunt; also, a relative descended the same number of steps by a different line from a common ancestor." The first definition is the strict interpretation according to cXnon law, the second a broad interpretation. Ordinarily the term cousin is understood of persons called first cousins. Since the fathers of the recently eldcted mother general and of the newly-elected fourth councilor are first cousins, these religious are really second cousins, and hence do.not come within the strict canonical interpretation of the term "two cousins," as used in ithe 326 Nouember, 1954 QUESTIONS AND ANSWERS constitutions, referred to ifi the question. Hence both sisters may continue in office as members of the general council. We should add that our interpretation is based on the assumption that the examples given in the constitutions limit the meaning of "two members 6f the same f~imily." This interpretation seems reasonable to us. We are a diocesan institute. Our constitutions read as follows: (I} "The sisters elected to the general chapter shall remain, everyone in her own office, up to the ne~t chapter. No one can be deposed,, unless for a grave cause and by the general council alone." (2) "The mistress of novices shall be appointed by the superior general and her council." The general chapter is not a month old, whe~ the second councilor is appointed to the position of mistress of novices. May she be a meml~er of the general council and mistress of novices at the same time? No pro= vision ~s made in our constitutions for an event of this kind. The Normae of 1901, in. article 300, forbade the mistress of novices to hold any other office which might impede the care and direction of the novices and explicitly mentioned the office of general councilor. This article has been written into many constitutions and must be observed in 'such cases. The Code of Canon Law merely laid down a general norm in canon 559, § 3, which says: "Both [the master of novices and his assistant] should be free }rom all other occupations which could hinder them in the care and gov-ernment of the novices." The Code does not determine in par-ticular whicfi offices are incompatible; this judgment is left to the constitutions and to the prudent judgment of superiors. Now since your constitutions have no such prohibition, superiors may determine that the office of mistress of novices is not incompatible with that of general councilor. In that case the second councilor remains a member of the general council and also assumes the office of mistress of novices. --35-- Until recently our congregation has been merely diocesan. Our con-stitutlons permitted the mother gqneral to be elected to two terms of six years each, but not to a third immediate term. Recently we have re-. ceived the Decree of Praise from the Holy See and are now a pontifical congregation. Our new constitutions, like the old, permit a sister to hold two consecutive terms of six years each as mother general, but not a third immediate term. We are to have a general chapter in January, and our 327 QUESTIONS AND ANSWERS Replete for Religious present mother general will have completed twelve consecutive years in office by that time. Some sisters contend that under the new con!stltu-t[ ons she will be eligible for immediate re-dection for two more terms of six years each without any special permNslon from the Holy See. Is this correct? Father Frederic Muzzarelli, S.S.P. in his book De Congregation-ibus Iuris Dioecesani, published in Rome in 1943, holds this opinion, and Father Gallen referred to this interpretation, apparently with ap-proval (REVIEW FOR RELIGIOUS XII [September, 1953], 255). Father Muzzarelli gives the following reason for his opinion: "The time spent in office under the former constitutions is not to be com-puted, since these have nol/¢ lost all force." It seems to us that this in-terpretation is contrary at least to the spirit of the Letter of the Sacred Congregation of Religious dated March 9, 1920 (see Canon Law Digest, I, 276-277, for English text), and sent to all the local ordinaries of the world. The Letter stresses the years spent in of-rice, regardless c;fthe manner of obtaining .it. This likewise seems to be meaning of canon 505 which states that "higher superiors shall be temporary." Father Muzzarelli interprets "temporary" as "not perpetual" but the Letter seems to make it very clear that "tem-porary" is to be taken in the ordinary sense of the term. Twenty-four consecutive years of office certainly seems to us longer than the ordinary meaning of tempora[y. Our interpretation of the canon is confirmed by a recent state-ment of Father Anastasius Gutierrez, C.M.F., an official of the Sacred Congregation of Religious, who published a series of articles regarding the present practiceof the Sacred Congregation in Com-mentarium pro Religiosis during 1953 and is continuing the same during 1954. Here is his statement: "No matter how the mother general may have been promoted to or continued in office (by nom-ination, election, or confirmation), once twelve years of continuous regime have elapsed, she is no longer canonically eligible; she may be postulated, but cannot be re-elected" (page 90)." --36-- . Could you please give us a list of books that treat of obedience? Among rather recently-published books are the following. Valen-tine, O.P., Religious Obedience: A Practical Exposition for Sisters, (London, 1950; also, the Newman Press, Westminster, Md.). Polit, S.J., Perfect. Obedience: A Commentary on the Letter on 328 November, 1594 NEWS .AND VIEWS Obedience, translation by William Young, S.J. (Newman Press, Westminster, Md., 1947) PI~, O.P. (editor), Obedience--Volume III of series on religious .lii:e (Newman Press, Westminster, Md., 1953). Some rather recent books that contain extensive treatment of the subject are the following. Fennelly, C.S.Sp., Follow Me (Burns ~ Oates, London, 1943) ; see Part III, pp. 123-203.Msgr. Gay, Re-ligious Life and the Vows (Newman Press, 1942--reprint of an old book) ; see Part III, pp. 167-264. Brothers of the Sacred Heart, Catechism of Religious Profession (Metuchen, N.J., 1943--new edi-tion in press) ; see Section IV, pp. 159-201. Brothers of ~he Chris-tian Schools, Short Treatise on the Religious State, (Paris, 1950) ; see Chapter VIII, pp. 270-324. And, finally, see the first volume of "the series on the religious life, Religious Sisters (Newman Press, 1950): "The Vow of Obedience," by Marie-Joseph Nicolas, O.P.; and "The Adaptation of Religious Obedience," by Reginald Go-mez, O.P. In listing these, various treatises on obedience we do not neces-sarily recommend them because we have not read all of them suffi-ciently for that. Also, we list these because .we happen to have them at hand. Readers may know other treatises, and their suggestions would be welcomed. NEWS AND VIEWS (Continued from Page 310) spaced (triple is even better), with at least an inch of margin on each side of the page. It is difficult to make editorial notations on a crowded page. 2) Onion-skin paper should not be used. It is frustrating to try to make editorial notations on such paper. 3) For practical purposes, REVIEW FOR RELIGIOUS follows what might be called the "old-fashioned" method of printing quo-tations: that is, we print them just like the rest of the article, except for the fact that they are in quotation marks. This same system should be followed in manuscripts. 4) The use of capital letters should be very reserved. Congress in Canada Our May number (pp. 138-40) contained a great deal of pre-liminary information concerning the national congress of religious institutes to be held" in Montreal, July 26-30. The Acta of the 329 NEWS AND VIEWS Review" for Religious congress will be published: but~-we do not know the precise date of publication. In the meantime, pending the publication of th~ Acta, our readers will no doubt be interested in the following in-formation, which we have received through the kir~dness of Father Edward Sheridan, S.J., one of the Associate Secretaries of the con-gress and First Vice-President of the executive council of religious men. Interesting statistics include the following: At the inaugural general session were three cardinals and some twenty bishops. Also present at the congress were four abbots. In approximate figures, the delegates, representing some 200 religious institutes, with a total of 60,'000 members, were distributed thus: 400, representing 12,500 French-speaking religious men (of whom about 6,000 are teaching brothers); 150, representing 2,500 English-speaking religious men; 600, representing 37,000 French-speaking religious women; 250, representing 8,000 English-speaking religious women. Included among the delegates were 259 major superiors. At the inaugural general assembly Cardinals MacGuigan, of Toronto, and L~ger, of Moni~real, stressed adaptation and moderni-zation in habit and custom book. These points were also much stressed in the sessions of religious women. One fruit of the congress was the establishment of a Canadian Religious Conference--a permanent conference of all major religiou~ superiors resident in Canada, with a permanent secretariate to be established in Ottawa. This was. in resptonse to the express wish of the Sacred Congregation of Religious. Very Reverend Girard- Marie Par~, O.P., was elected the first president of this conference. The closing exercise of the congress was a torch-light procession and outdoor evening Mass, at the famous St. Joseph's Shrine. The Apostolic Delegate, the Most Reverend Giovanni Panico, was the celebrant. The physical plant was ideal for the meetings. This included St. Laurent College, conducted by the French Canadian Holy Cross Fathers; and St. Laurent Convent, of the Holy Cross Sisters--the two together constituting some five solid city blocks of religious and educational buildings, with fine grounds. The Holy Cross Fathers and Sisters were indefatigable in doing everything possible to make the congr.ess a success. The modus agendi of the sectional meetings--which especially impressed Cardinal Valeri, Prefect of the Sacred Congregation of Religious and President of the congres.s--was planned and executed 330 Nooernber, 1594 NEWS AND VIEWS x~ith remarkable ingenuity and efficiency. Before the congress, four books (one for each of the four sections) were printed. These books contained general information, outlines (some rather com-plete) of each of the papers to be given at the sectional meetings, topics for discussion and study, and the full text of the address given by Pope Plus XII to the congress of religious in Rome, December 8, 1950. Every delegate was provided with one of these books. Each of the sections had its own general session in the morning, at which four twenty-minute papers were read Jan the subjects indicated. Then each section broke up into study committees, of from twelve to twenty members, each committee discussing one of the papers read for a period of one hour. After lunch, the committees met again for an hour's discussion, 2:00 to 3:00 p.m. From 3:00 to 3:30 the speaker of the fiaorning conferred with the presidents and sec-retaries of the committee

Issue 49.1 of the Review for Religious, January/February 1990. ; R~\'u!w ~:~R Rt~u~aot!s ( ISSN OO34-639X ) is published bi-monlhly ai St. La~uis University by the Mis-souri Provinc¢ Edu~.'ational Inslilulc of the Soci,.Zly of.lcsus: Editorial Office; 36OI Lind¢ll Blvd. Rm. 4214: St. Louis. MO 63 IOg-3393. S¢cond-class postage2 paid at St. U~uis MO. Single copies $3.50. Subscriptions: United Stal¢.~ $15.00 I'or one .,,'ear: $2g.00 for two years. Olher countries: US $20.00 for on~ .vear~ if airmail. US $35.00 per )'car. For subscription orders or chan~¢ of address. write: Rl~\'ll~\V i:tm R~il.l(i~vs; F'.O. Box riO'70; Duluth. MN 55gO6. POSTMASTER: Send address changes to R~:\'l~:w vor R~:l.~{:l~nls; P.O. Box 6070; Duluth, MN 55806. I)avid L. Fleming, S.J. Iris Ann Ledden, S.S.N.D. Richard A. Hill, S.,J. ,Jean Read Mary Ann Foppe Editor Associate Editor Contrib.ting Editor Advisor\" Board David J. Hassel, S.J. Sean Sammon, F.M.S. Mary Margaret Johanning, S.S.N.D. Wendy Wright, Ph.D. Suzanne Zuercher, O.S.B. Jan.ar\'lFebrttarv 1990 Volume 49 N.mber I Manuscripts, Imoks fiw review and correspondence with the editor sho(dd be sent to w~a R~:u~;~o~s: 361)1 I,indell Blvd.: St. I,ouis. MO 63108-3393. Correspondence about the deparlmenl "Canonical Connsel'" should he addressed to Rich-ard A. Hill, S.J.; J.S.°I:B.: 1735 I,eRoy Ave.: Berkeley, CA 94709-1193. Back issues and reprints should be ordered from RF:\'u~w voa RF:L~;~US; 3601 I,indell Blvd.; St. I,ouis, MO 63108-3393. "'O1.11 of prinl" issues are availahle from University Microfilms International; 300 N. Zeeb Rd.: Ann Arbor. MI 481116, A major portion of each issne is also availahle on cassette recordings as a service for Ihe visually impaired. \\'rile Io the Xavier Sociely hw Ihe Blind; 154 Easl 23rd Street: New York, NY I0010. Review for Religious Volume 49, 1990 Editorial Offices 3601 Lindell Boulevard, Room 428 Saint Louis. Missouri 63108-3393 David L. Fleming, S.J. Iris Ann Ledden, S.S.N.D. Richard A. Hill, S.J. Jean Read Mary Ann Foppe Editor Associate Editor Contributing Editor Assistant Editors " REVIEW FOR RELIGIOUS is published in January, March, May, July, Septem-ber, and November on the twentieth of the month. It is indexed in the Catholic Periodical and Literature Index and in Book Review Index. A microfilm edition of REVIEW FOR RELIGIOUS is available from University Mi-crofilms International; Ann Arbor, Michigan 48106. Copyright© 1990 by REVIEW FOR RELIGIOUS. A major portion of each issue of REVIEW FOR RELIGIOUS is also regu-larly available on cassette recordings as a service for the visually im-paired. Write to the Xavier Society for the Blind; 154 East 23rd Street; New York, NY 10010. PRISMS. As we begin our forty-ninth volume, there are some additional names found on our inside cover editorial masthead. Although our readers may be familiar with the members of our Advisory Board from their writings or from conferences or workshops, I want to take this opportunity to intro-duce each one of them. Father David Hassel, S.J., with his doctorate in philosophy from St. Louis University, has taught university courses in the philosophy of hu-man nature, God, Augustine, and secularization for twenty-seven years. He has written four books on prayer (Paulist Press) and two on Chris-tian philosophy of education and of love (Loyola University Press), along with some nine articles for REVIEW FOR RELIGIOUS. He currently is a writer-in- residence at Loyola University in Chicago, Illinois. Sister Mary Margaret Johanning, S.S.N.D., is presently chancellor of the Jefferson City, Missouri diocese. From 1977 to 1987, she served in Rome as general superior of the School Sisters of Notre Dame, and from 1971 to 1977 as provincial councilor of the St. Louis province. With her doctorate in theology from Marquette University, she has lec-tured on topics of theology and spirituality, and has been involved in giv-ing retreats and spiritual direction. Brother Sean D. Sammon, F.M.S., is provincial of the Poughkeep-sie Province of the Marist Brothers and also serves as president of the Conference of Major Superiors of Men. He worked for nine years at the House of Affirmation, serving most recently as Clinical Director. With three books and a number of articles published, his most recent contri-bution is Alcoholism's Children: ACoAs in Priesthood and Religious Life (Alba House). With his doctorate in psychology from Fordham Univer-sity, he lectures on topics of adult development among religious and priests, sexuality and intimacy, and addictive behavior. Wendy M. Wright, with her doctorate in theology from the Gradu-ate Theological Union in Berkeley, currently teaches theology at Creighton University. She has taught at University of California at Santa Barbara, Weston School of Theology in Cambridge, and Univeisity of Nebraska at Omaha in the fields of history of Christian spirituality, his-tory of religions, and family spirituality. Among her publications are Sa-cred Dwelling: A Spirituality of Family Life; Francis de Sales and Jane de Chantah Letters of Spiritual Direction (with Joseph F. Power); and 3 4 / Review for Religious, January-February 1990 Bond of Perfection: Jane de Chantal and Francis de Sales. She and her husband, Roger Bergman, who is director of New Covenant Justice and Peace Center, have three children and live in Omaha, Nebraska. Sister Suzanne Zuercher, O.S.B., holds a master's degree in clini-cal psychology from Loyola University of Chicago and is a licensed psy-chologist in the state of Illinois. She has worked as a school psycholo-gist, university campus minister, and for twelve years as staff member and co-director of the Institute of Spiritual Leadership of Loyola Univer-sity, an international program training men and women for spiritual lead-ership as companions for those on the spiritual journey. She has offered workshops throughout the United States and Canada as well as in Japan, Hong Kong, and Indonesia. As a member of the Benedictine Sisters of St. Scholastica Priory, Chicago, she has served as first councilor and is presently community secretary and formation directress, a position she also held for six years in the 1970s. As editor, I am delighted to welcome these members of our Advi-sory Board. With their broad experience, learning, and publishing skills, they give promise of providing Rzvmw FOR Rzt.~c~ot~s with future direc-tion and creative imagination as we look toward the Church of the third millennium. David L. Fleming, S.J. Challenges Facing Active Religious Today Sally A. Kenel, D.W. Sister Sally Kenel, D.W., can be addressed at St. John's University; 300 Howard Avenue; Staten Island, New York 10301. Iduring the summer of 1988 I participated in the General Chapter of the congregation to which I belong, the Daughters of Wisdom. Since we are an international group with our generalate in Rome, the meeting was held at a large house specially equipped for chapters in the lake district out-side of Rome. There were many adjustments to make: some as basic as climate, language, and food. However, it was only after we had been meeting for about a week that I realized that even more significant than these was the overall adjustment in lifestyle. We followed a strict schedule which centered around our Eucharis-tic celebration and our Marian prayer in common. The casa at which we met was quite far from the nearest town. Moreover, the doors of the house as well as the gates of the property were locked at 9:30 P.M. and reopened at 8:00 A.M. On the several occasions I absented myself from the common meals, questions about the state of my health indicated that I had been "missed." In my initial processing of this experience, I com-pared being at the general chapter to being in the novitiate. However, as our discussions at the chapter centered on the mission of the congregation and the lifestyle of a religious today, I realized that even as we talked about community life in an active religious congrega-tion, we were living a monastic lifestyle. This insight served as the cata-lyst for this article in that it stimulated my reflections on the active as opposed to monastic lifestyle, and the challenges facing post-Vatican II active religious. Review for Religious, January-February 1990 The Active Religious Life Almost twenty five years ago, the Second Vatican Council in its "De-cree on the Appropriate Renewal of Religious Life," stated that such a renewal involved two simultaneous processes: "(1) a continuous return to the sources of all Christian life and to the original inspiration behind a given community and (2) an adjustment of the community to the changed conditions of the times."~ In the years which followed, our con-gregation, like so many others, took these words of Vatican II to heart and with much prayer, soul searching, discussion, and, at times, painful confrontation, engaged in the renewal of our congregation. The result of our efforts was the declaration that for us mission is primary. In other words, on the continuum which runs from contemplative to active relig-ious lifel we clearly situated ourselves near the latter. In so placing ourselves, we joined with other congregations in liv-ing religious life in a way that George Aschenbrenner has distinguished from contemplative life in six main ways. (!) Ministry is the primary de-termining influence for the community. This being the case, then (2) a certain flexibility is necessary in order to be able to deal with the de-mands' of ministerial activities. However, such a life may become scat-tered; therefore, (3) discernment is needed if religious are to find, be with, and serve God through their works. Since the purpose of the con-gregation is to be sent in mission, (4) mobility and availability are key elements of an active spirituality, and correspondingly (5) an apostolic form of prayer should characterize active religious. Finally, (6) the com-munity must be marked by a unity which goes beyond physical presence to a unity of mind and heart.2 Although active congregations have done much to make these char-acteristics vital dimensions of their lives, certain of these areas continue to challenge. Frequently the challenge they offer is a subtle one. While religious are engaged in evaluating their ministries and strategizing to in-culturate the gospel message and values, other aspects of active religious life may be neglected. It is these areas which continue to challenge re-ligious, and at times provide the fodder for those who endorse a return to a more traditional lifestyle. Assuming that participation in the mission of the Church is primary for active religious, and that our efforts at renewal in this area are con-stant, a whole variety of questions arise. For example, when we focus our efforts on mission what happens to community? Does it remain one of the marks of religious life, or do we abandon it and become secular institutes? As our communities become smaller and our works less insti- Challenges Facing Religious Life / 7 tutionalized what happens to "local superiors"? If they are no longer needed as administrators, who fills the mentoring roles which they tra-ditionally held? What is an apostolic prayer life? Can unity of heart and mind extend beyond the borders of a particular country or culture to form an international bond? The fact that these questions are spin-offs from the primary question of ministry in no way diminishes our responsibility to respond. As ac-tive religious we need to grapple with these issues to see where the Spirit is leading us today. It is to reflection on these questions that we now turn. The Challenge of Community Living The Vatican document, "Essential Elements in the Church's Teach-ing. on Religious Life," states that: The style of community life itself will relate to the form of apostolate for which the members have responsibility and to the culture and soci-ety in which this responsibility is accepted. The form of apostolate may well decide the size and location of a community, its particular needs, its standards of living.3 This statement clearly indicates that a community lifestyle is the norm for religious, and recognizes that local communities can and must take a form appropriate to the needs of the apostolate. As simple as this may seem, any one who tries to live in community with people who engage in a variety of ministries knows that the reality is quite complex. People come to community with a variety of expectations. Some use the family as the model for community life. Although the sharing of re-sources that community life demands may well be similar to that of a fam-ily, there are also differences. Some people expect to find in community the security of a parent-child relationship where they may relax in de-pendence or dominance depending on their personalities. Others ap-proach community as a sorority or fraternity and expect that community will provide them with a group of congenial companions with whom they may spend their free time. Others look on community as a shelter, a place to come home to after a hard day's work. Sitting quietly in front of the TV is their idea of a pleasant evening together. For still others, a "bed and breakfast" model of community is the ideal. Ministerial ob-ligations, dinners with friends, shopping, visits to a health club, and so forth, indiscriminately keep a person busy every evening. By so limit-ing the time spent with the group, a person is able to avoid the give-and-take which life in community ordinarily demands. At least in part, all these expectations show a response to the com~ Review for Religious, January-February 1990 mon life that was the norm for religious communities prior to Vatican II. At that point in time, a good community was one whose main attrib-utes were regularity, order, and discipline. Vestiges of this ideal remain and constitute the basis for the expectations of some religious today. On the other hand, there are religious whose expectations of community have their roots in reactions against a common life. The result is a ten-sion which is expressed by clusters of people around the pole of group orientation in opposition to clusters of people around the pole of indi-vidual orientation. Attempts to address such tension on the practical level has led to such practices as interviewing prospective members of a local community in order to examine mutual compatibility. Although such testing may lead to a more peaceful life together, it fails to address the basic issue of the value of community itself. Why do active religious live in community? One way to respond to this question is rooted in Johannes Metz's understanding of religious congregations as "the institutionalized form of a dangerous memory within the Church."4 The community life of an active religious congregation, then, recalls the enthusiastic union of the early Christians described in the Acts of the Apostles: "The community of believers was of one heart and mind, and no one claimed that any of his possessions was his own, but they had everything in common" (Ac 3:32). These early Christians had grasped the notion that God is community, the Trinity, and gave witness to this belief through their life together. Thus, the community life of active re-ligious today serves as a protest against the excessive individualism in today's society and bears witness to the fact that to be is to be in rela-tionship. Reflection on the value of community does not immediately solve all the problems connected with the living of community today. However, it does provide the context in which religious can explore the particulars of community life. By locating the value of community in witness, the notion of community for the mission of the Church is reaffirmed. Thus, the challenge for active religious is to find ways of being together in com-munity which facilitate the ministries of each member, and at the same time proclaim the interdependence of all people. The Challenge o1' Mentoring Several years ago when I was a member of our community's forma-tion team we spent a great deal of time reflecting on where to send our ne~,ly professed sisters. Although ministerial opportunity was our pri-mary consideration, we quickly became involved in the question of vi-able community situations. Where were there sisters who would be open Challenges Facing Religious Life to sharing their lives with the temporary professed whose experiences were so different? Where were there sisters who could and would serve as mentors for these women? In general, we found a reluctance on the part of older sisters to become involved in a mentoring relationship. In pre-Vatican II days this problem did not exist. The local superior was responsible for all the sisters in her house, and she was expected to pay particular attention to the integration of the temporary professed into the community. Thus, the formation begun in the postulate, novitiate, and juniorate was continued by the superior in the house to which a sis-ter was assigned. In addition, regular personal meetings with the supe-rior often served as spiritual direction. Today active communities are smaller and less structured. Often, the group is not uniformly involved in a particular ministry. Joined to the emphasis on the personal respon-sibi! ity of each member, these factors have contributed to the demise of the role of local superior. In their place we find the "communicator" or "contact person," that is, someone within the group who accepts re-sponsibility for communication with the provincial leadership, and so forth. However successful such communication may be, this redefinition of task may leave the mentoring role which the superior formerly filled empty. Such a lack not only deprives new members of receiving the tra-ditions of the community, but also raises the question of whether the adult crisis which Erikson describes as Generativity vs. Stagnation is be-ing successfully negotiated. Although some may claim that their minis-try outside the congregation commits them to involvement in establish-ing and guiding the next generation of Christians, the responsibility of passing on the charism of their particular group cannot be ignored. However, some will argue that the religious life of today bears little resemblance to the life to which they committed themselves. They con-tend that they cannot be expected to pass on the tradition because they themselves do not know what has happened to it. Take daily Eucharist, for example. They consider it a must, and yet newer members of the com-munity do not share the depth of their commitment in this area. How can they be expected to pass on the tradition to those whose values are judged not only different but inferior? What these people fail to realize is that generativity demands the pass-ing on of the tradition, in this case the charism, and not one particular time bound expression of it. Their nostalgic reminiscences of the "good old days" when community members did everything together are but signs of their own stagnation. The challenge for active religious is to re- Review for Religious, January-February 1990 alize that the process of renewal set in motion by Vatican II is an ongo-ing one. It demands the frequent return to the charism, and the contin-ual search for appropriate expressions of the charism. The refusal of men-toring roles in a congregation may indicate that it is time to examine the charism again with the hope of identifying its core values so that these values in turn may be passed on. It may also be time to view the charism as a gift to the whole Church, not merely to a particular congregation. This opens ihe way to redefining membership to include associate mem-bership and other forms of affiliation with a congregation. These new forms of membership in turn raise anew the challenge of mentorship. The Challenge of an Apostolic Prayer Life The need for prayer in the life of a religious is often likened to a car's need for gasoline. Unless one gets the tank filled periodically, the car will not continue to run. One immediately makes the connection with the need for religious to take time to become filled with God. Today's re-ligious seem very much aware of the need for periodic retreats and pro-longed periods of prayer. However, another automobile analogy can be made. It is not only gasoline in the engine that keeps a car running. While the car is going the battery must be constantly recharged by the ¯ alternator or else the car cannot continue to run. Thus, besides setting aside more extended periods for prayer, an apostolic prayer life calls for continual prayer in the midst of activity. But, how does one "pray always?" (Lk 18: I). The temptation is to claim that one's work is prayer. However, in such a simple equation, both work and prayer lose something. A brief reflection on Eucharist may help to bring the relationship between prayer and work into sharper focus for the active religious. Eucharist involves three basic movements: thanksgiving, memorial, and invocation. At Eucharist we give thanks to God in Jesus' name for all the good things--be they as general as creation, and redemption, or as particular as specific moments of grace. We remember the death and resurrection of Jesus, the "dangerous memory" par excellence, a mem-ory which promises freedom for all. We implore the Holy Spirit to make our gifts holy and to transform ourselves as well. Notice, however, that this is not the prayer of an individual, but rather we thank; we remem-ber; we invoke. The Eucharist teaches us that prayer is not merely a dia-logue between a person and God, but rather that Christian prayer is com-munal. Moreover, Eucharist does not end when one leaves the church. As the poe~n by R. Voight makes clear, in our work we do Eucharist. Con- Challenges Facing Religious Life sider, one verse: He was old, tired, and sweaty, pushing his homemade cart down the alley, stopping now and then to poke around in somebody's garbage. I wanted to tell him about Eucharist But the look in his eyes the despair on his face, the hopelessness of somebody else's life in his cart, Told me to forget it. So I smiled, said "Hi"--and gave him Eucharist.5 This brief reflection on Eucharist points to the dynamic relation be-tween prayer and work in the life of the active religious. Prayer as en-gagement in contemplation is not an individual activity, but rather, no matter how personal, is also communal. Our communion with Christ is a communion with the Body of Christ as well. This sense of communion finds expression in prayer not only as the context out of which one prays but also in the form of prayers of petition, and through such expression communion is enhanced. In turn, this sense of unity with others demands expression in our ministry. Our union with Christ urges us to a life of service. Thus, an apostolic prayer life does not exist alone, but only in conjunction with a prayerful apostolate. The challenge of an apostolic prayer life is to develop a prayerful approach to ministry so that prayer and work are viewed as different forms which our efforts towards true communion take. The Challenge of Internationality We live in a time when distances between places have been reduced drastically by improved means of communication and transportation. We live in a time when the condition of the very planet on which we live challenges us to recognize our interdepeiadence. Simultaneously, how-ever, today's religious are encouraged to adapt their style of life to the demands of their specific apostolates and to the culture in which they live. In trying to make such adaptations, religious tend to emphasize the needs and demands of the local church and the local community. Al-though such a focus is important, at times it can be isolating, and can raise the question of what it means to belong to a larger group, be it prov-ince or international congregation. In other words, if we have more in common with other religiou~ living and working in similar situations than we have with other members of our own congregation, why belong to Review for Religious, January-February 1990 an international congregation? Responses to questions such as these hang on the value which one places on the charism of a congregation. Is the charism an adequate ground on which bonds strong enough to extend across continents yet flex-ible enough to allow for cultural diversity can be built? Or to put it an-other way, does sharing the past, being a community of memory, so ori-ent us that we engage in the here and now not only with enthusiasm, but with the realization that our here and now is but a part of the total pres-ent reality? Moreover, does being a community of memory so orient us towards the future that we face it with hope not only for ourselves, but for all people, for the world? The potential of the charism of a congregation to enable bonding needs to be developed and made concrete. In recent years such develop-ment of the charism in active congregations often has taken the form of a mission statement. However, the mission statement itself can remain purely theoretical unless we begin to share the stories of how this state-ment is enfleshed in the specific ministries of religious in different cul-tures. Without such interpersonal and self-disclosing communication, true bonding within the congregation will not occur~ and the potential for challenge and affirmation on an international level will remain unde-veloped. International bonding built on the principles of interpersonal and self-disclosing communication stands in stark contrast to a hierarchical model of bonding. In the former, the general administration is charged with fa-cilitating such communication as opposed to serving as the bond of unity in the congregation. Each member shares the responsibility of preserv-ing and strengthening the bonds of congregational unity. Furthermore, each member shares the responsibility for creating new bonds through her sharing of the concrete form the charism takes in her life and minis-try. In other words, the local community and the local church need not become less important to the individual religious, but each one must come to the recognition that there are other local communities and other local churches where needs and attempts to meet these needs are quite different from one's own. Moreover, the full meaning of one's local church and local community can be found only in relationship to the uni-versal Church and the congregation. A religious congregation as a visible, identifiable group of people within the Church serves as a model of the Church. A non-hierarchical understanding of the internationality of a congregation can function as a symbol of grace for the larger community. As such it refuses to allow Challenges Facing Religious Life the universal Church to be understood as the Vatican, but recalls the Pauline understanding of universal Church as the communion of local churches. At the same time, the internationality of a congregation refuses to allow a local church to consider itself an autonomous subdivision of the universal Church. The internationality of a religious congregation calls the Church to recognize that it is at once local and universal. However, a religious congregation can function as a symbol of grace for the Church in this way only if it itself is truly international. In other words, the challenge of internationality for a religious congregation is much the same as it is for the Church--to realize that it is at once local and universal. On the practical level, this becomes the challenge of es-tablishing, maintaining, and enhancing personal, self-disclosing commu-nications. Conclusions If the chosen priority of a religious congregation is the mission of the Church, then this priority will have ramifications on all of life. The challenges facing active religious today flow from this primary commit-ment to ministry. Moreover, the challenges which we examined in this article all seem to have a common thread--that of recognizing oneself as living in relationship. Whether one examines the quality of local com-munity life, the continuation of a congregation and its values through men-toring, apostolic prayer, or internationality, the central challenge is to a life of interdependence. In other words, the ideal of the "rugged indi-vidual" has no place in active religious life. Since many of us have cul-tivated this ideal in order to survive the past two decades in religious life, the challenge to live interdependently is one that strikes at the heart of our hard won "freedom." On the other hand, interdependent living and dependent living are not synonymous. Interdependency demands that we take responsibility for our own lives and at the same time realize that we are part of an intricate web of relationships. Insofar as religious are able to meet the challenges of interdepend-ent living, they in turn will become challenges to others--to the Church, to the nationalistic spirit of governments, to a consumerism which has no regard for non-human life, or the environment. In this way, active religious will serve as symbols of grace, reflecting to all the community of God. NOTES "Decree on the Appropriate Renewal of Religious Life," in The Documents of Vati- Review for Religious, January-February 1990 can H, ed. Walter M, Abbott, S.J., p. 468, no. 2. 2 See "Active and Monastic: Two Apostolic Lifestyles," REVIEW FOR RELIGIOUS Wol. 45 (1986): pp. 653-668. 3 Origins 13 (1983) p. 136, no. 21. 4 Followers of Christ (New York: Paulist Press, 1978), p. 12. 5 As quoted in Morton T. Kelsey, The Other Side of Silence (Paulist Press, 1976), pp. 276-278. The Challenge God, can you wrap your arms around me, hold me tight and tell me that you love me? Jesus, as my lover, can you really do that? Spirit, can you fulfill the need I feel . . . to be touched, squeezed, loved? Make love to me, God, can you do that? Whisper in my ear, Jesus, can you? Tell me You want me as well, Spirit, is that possible? Am I not to be human anymore? Am I not to feel desire? Am I not to remember or imagine? I imagine his pain as the nail broke through his flesh. I remember the words he screamed at his death. My heart is full of desire for him. I am human--so was he. He came to gather us for his Father. He wants me. He whispers to me everyday and makes love to me with every breath I take. He touches me, squeezes me, loves me. Yes, Lord. My God. I believe. I feel your arms engulf me-- Hold me tighter, Lord. I love you, too. Elaine Laws A.S.C. Affiliate Lay Volunteer Liberia, W. Africa Enlarging Perspectives for the Future of Religious Life Shaun McCarty, S.T. Father Shaun McCarty, S.T., teaches in the Washington Theological Union and is a staff member of the Shalem Institute for Spiritual Formation. His address is Holy Trinity Mission Seminary; 9001 New Hampshire Avenue; Silver Spring, Maryland 20903. ~l~s we approach the last decade of this century, religious find themselves deeply concerned with and uncertain about the future. The crisis facing religious (mainly in the United States and in western Europe) is marked by a decrease in vocations, an increase in median age, and a growing com-plexity of ministerial needs. Many are experiencing either sadness, fear, anger, helplessness, hopelessness, or some combination of the above! The causality (which I would not pursue at length here) is complex. In addition to a history of change that has marked the evolution of reli-gious life, there are theological reasons for the present crisis such as Vati-can II's accent on the universal call to holiness; pastoral ones such as ex-panding possibilities for dedicated service for laity; and cultural ones such as delayed maturation leading to difficulties for young people in mak-ing lasting commitments. People have different ways of dealing with crisis. One can choose (a) to deny or ignore it with a cockeyed optimism; (b) to blame it on the wrong causes or people; (c) to hanker after "the good old days" (that are yet to come!); (d) to become immobilized and depressed by a fatalis-tic cynicism; (e) to engage in narcissistic introspection and breast-beating; (f) myopically to limit one's perspective or to focus on the wrong issues. None of these alternatives is constructive. My contention is that religious life is in transition and that we need 15 Review for Religious, January-February 1990 a strategy for living in a transitional period. As a first step in developing such a strategy, I would suggest enlarging one's perspectives so as to face the future with hope. By "perspective" I mean the scope or hori-zon of a person's or a group's vision whereby one is enabled to perceive context, allowing for a sense of proportion and within which one can fo-cus attention and energy. Context enables one to see something in its re-lationship rather than in isolation. This, in turn, allows it to be seen in proportion to its real significance. Within proper context, one can then choose to focus on the right issues. It is also my contention that, though painful, crisis bears potential for growth. "Crisis" literally means being presented with a situation de-manding decision. The word for discernment in Greek is diakrisis, that is, "a sorting out." It is that "sorting out" that I would like to address. As all Christians, religious have a responsibility to discern the signs of the times in the process of making decisions for the future in a spirit of hope for the coming of the kingdom. So the question is: What help is available in reading the signs of the times that are pertinent to what has always been a changing shape of religious life? My task is to try to provide some perspectives that might enable a hopeful reflection on what we can expect and prudent decisions about what we can do to help shape the future. I will attempt neither to predict nor will I presume to play the prophet. Rather, I will explore some mean-ings and pose some questions that might hopefully expand and deepen perspectives in sharing responsibility for the future. Some Meaning to Broaden Perspectives I would suggest five key areas where broader and deeper perspec-tives might be profitably pursued. They include: (I) the primacy of the kingdom (or reign) of God; (2) a mature grasp of and love for the Church as "Catholic"; (3) membership in interdependent religious community; (4) different approaches to and notions of the future; (5) the cultivation of a mature sense of Christian hope and trust. The Primacy of the Kingdom (or Reign) of God Kingdom (or reign~ of God is a symbol used to convey the mystery of the corporate vision or dream for the future that energizes Christians for involvement in the present. It is the large perspective that embraces all the others. It summarizes the mission of Christ now shared by all. God's reign is already breaking through and manifest by those liv-ing the beatitudes which results in fruits of the Spirit such as peace, jus-tice, mercy, forgiveness, reconciliation, unity, and love. Obviously these Enlarging Perspectives values of the kingdom are not the exclusive property of any group within the Church or even of the Church itself. A Mature Grasp of and Love for the Church as "Catholic" The Church, though not co-terminus with the kingdom, is a commu-nity of disciples called together in Christ to be a visible body united in belief, discipline and worship in service of the kingdom. It is important to remember that the beginnings of the Church (which we continue to remember) were marked by "upper room experiences" where Jesus washed feet as a prelude to Eucharist and where the Holy Spirit descended upon disciples who had gathered in fear and confusion to be empowered for the mission of proclaiming the Good News of the kingdom. "Catholic" is a designation that indicates the universality of the Church's scope; its quest for unity, yet respect for differences; its inclu-siveness of peoples and cultures; and its ability to recognize and to re-spect kingdom values wherever they are found. The term "Catholic" is opposed to insular, parochial, provincial, or sectarian attitudes. A mature love for the Church means accepting her in both her graced and flawed condition; being faithful to her in attempting to personalize the institution as others experience Church in our ministry to them; and working prophetically from within the perennial tasks of renewal (begin-ning with ourselves!). Membership in Interdependent Religious Community Religious life is an ecclesial way of living a vowed Christian life in community for the sake of the kingdom. It is both charism and institu-tion. As charism, it is a gift of the Spirit to the Church through the in-spiration of a founder. As institution, it is structured according to a rule of life or constitution approved by the Church. Though both charism and institution are important elements to be kept in poised tension, I would suggest that sharing in the charism is morevital to membership than par-ticipation in its institutional structures. It is even a deeper bond than af-fective ties with other members. By membership I mean how, where, and when one experiences a sense of bel6nging to or connectedness within a group. I would also suggest that today, more than ever before, members and communities are called to greater interdependence both within the com-munity and with other groups. By "interdependence," I mean mutual dependency in co-responsible fashion as opposed to an unhealthy inde-pendence or dependence. Review for Religious, January-February 1990 Different Approaches to and Attitudes towards the Future "Future" refers to that aspect of human history not yet fully here except in seed and about which little can be known with certainty, but for which there is responsibility for human choices in the present. There are different attitudes about the future. Some hold that history continues to repeat itself and that managing the future means knowing the past. Others think changes are going to be so radically different in the future that it is senseless to look at the past. There are others still who feel that, as the present has emerged in continuity with the past, so the future will be both creative and new, but will emerge in continuity with the past and present. I believe the latter is more in keeping with the notion of Divine Provi-dence. As a matter of fact, the Latin root of "providence" is "pro vid-ere" which means literally "to see with" or "to see for"--implying the use of dynamic memory in looking at the past, creative imagination in looking at the future, and collaborative action in the pres.ent. Thus Di-vine Providence may be viewed, as God calling creatures to be co-responsible for and to collaborate with the Spirit in shaping the future. There are different kinds of futures including: (a) possible, that is, what could happen limited only by the scope of imagination; (b) prob-able, that is, given current trends, what is likely to happen; (c) prefer-able, that is, what should happen determined by a value system; and (d) plausible, that is, what can happen by attending carefully to the other kinds of futures. I would suggest that, in helping to shape the future, we need to explore the possible, assess the probable, assert the preferable, and attempt the plausible. The Cultivation of a Mature Sense of Hope and Trust By hope I mean trustful expectation for the future, born of faith in promises of the more to come. Just as with faith, I believe there is a first and second naivete of hope. In faith development, what begins initially as an unquestioning and naive faith, after a period of doubt and questioning, can grow into a more critical and mature faith marked by a second naivete. A similar develop-ment can happen in regard to a naix, e hope. An Eden-like expectation of absolute assurance can be shattered by an act of betrayal (real or sup-posed, conscious or unconscious). If the person thus "betrayed" can for-give and effect reconciliation with the event of betrayal, then that per-son can grow to a more mature trust (second naivete) which includes the possibility and risk of further betrayal. I would submit that people can experience corporate as well as individual betrayals, that is, betrayal by Enlarging Perspectives a renewed Church or changed religious community. Some Questions to Enlarge Perspectives (1) Perspectives of kingdom and Church Are we "catholic" enough in our notion of Church? How much do we perceive Church in the first person plural? Do we view both institu-tional and charismatic elements in the Church as interdependent, minis-tering in mutual dependency rather than as competitors or adversaries? As different (and often differing!) individuals and groups in the Church, can we transcend personal and intramural agenda by focusing on king-dom priorities? Does our grasp of Church embrace a missionary dimen-sion as necessary to its fullness? In carrying forth the mission, do we see evangelization as a two-way street, a dialogue in which we need to lis-ten to learn as well as to proclaim to teach kingdom values? Do we value quality of personal evangelization (especially our own !) over quantity of religious practices? In evangelizing, are we able to distinguish Gospel from cultural values? Are we developing a mature love for that Church? Does such love imply placing a priority on our personal relationship with Jesus and com-mitment to the Gospel proclaiming his kingdom as realities that relativ-ize Church membership? In realizing that discipleship is prior to apostleship? In seeing code, creed, and cult as important, but secondary to our experience of God in Christ? Does a mature love for the Church call for recognizing and embracing the flawed as well as the the graced condition not only of ourselves and other individuals, but of the Church itself? Does it mean reverencing the person and opinions of others who disagree with us? Being able to forgive those who wound us? Does ma-ture love prefer invitation to control by refusing to resort to power poli-tics to win the day, even for a worthy cause? Does it include making pref-erential, yet not exclusive options for the poor? Does it call for building bridges between those who have and those who have not? Do we foster mature love of Church by exercising a truly servant leadership that is ready to wash feet? To share Eucharist in life as well as sacrament? To discern the Spirit of God in experiences of life? To recognize, affirm, and enable the use of different gifts for ministry in the Church? Does ma-ture love lead us to avoid elitism and to shun seeking privilege? Are we comfortable enough in our Catholic identity so as to engage in genuine dialogue (in which we listen as well as speak) with other Christians and non-Christians energized by a passion for unity in love as well as truth? Do we acknowledge goodness wherever or in whomever we find it, in-side or outside the Church? Do we acknowledge kingdom values wher- Review for Religious, January-February 1990 ever we find them? (2) Perspectives of religious life: So as to establish a proper context, rather than asking in isolation "What is happening to religious life?", should we be asking, "What is happening in the Church?" And what is happening in the global Church--in Africa, Latin America, Asia, and elsewhere? Not just in the local Church in a given diocese, nation, or culture. Within respective religious communities, do we need to shift focus and to widen horizons? To shift the focus of membership in community from local living to the larger religious community sharing a charism within a context of Church and kingdom? As religious, is there any higher obedience we owe the Church than fidelity to the charism of our community? And, in fact, is that charism the exclusive possession of any given canonical group? Can that same charism be shared by men as well as women? By laity as well as by religious? by non-Catholics as well as by Catholics? If the charism is susceptible of wider appropriation, then is there a responsibility for religious to share and foster it with others out-side their own canonical groups? Could it be that the charism will out-live present structures that embody it? What can we do to discover or to create the conditions for"upper room experiences" so that community gatherings might become energiz-ing and enabling rather than enervating and obstructive? What would they look like in terms of participation? Prayerful mode? Respect for dif-ferent gifts for ministry? Though responsibly planned, with a readiness for kairos moments in which we can be surprised by the Spirit? Agenda with priority on the needs of those we serve over internal concern? Lis-tening with open hearts? How are we dealing with the fear and confu-sion of crisis? How and in what areas can we work in mutual dependence with oth-ers who share our concerns? Where is there redundancy, competition, or unhealthy independence or dependence? Between religious communities? Between men and women? Between religious and laity? Between parish priests and religious or lay associates? Between Catholic and non- Catholic sponsored programs? What kind of support do we need from and can we give to one another? (3) Perspectives of the future and hope for it: Can we resist being victimized by "prophets of doom" proclaim-ing the probable? Are we ready to share responsibility for shaping the future by reading the signs of the times and by making discerned choices for the preferable and plausible futures? Have we grown in a mature Enlarging Perspectives sense of hope and trust? Have we survived real or supposed "betrayal" within communities and/or the Church? How have we reacted or re-sponded? With bitterness? Anger? Resentment? Cynicism? or with for-giveness and reconciliation? With the readiness to enter a more real world? With greater awareness and acceptance of human limitation? With a more mature love of Church? With the willingness to risk in trust-ing again? With the firm belief that, though Jesus has ceased to be vis-ible, he has never ceased to be present? Conclusion Perhaps a fitting paradigm for this time of transition would be the Exodus event? Many, lured by promises, never reached the Promised Land themselyes, but lived and worked that others might? As Sam Goldwyn used to remark at meetings. "For your informa-tion, I have come to ask a few questions!" Perhaps this is a time for hav-ing more disturbing questions than comforting answers. It was Rilke who said the important thing was to love the questions and perhaps someday we would live ourselves into the answers! There might be the germ in that for a strategy of survival for religious during an era of transition: to love and live the questions to~e'ther in hope! Towards A Trinitarian Model of Religious Life John J. Markey, O.P. Father John Markey, O.P., is a member of the Southern Dominican Province. His address is De Porres House; 495 Merritt Avenue; Oakland, California 94610. The authors of the landmark book, Habits of the Heart, present a clear challenge to traditional religious communities which claim to want to "transform" the dominant cultural ethos. ~ It is ultimately up to the vari-ous churches to provide a morally coherent alternative to the radically myopic individualism that has come to so characterize and inform Ameri-can culture. But religion itself has often been both systematically co-opted by this culture, and has reinforced it by providing a rationale for its most insipid implications. It is, therefore, increasingly evident that the churches must begin any wider prophetic role by questioning and re-imagining their own communal life, and the place of the valid insights of individualism within this context. Within the Roman Catholic tradi-tion it is clear that those in religious life have a particularly urgent man-date and rich resources in this regard. There is a growing awareness that any genuine Christian community must be both inculturated and prophetic. This means that the community must define itself within a certain cultural context; it must take seriously and even incarnate the valid insights and thought-forms of the culture. But the community will also necessarily have a countercuitural dimen-sion to it. It will be characterized by a lifestyle that explicitly contradicts some cultural themes and attitudes that are seen to be irreconcilable with gos-pel values. A thorough analysis of American culture would reveal many myths 22 A Trinitarian Model. of Religious Life / 23 and values that need to be challenged and transvalued by the gospel, but no single aspect of American life is as pervasive and dominant as radi-cal individualism. It is fair to say that Western liberal thought revolves around this theme, and that it informs every strain of American cultural life. The deifica~tion of this cultural value has had a destructive impact on American life by creating an ethos where commitment is often unin-telligible, fragmentation and disintegration of family life is unavoidable, and personal isolation is the norm. This is not to say that individualism in itself is the problem. On the contrary, there are many positive and valuable insights attached to this thought-form. Some of the fundamental values derived from individual-ism that religious communities should incarnate are: the emphasis on the value and dignity of each person and the role of the community in en-hancing this dignity; the primacy of the personal, relational, and experi-ential dimension of the community life over against the institutional and structural dimension; and the absolute need for personal manifestation and self-appropriation of community identity, decisions, and goals. Any North American religious community must take the valuable insights of individualism seriously if it truly wants to be both inculturated and pro-phetic. But the community must, at the same time, develop a lifestyle that puts this phenomenon in the fuller perspective of the gospel. Proposal for an lnculturated North American Model of Religious Life Given both the major cultural themes and the major cultural needs and problems, I propose that community should be the rubric around which we redefine our understanding and praxis of religious life at this time. I think that it is this element of religious life which, if properly un-derstood, best encompasses and incorporates the relational, personal, and experiential values that we learn from our culture. It is also community which most clearly responds to the desperate need in our time for a sig-nificant countercultural alternative to radical individualism. It is clear, however, that we must come to a new and meaningful understanding of community, particularly in a Christian and Catholic context, if we are going to develop the coherent alternative we seek. We must rethink tra-ditional understandings of community and communal life in terms that can both express the new insights of the culture while at the same time remaining faithful to the spirit of both the gospel and the broader tradi-tion in regard to community. Along these lines, then, I propose that we consider the Trinity to be the model of authentic Christian community, and therefore the context Review for Religious, January-February 1990 in which we redefine community and community life. I hope to make it clear that a trinitarian model and trinitarian terminology are ultimately more helpful for the task previously laid out than the Christological model on which much of religious life is currently based. Furthermore, I propose that we adopt a modern (though traditionally informed) social understanding of the Trinity that explains the Trinity in experiential terms. Here I am essentially assuming that there are two traditional theo-logical interpretations of the Trinity, that while related are finally dis-tinct. 2 I will try to explain the two lines of development below and then show some of the implications of taking one as our model of commu-nity. It is important to see that the fundamental advantage of this option is that it provides a model of community based on the very life of God as we understand it. In this sense the religious community is defined as an icon of the Trinity, which means that its self-understanding must ul-timately be shaped by its most deeply held theological assertions. Two Approaches to Understanding the Trinity I) Substantial Identity In the West after Augustine, the primary approach to Trinity was to begin with the divine "substantia," the single and simple essence or sub-stance of the Godhead, and then try to explain (generally using a very schematic psychological model) how this single substance could be triper-sonal. So the main focus of this line of development was the attempt to show how the three persons could relate to one common divine sub-stance, which necessarily precluded any multiplicity, while at the same time maintaining a real distinction of persons. This approach was suc-cessful in describing the unity of the Godhead, but ultimately found it difficult to give an adequate account of the relation of persons within this unity. For this reason articulations of this approach often ended in either modalism or quaternity. H)Vital Identity and Mutual Inexistence In the East, following the lead of the Cappadocian Fathers, there was a tendency to begin with the reality of the three persons and then to ar-gue to the unity of the Godhead. In essence, the task of this approach was to show how three persons could be one (rather than how one could be three). Along these lines there were two critical developments. First, Victorinus proposed that the unity of God be described as a "vital iden-tity" of life and action rather than as a "substantia."3 God then was not to be understood as some static essence, but as vitally and dynamically A Trinitarian Model of Religious Life / 95 alive. The three persons, therefore, do not share a common substance so much as a common identity of life. Secondly, John of Damascus proposed the concept of mutual inex-istence (perichoresis) as the best way to describe the unity of the three persons.4 This meant that the three indwell in one another and compene-trate with one another, as the flame of three wicks can burn as one. This mutual indwelling or inexistence of the divine persons is not a conse-quence of their unity, but the equivalent of it. It is in fact the mutual and complete compenetration of the three divine persons that comprises their essential unity. So here the divine persons literally exist in one another in a vibrant and ecstatic way. The three persons, as incorporeal and fully self-donating, experience an interpenetration and intense empathy that is ultimately a single identity of life. It is then the self-donation of the three persons that makes their unity possible. This mutual self-donation, however, does not compromise the autonomy of each divine person, but is only possible because of it. With-out autonomy no action would be possible, let alone self-donation. This perfect self-donation makes relationships unitive rather than divisive. This means that mutual self-donating relationships constitute the very re-ality of God. By beginning with the persons we come to a radically social under-standing of the Godhead that can in turn lead to a social understanding of created reality as well. God is the supreme communion of three di-vine persons, which humans are called to reflect imperfectly, but sacra-mentally, in relationships and community. If we choose community, then, as the rubric under which to rede-fine religious life, it would seem that the second approach to Trinity is the best model for human and particularly Christian community. I would contend however, that most models of religious life, and particularly the models of community within these, coming out of past paradigms in the West, are based on the "substantial identity" approach. I would like to make a short critique of the understanding of community under this model, and then begin to reinterpret some aspects of community and re-ligious life under this new model. Short Analysis of the Old Model of Community In many ways the old paradigm of religious life and particularly of community is analogous to the substantial identity approach to the Trin-ity. Traditional understandings of religious life tended to begin with the one substance, usually the institutional structure of the community, or-der or congregation, and then tried to fit individuals into this substance. Review for Religious, January-February 1990 So they began with the unity, which in this case tends to be a formal and impersonal unity, to which individual persons must relate. In this model the persons do not relate directly to one another, but instead relate to a certain "thing" called community. Personal relationships within this type of community are then either mediated or accidental. Individuality in this model means that I have my own personal and spiritual life (that should stay within certain boundaries and follow certain rubrics) and that I relate to the group in a certain structured way along the lines of func-tion. In other words, the work that I do is regulated by and somehow re-flects the group. The theological focus and justification for this understanding of com-munity tends to be narrowly Christological. As an individual I follow Christ by joining with a group of Christians who want to follow Christ along a similar pattern. In the West this pattern has often been basically informed by a military model (although it is a caricature to say that one became a "soldier for Christ," and that one joined the "Christian army," these images did seem to be present in the popular imagination of recent generations of religious). This narrowly Christological focus in turn often led to a linear and patriarchal institutional structure within which the individual must fit him-self or herself. This model also left no real room for the Holy Spirit and pneumatology because these tend to disrupt the structures (rules, consti-tutions,. traditions, and so forth) which are the source and focus of unity. In this scheme, then, unity was often equated with conformity to a set and impersonal pattern of common life. The main problem with this model is that it generally leads to one of two understandings of community and communal life, both of which are based on the assumption that there is some "thing" out there called a community that exists apart from the people that make it up. There is, for instance, a Dominican Order out there that somehow exists apart from Dominicans. This ultimately leads to understanding the community as be-ing fundamentally impersonal (which seems self-contradictory). This un-derstanding of community manifests itself in two basic forms, both of which I believe can be described in trinitarian terms. On the one hand, there is a kind of Modalism where each member of the community is just a projection of the whole group. Here each member is really interchange-able with any other member. Personal identity is subsumed in the whole so that my individual personality needs to be altered and re-formed so as to project the image of the whole. Secondly, the term Quaternity can be used to describe an understanding of community where each person A Trinitarian Model of Religious Life is seen to be a distinct member of the community, but there is always something more behind these called "the community." The community is some thing out there which each member, and all of the members as a whole, only represent but never fully embody. Religious Community Based on the Social Trinity Model Like its trinitarian paradigm, this understanding of religious commu-nity begins with the persons, and comes to understand their unity as that of persons sharing a vital identity of life based on mutual self-donation and shared vision. So the source of unity is love and its manifestation is the interpersonal bonding of the members. Although common struc-tures and institutions will arise from this unity to support it, they are not identical to this unity nor are they its source, starting point, or founda-tion. The actual starting point of this model is an understanding of per-sons as ecstatic beings who are most fully persons when they donate them-selves fully to the other in interpersonal relationships. In this sense per-sons can and do exist in one another~dwell in one another--in a way analogous to the way in which the persons of the Trinity mutually inex-ist. So this new model demands that community be understood in radi-cally personal and social terms. This approach effectively means that there is no "thing" out there called community that is essential and un-changeable and is unaffected by the persons who make it up. So there is, for instance, no Dominican order or community out there that exists apart from Dominicans. A consequence of this is that what a community is, or what the Dominican order is, is always changing and developing to some extent. The community is always dependent on the persons that make it up. So the community is always identified with the personal ex-perience of it. Although the community is always changing and developing with the people involved, it should always grow and develop along certain lines or patterns. This is because an essential part of the vital identity of the community will be an apprehension of and a resonance with the identity of the founder and the habitual tendency to live this out concretely over time. Those in community must interiorize this identity, and come to share it in common, as well as be familiar with how this identity has been lived out concretely in its shared history. Nevertheless, the present com-munity must never blindly follow one single concretization, or absolu-tize any past communal manifestation of this identity. The difference between this. and the older Christological model is that this model is profoundly pneumatological. Here to follow Christ Review for Religious, January-February 1990 means, first of all, to take on the mind of Christ, and this in turn means to be radically open to the Holy Spirit and the newness of mind that this entails. Taking on this mind leads to a radical personalization because it calls one to complete trust in the Father--which frees each person to be truly open and vulnerable to others. This mind also causes one to re-alize that mutual inexistence is not something one chooses, but is the very pattern and foundation of life (which one can choose to ignore). Be-cause the Holy Spirit is the ultimate personalizing principle, even within the Godhead, we see that the Spirit is the foundation of community.5 All of the above implies that the fundamental starting point for re-ligious community is conversion. The absolute need for the type of con-version process that allows us to take on the mind of Christ is obvious. Community is not possible without the orientation, transvaluation, and radical personalization of both initial and ongoing religious conversion. Any model of community that is not premised on both the initial and on-going need for conversion and repentance is inadequate. Community is not then finally some thing we can do; it is a gift we are given and can only receive. It is also not something we ever have as a finished product or achievement; its fulfillment always lies in the future, though the seeds of this future are already present. So these pneuma-based communities are inherently eschatological communities in that they point to and an-ticipate the fullness of communion in the future. Differences between the Old and New Models in Four Key Areas I) Formation Formation in the Old Model often meant re-formation. It often in-volved taking a person and changing him or her into a certain type of person who acted in a particular way and had a particular mind-set. For-mation in practice was usually indoctrination and incorporation into an institution. So there was a process set up that should end at a certain point with a certain type of predetermined character who could function within a defined system of life. The model of formation was most often seen to be military "boot camp," and the primary method of formation was sensory deprivation and incarceration. Under the New Model, formation would refer more-to the whole group than to the individual person. This is because with each new per-son that enters.the group, the group must re-form, as it were, and estab-lish a new unity. The model for individuals would actually be incorpo-ration, but not incorporation into a preexisting and unchangeable struc-ture. Rather, the process would be one of being drawn into a conscious A Trinitarian Model of Religious Life / 99 union of persons that entails individual and group conversion. It is a proc-ess of growth in desire and ability to donate oneself to a certain group of people, and for the group to accept and relate personally to the new person, hence redefining itself in terms of that person. The model for for-mation here would be more like the RCIA. It is a dynamic process of conversion and incorporation that challenges both the individual and the community to come to a new understanding of and commitment to oth-ers. Initial formation in a strict sense would include a process of coming to know the vital identity of the preexisting group by coming to know the identity and vision of the founder and interiorizing this vision in a way that causes the person to make decisions that in turn forms his or her character. In other words, there is a sense of taking on a new iden-tity, but this identity is always personal, and builds on the character, per-sonality, and experience of the person. It is neither a process of becom-ing someone wholly different from oneself, nor the same as others; it is coming to a fullness of autonomy and unique identity. It is a process of becoming who the person truly is. It is only this process that can facili-tate Christian community, because self-donation is ultimately based on the fullness of autonomy, not the lack of it. lrI) Vows In the Old Model the vows were generally understood to be explicit commitments to live out a certain pattern of life: This pattern was often based on the narrow, military sense of following Christ that I have al-ready mentioned. The vows were then defined as being those elements that were necessary to maintain a cohesive and successful group identity and purpose. Obedience, therefore, was often the primary vow (for Dominicans it was the only vow), and was understood in the military sense of accept-ing a certain authority structure and chain of command. How one related to the community as a whole. The authority structure tended to take the place of interpersonal responsibility to the community---following orders from legitimate authority, no matter how half-heartedly and passively, was seen to be obedience. Poverty was the commitment to be materially dependent on the whole group, and to accept the priority of the corporate needs over one's own. So one could not own anything personally (that is, neither personal bank accounts nor independent financial resources), although one might have the use of things based on need. Furthermore, this vow was gener-ally regarded as applying only to the individual's obligation in regard to Review for Religious, January-February 1990 material goods, although it was occasionally seen to impinge on the ma-terial wealth of the community as a whole. Celibacy had both a moral and an institutional basis. It was, there-fore, seen as the obligation to abstain from all sexual activity, and to avoid all exclusive relationships so as to avoid scandal to the group's repu-tation and to insure cohesive institutional structures. In the New Model there will always be two aspects to any vow: how it affects and is part of the life of the community as a whole; and how it affects and directs the life of the individual. It is important to see that the vows are primarily commitments to a certain style of life and to cer-tain values and priorities made by the whole community. The individ-ual's vows, then, are the taking on of these group commitments, and mak-ing personal decisions to facilitate these. So when the individual makes vows, she or he is vowing to enter fully into the vows of the whole com-munity, and making a commitment to come to see one's own identity in terms of the others. In one sense there is only one vow, namely the community's vow to enter into an obediential relationship to the Father after the example of Jesus, based on an unconditional trust in the providential care of the Father. This vow then will be most clearly manifest in the community's commitment to poverty. Obedience in this model is first and foremost trust in God. But be-cause of this it is experienced as a trust in and openness to the whole com-munity. In this sense, obedience means essentially "to listen" (from the Latin root), and is most fully expressed by the term integrity. For the in-dividual this means that one make the community the priority in one's life, and, therefore, the person should grow, develop, and make deci-sions in true dialogue with the whole community. It means that each per-son forms and informs his or her life by the interpersonal relationships that are experienced as community. As a group, obedience is the commitment to never let institutional structures pass for common life or take the place of true listening, dis-cernment, and consensus building. In other words, it is the commitment to an ongoing and interpersonal dialogue, which is a group commitment, out of love, to live with a certain amount of ambiguity and tension in their lives, even at the expense of efficiency and cohesiveness. The com-munity and the individual fundamentally commit themselves to be open to the Spirit, and to be fully charismatic in the truest sense. Rigid con-formity, mediocre efforts, institutional paralysis, unimaginative and un-creative problem solving, and impersonal decision-making would all be Seen as violations of this vow. Poverty is seen by the whole community as the test and sign of its A Trinitarian Model of Religious Life unconditional trust in God. This vow is based on the assumption that the radical sharing of worldly goods is the fundamental and practical test of both the individual's and community's faith. So this vow on the part of the individual is the commitment to a complete sharing of wealth and re-sources with the others in the community and with those outside of it. It is a vow to hold nothing back. Furthermore, it is the commitment to work, not so that one may accumulate wealth or find personal gratifica-tion, but so that through work one may share with others, and produce fruits to share with others. On the part of the group, poverty is likewise a commitment to a radi-cal form of hospitality that excludes no one in principle, and where pri-ority for sharing is based on need. It also means that the whole commu-nity will work as a way of sharing, and so that it will have something to share. Group "navel-gazing" that does not end in service, wasting money and service on those who do not need it, over-planning for the future security of the group, spending money for services that the group could perform for themselves, and an inability to let go of past successes are all violations of this vow. Celibacy is the vow that facilitates the radical self-donation of one-self to a number of other people, so it is first of all the vow to give one-self fully and personally to the others in the community. As such, it nec-essarily requires that the person forego any fundamentally exclusive re-lationships and the types of physical intimacy that are proper to these. This does not mean a denial of intimacy, affection, and personal rela-tionship-- one is actually committed to these in self-donation--but one chooses to find these and enter into these within the context of commu-nity. This then is the central predisposition of the trinitarian model of com-munity: the choice to seek interpersonal fulfillment in a non-exclusive but fully intense way through community with others. As a community this vow is the commitment of the whole to each person, and to the extension of hospitality to include a personal open-ness to all. So it is a commitment to be inclusive communities that offer human relationship unconditionally to all. Simply living together with a "boarding-house" mentality, refusing to reach out to and even chal-lenge the alcoholic or any dysfunctional member, passive-aggressive be-havior, and remaining separate and distant from people outside of the com-munity would all be violations of this vow. III) Common Life and Institutional Structures As alluded to earlier, in the New Model common aspects of the com-munity life (prayer, study, various practices, and so forth) and the un-derlying institutional structures which support these (constitutions, rules, 39 / Review for Religious, January-February 1990 authority structures, government apparatus) are not equivalent to the com-munity, but arise out of it and are meant to serve it. So no elements of the common life are absolute and unchangeable in principle. It is impor-tant to point out, however, that although the institutional structures in the New Model are fluid and open to change, there are some things that they must necessarily exclude. Leadership in this model of community is always a service to the whole that is exercised cautiously and humbly. Any authority structure within the community, therefore, must begin with an unequivocal rejection of a worldly view of power, particularly those models that arise out of a militaristic worldview. Furthermore, there can be no caste systems in community life--seniority, clericalism, and elitism are all worldly views of power. Everyone who has made an explicit commitment to the community has an equal share in and respon-sibility to the common life. So authority structures must always reflect this reality, and must always be open to revision and challenge. In both models the greatest threat to unity is dissent. In the Old Model, dissent was usually seen in impersonal terms, as in dissent from some aspect of common life. To disagree with a superior, to not observe a certain practice, or to disregard a certain law were all acts that were understood to be disunifying. The key in this model then was to mini-mize dissent by insisting on complete, even mindless, conformity on a very practical level to a certain core of ideas and practices. In the New Model dissent is seen in more personal terms as a break-down of the interpersonal bonding and as dysfunctionality. The main source of dissent is the attitudes of persons within the group towards one another. This type of dissent will often hide behind superficial agreement or conformity, but operates at a deeper level to poison relationships and undermine unity. The approach here though is to confront dissent as part of the ongoing need for conversion and repentance for the whole com-munity. This highlights then the absolute need for consent in this model, and particularly for an ongoing process of building consent or consen-sus. So the main emphasis is not minimizing dissent, it is maximizing consensus, which in turn requires that the community be willing to con-front and challenge dissent in a personal and constructive way. IV) Mission and Ministry In the Old Model mission and ministry were the primary focus of re-ligious life in general, and of one's individual vocation in particular. Com-munity, then, had a secondary role and was seen essentially as a means of facilitating mission. The dominant understanding of vocation was that one was called to a certain mission (namely to follow Jesus), and so one A Trinitarian Model of Religious Life / 33 was called to do certain things. One then was to choose a lifestyle that best accommodated and supported what it was that one wanted to do. One chose a community because it best enabled the work that one wanted to do. So community was formed for a certain reason or purpose, namely, because it was the most efficient and practical means to share resources, pool talents, and consolidate authority in order to get a cer-tain mission accomplished. The vows of celibacy and poverty, for in-stance, were often seen in this light: community made possible the kind of work one wanted to do. So this model generally understood mission in an individualistic sense, and mainly valued community for its func-tional role. In the New Model one does not live in community to facilitate work or mission; one lives in community and, therefore, can work and be sent on mission. Community is always primary and chosen for its own sake. Community is chosen because of the people involved; it is the decision to share one's life in a particular way with others. Here the trinitarian emphasis of this model is most helpful. The Trin-ity does not come together in order to create and go on mission. It is in-stead just because of the radical unity and self-donation of the persons to one another that they can create and be sent. The missions of Jesus and the Holy Spirit are the models here. Missions always reveal some-thing about the senders, and what the Son and Holy Spirit communicate simply is their shared life with the Father. It is precisely their shared life that they invite us into. In other words, the senders are essential; there is no mission without being sent. So it is because one lives in community, and because of the graced transformation of experience that this entails, that one feels empowered to go out. And what is shared when one is "out" is precisely the fruits of the common life. Because the Christian community is by nature a char-ismatic community, there are a variety of gifts to be shared. Furthermore, each community, because of its shared vital identity with a particular foun-der, will have a particular charism which both grows out of and shapes the development of the community life. It is then the radical self-donation conversion that sends a person out. So through conversion each person is always moving into wider circles of community. The religious community is in turn sent by the wider Christian community, and so it has a message and a mission also. Under this model, community is experientially prior to mission, and is in fact its source. In the actual life of the community, however, both will be mutually dependent and interrelated. In this sense though, very 34 / Review for Religious, January-February 1990 individualistic types of spirituality, even those that allow for some form of community, are called into question. In regard to vocation, this means that one's vocation is primarily understood as taking on the mind of Christ and thereby coming into contact with the life of God within one, and of being called by this realization into relationship with others in a new way. In the context of this new relationship one is sent out to oth-ers. The point is that for those who choose to live in religious commu-nity it is community itself which is the vocation--it is the call. The spe-cific mission or function that one takes on within this context is really the call of or from the community. This call is the claim that members of the community have on one another by virtue of their mutual self-donation. This raises the question of the place of ordination within the reli-gious community. In the Old Model a specific type of work was often seen as the primary vocation, and, therefore, the community was there to support and enhance ordination. The levels of participation within the community were generally based upon the work one did, and so the or-dained occupied a higher level in the communal structure. So ordination tended to be divisive and obscured the priority of the communal life. In the New Model interpersonal relationships are primary. The vo-cation of the religious is to community, and it is primarily the commu-nity as a whole that is sacramental. It is the community which sends the person to do a particular type of work or to function in a particular ca-pacity. Ordination, then, comes from the community and is based both on the needs which the community perceives and on the gifts of the in-dividuals within the community. Ordination, however, is not the indi-vidual's sole possession; it is proper to the whole community and is dele-gated to one or another member as circumstances require. Furthermore, ordination can never be divisive; it can never change one's status within the community; it can only change one's function. Conclusion Those who look upon God as a metaphysical monad flee society to dwell alone with the Alone. [but] those who look upon the reality of God as the perfection of interpersonal communion will discover the divine in community.6 Our vision and image of God is ultimately the matrix around which we shape our lives. Who we are and how others experience us says more about the God we believe in than all the theological discourse we can of-fer. When confronting the challenge, therefore, of redefining our lives A Trinitarian Model of Religious Life so as to be prophetic witnesses to the gospel, the most fundamental ques-tion we must ask ourselves is, "Who is our God?" Likewise, when we truly come to know this God the primary question we must ask is not "What ought I do?" It is instead "Who ought we be?" NOTES J Robert Bellah et al, Habits of the Heart: Individualism and Commitment in Ameri-can Life (Berkeley and Los Angeles: University of California Press, 1985). 2 For a more detailed discussion of the development of trinitarian doctrine see par-ticularly Jurgen Moltmann, The Trinity and the Kingdom (San Francisco: Harper & Row Publishers, 1981); Robert Jenson, The Triune Identity (Philadelphia: Fortress Press, 1982); and Donald Gelpi, S.J., The Divine Mother: A Trinitarian Theology of the Holy Spirit (Lanham: University of America Press, 1984). 3 Gelpi, op. cit., pp. 13 ! - 132. 4 Moltmann, op. cit., pp. 174-176; Gelpi, op. cit., p. 132. 5 For a further discussion on the role of the Holy Spirit in the Godhead see Gelpi, op. cit., particularly chapter 3. 6 lbid, p. 140. In-Depth Wisdom A tree climbs to the heights because of roots concealed; Waves break in beauty on the shores for there are depths unseen; Mountains rise in loveliness on rock, set fold on fold; Lest we forget as we grow old. Philomena Mary, S.N.J.M. 1420 Mount Royal Blvd. Outremont, Quebec, Canada H2V 2J2 Community--- A Multi-Dimensional Reality Jeanne Knoerle, S.P. Sister Jeanne Knoerle, S.P., is identified with Woods Associates, consultants to non-profit organizations in strategic planning, management, and marketing. Her address is Saint Mary-of-the-Woods; Indiana 47876. Several bits and pieces of experience have coalesced recently to tempo-rarily part some of the mists shrouding my understanding of the word and the reality of community within a religious congregation. They have con-tributed for me what our old Rational Psychology professor, Father McGinnis, would call an "intellectual aha," and I would like to share them. The first piece of experience contributing to this "aha" has grown from my confusion and unclarity about what it means to be a woman re-ligious, committed to a life lived in community. This is not a recent con-fusion. It has been with me (and I know with many others) for some years and is an ambiguity and tension that has been alternately energiz-ing and creative as well as enervating and destructive. So much so that I have come to see the word "community" as representing a reality with so many possible understandings and so many modalities of expression that it has become almost useless as a representation of a concept. Often a group of religious tries to get at its meaning by eliminating all the things it apparently is not--physical things like sharing a com-mon dwelling, sharing common work, doing things together--hoping that in identifying what it is not, they will more easily be able to move to a definition of what it is. When the group does move to trying to define what it is, they often identify it as an invisible bond which ties a group of people together 36 Community---A Multi-Dimensional Reality around shared values, seeing it as expressed not so much in physical to-getherness but in commonness of purpose, in a shared history, in a be-lief in a common tradition. In reality, however, what I find myself doing most of the time is vac-illating between those two extremes, momentarily satisfied but never fully at peace with either. One seems too dependent on a narrow con-ception which can be counted and measured and made explicit. The other seems too vague and unclear, susceptible of such a wide range of inter-pretation as to offer no possibility of an objective, shared reality. I come away with a sense that each of those extremes offers a piece of the truth, an insight into the constantly shifting dynamics of community, but that ultimately there must be some other, fuller definition that incorporates some aspects of each of them. A second bit of experience which led to these reflections has come from my further study of the Enneagram, a personality theory which iden-tifies three interior centers from which individuals draw their energy to cope with the realities of their life. These centers--the head or percep-tual center, the heart or relational center, and the gut or instinctual cen-ter- are each operative within every individual, and are each important to the development of the total human person.Yet each of us comes to favor using one of them over the other two, drawing from it the primary energy for our response to life. Dealing more deeply with this system and how it operates within the life of individuals has enabled me to more effectively step aside and ob-serve the patterns of my own and others' attitude toward life. It has given me a sense of understanding, tolerance, and acceptance of behavior that earlier I had been confused about and often judgmental of. And it has enabled me to see more clearly patterns in the motivations of individu-als and groups where before I had focused primarily on disparate actions. A major spin-off has been to provide me with a more coherent un-derstanding of the wide variations in the ways in which members of a religious community see and respond to the same stimuli. That people responded very differently was surely evident in the past. There were those who thoroughly enjoyed and anticipated the challenge of study in the summer, and those who dreaded the vei'y thought of summertime be-cause it meant they had to study. There were those who loved to volun-teer for infirmary duties and those who hated to. Those who loved most to party, and those who loved most to pray. Why they did so and why I personally responded in the way I did was not so clear. Because the Enneagram is a system built on trying to Review for Religious, January-February 1990 understand the constantly shifting dynamics of the human personality, the answers it provides to "why" we act the way we do are neither sim-ple nor clear-cut, but they do at least provide an overall pattern against which to make some judgment. The third piece of experience I bring to this moment comes from the variety of reading in theology, ecclesiology, and ethics that I have re-cently undertaken, but especially from Avery Dulles' recent book The Reshaping of Catholicism. Father Dulles' book helped to put some, though by no means all, of my frustrations into perspective. It helped sort out and clarify the mean-ing of many of the concepts and experiences which have been so much a part of Catholicism since Vatican II. But the particular insight he presented which connects to the chal-lenge I described earlier, that of defining community, I found in his chap-ter on the Extraordinary Synod of i 985. There, in explaining the themes which emerged from that synod and which were incorporated into its pub-lished Report, Dulles described three schools of thought which existed among the delegates: the neo-Augustinian school which tended to depict the Church as an island of grace in a world given over to sin; the com-munitarian school which tended to depict the Church as the human face of God on earth, in trouble now because of the failure of conservative prelates to carry out the reforms of Vatican II; and the liberation school which depicted the Church as in possession of the wisdom of God and which, therefore, must be politically involved if it is to carry out the work of the kingdom. The neo-Augustinians, putting their accent on worship and holiness, wanted a Church more committed to the cultivation of spiritual union with God. The communitarians, putting their accent on more humanis-tic issues, wanted a Church more involved in the promotion of peace and reconciliation. The liberationists, sharing neither the sacralism of the Augustinians nor the secular optimism of the communitarians, wanted a Church that was confrontational and militant. The Synod dealt with these three points of view, but the commitment of the drafters of the document was not to a presentation of varying points of view and to a clear identification of their points of disagree-ment. Rather the emphasis was on integration, on interrelationship, on allowing the variety of colors to be mixed together on the canvas like a Monet painting, rather than to be identified separately like a rainbow. Therefore, the final Report incorporated concerns of all of these groups, but with none clearly in the ascendance. Community--A Multi-Dimensional Reality/39 Dulles quotes the following marvelous sentence, artfully crafted to incorporate the ultimate wholeness which grew from the conflicting worldviews of all of those schools: "The Church as communion is the sacrament for the salvation of the world." It was that discussion about the schools of thought that existed in the Synod, and especially that sentence which seemed so beautifully to cre-ate a whole out of three disparate expressions of the truth, which began to push a pattern more insistently into the forefront of my mind. While the community of a gathering of bishops and the community of a religious congregation are certainly very different entities, and in many ways are not analagous, they do share the reality of being a group of people in relationship to one another, who share a common purpose, a common mission, and a common tradition. Theirs is a more ephem-eral relationship--they are not together often, nor with regularity, nor as a group do they have a specific, ongoing common task beyond the one they are presently fulfilling, though they do share the general task of mak-ing the word of God present in the world through their work as bishops. Nonetheless, it seems to me we can see the conflictual issues of com-munity mirrored fairly clearly in the three schools of thought which ex-isted at the Synod and which were so clearly delineated by Father Dul-les. And those schools fit with a fair amount of cohesion into the three types of centers which are basic to the theory of the Enneagram. The neo-Augustinians, like those approaching life from the head cen-ter, tend to approach things perceptually, more frequently using their in-tellect and their powers of observation to solve the problems of life, be-ing less intensely involved than those in the other centers. Hence they more clearly see the other-worldly aspects of religious life and feel less pressure to commit the community to becoming involved in the concerns of the world, and more pressure to see that it retains its sense of being an effective instrument of salvation. The communitarians, like those approaching life from the heart cen-ter, tend to approach things from the point of view of relationships, con-cerned always with how they relate to others and how others relate to one another. Without a sense of relationship they have difficulty feeling the life in them, and are, therefore, much more concerned with the world outside them than with the world within them. Hence they focus most comfortably on the human aspects of the work of the community. The liberationists, on the other hand, like those approaching life from the gut center, have an instinctual feeling about the World; they have a kind of built-in sense of knowing, the source of which is not al- 40 / Review for Religious, January-Februao, 1990 ways clear, but the force of which is powerful. Hence they have a strong belief in the responsibility of the community to bring justice into the world, to use its resources and its life to make the world more right. Let me use myself as an example. As a person whose energy comes from the heart or relational center, I am most comfortable in the com-munitarian school, concerned with how we as members of a community can better relate to one another and how our religious community can best help other human beings be better, holier, happier, more complete persons. During the last few years I have begun gradually to integrate some of the rico-Augustinian or perceptual worldview more fully into my own, however. Becoming concerned that I had put too much emphasis on the outer world of action, I have consciously attempted to develop the inner, more spiritual aspects of my person. And now I sense in-creased energy emanating from the head center as well. Where I feel least comfortable, however, is in the liberation school. I know intellectually that to become fully integrated I must learn to trust (perhaps even more fundamentally to get in touch with) my instincts. I know I must learn that to touch and release my anger will not interfere with my relationships. I know I must be better able to integrate and act out of my instinctual center, as I have begun to integrate and act out of my perceptual center. Yet I find this center most out of my range of ex-perience and significantly harder to reach. I think each of us--whatever our approach to life--has the same strug-gle. If we want to become more personally integrated, if we want ulti-mately to create a more mature community, we must perceive, then tol-erate, then understand, then fully accept the differing approaches to life which result from using the energy of each of these centers. We must attempt to identify what worldview is ours and, without imposing it as the best and only one, contribute that piece of truth to the Monet canvas of community. But we must also acknowledge what piece of truth we find hardest to accept and struggle to incorporate it more fully into our view of reality. We must acknowledge, if we operate as neo-Augustinians from the head of perceptual center, our discomfort level when the community seems to over-stress a commitmeni to human development, leaving the spiritual aspect of our lives unstressed. We must acknowledge, if we operate as communitarians from the heart or relational center, our discomfort level when we are asked to ap-prove the taking of a community stand, thereby moving to publicly sepa-rate us from others rather than to positively underscore the bonds which Community--A Multi-Dimensional Reality draw human beings together. We must acknowledge, if we operate as iiberationists from the gut or instinctual center, our discomfort level when the community stresses the eschatological, the importance of the kingdom of heaven and the life of the other world, rather than the impor!ance of confronting the evil in this world and the need to see that justice is accomplished in the present. In each case, however, if community is to mirror the full dimensions of our humanness, we must acknowledge that each approach to life does have a piece of the truth. And we must be willing to contribute our own piece of the truth, holding on to it and placing it on the canvas. Then stand back to see the full picture which we have helped to create, accept-ing the contribution of the other truths as well as our own to that full-ness. Developing the fullness of that picture is what community is all about. And since, perhaps more than at any other time in history, com-munity is a concept that is ambiguous, even anomalous, we must be will-ing, as the drafters of the synod document were of the concept of Church, to seek among us a creative and dynamic peace about how we perceive and live it. As we now live in religious communities, however,, it seems to me that we too often speak the words of power than of peace. We fail to en-ter the world of those with whom we share the reality of community, talk-ing too often instead from the protection of our own shell, not really hear-ing, not really understanding the words of those who speak from another worldview. Our primary goal is too often the imposition of our own. Let me return to the initial insight which prompted these reflections-- that the word community has come to mean so many things that it has become almost useless as the representation of a concept. I would like now to modify that insight somewhat to say rather that community is a such multifaceted concept that it can only be captured by allowing its defi-nition to be pluriform. It is perhaps most analagous, not to a Monet paint-ing, but to a hologram---offering only one specific facet to the eyes of the viewer at a given time, yet only complete When seen in its full three dimensions. Perhaps if we can come 'to see our third of the truth reflected in that hologram, together with the other dimensions of the truth we less clearly identify with, we can better allow ourselves to say yes to the varying ex-pressions of community. And at the same time we can come to agree-ment that no one expression is sufficient for the whole. To begin this process, we need to name and claim our own 49 / Review for Religious, January-February 1990 worldview, so that it becomes objectified and clear. Then we need to hear others name theirs, and accept the authenticity of their vision as well as ours. Only then can we proceed. For example, from my relational center, from my communitarian worldview, some physical togetherness, some living or working or be-ing together, seems to me to be clearly implicit in the very word com-munity. I have difficulty understanding the more ethereal co.ncept of com-munity which is sometimes outlined in the perceptual or neo-Augus~inian view--that community is a form of bondedness which need not be ex-pressed in our being i.ogether, but rather in our somehow feeling that we are together. And I have even greater difficulty with the instinctual or liberationist concept of community as being strengthened by being against something or someone else. That simply is how I perceive community. It does not mean that I believe I hold the only truth about it. It does not negate other concepts or understandings of community. It simply means that if we ultimately define community without including some aspect ofphysical together-ness I will have little ability to relate to that definition, nowhere to hang on to it. It will not fit within my worldview. I need to correct the narrowness of my vision, not by letting go of it, not by some grand gesture of surrender or denial which will ultimately lead to my feeling at the margins of community or, even worse, alien-ated from it. I need to proffer my piece of truth and then seek to broaden my vision and deepen my understanding of community by seriously study-ing the truths offered by others, ultimately respecting their view of real-ity as much as I respect my own. If we were all to do that in mutual respect for each other's view of what community is, while the resulting hologram of community might not be totally satisfying to any one of us, it could instead offer us a rich and full opportunity to explore and live out its multifaceted reality dur-ing the rest of our lives. Dyads and Triads: The Sociological Implications of Small-Group Living Arrangements Patricia Wittberg, S.C. Sister Patricia Wittberg, S.C., is an Assistant Professor in the Department of Soci-ology and Anthropolgy at Fordham University. Her address is Department of Soci-ology and Anthropology; Fordham University; Bronx, New York 10458. As the number of active members in religious congregations becomes smaller, and as these members become involved in more varied and dis-persed ministries, it is increasingly common to find religious living sin-gly or in groups of two or three. While the personal.and communal im-plications of individuals living alone have been examined to some ex-tent,~ the special social dynamics of pairs and other very small groups have been less frequently considered. Usually, groups of religious larger than one but smaller then eight or ten are treated together under the head-ing "small group living," with little consideration for the special char-acteristics which groups of two or three might have. It would, however, be a valuable exercise to examine these special characteristics, since the recent experience of many congregations has uncovered regular patterns in them. Some "pair" living arrangements--or dyads, as they are also called--have remained stable for years or even decades within a congre-gation, resisting the efforts of community leaders or of the dyadic pair themselves to add a third person. Conversely, groups of three religious (triads) are often unstable, repeatedly splitting into pair and a singleton. The stability of pair members or the frequent group-switching of thirds have sometimes been attributed by others to unhealthy tendencies in the individuals involved--immaturity, perhaps, or excessive dependency. So- 43 44/Review for Religious, January-February 1990 ciologists, however, have found that it is often the mere fact of belong-ing to a group of a given size that elicits certain behaviors from an indi-vidual, independently of his or her personal psychological character-istics. This article will summarize the writings of the German sociolo-gist Georg Simmel on the characteristics of dyads and triads, and will draw some tentative implications of these studies for religious who live in small groups. It is important to emphasize that Simmel viewed his work on the nu-merical composition of groups to be a sort of "geometry of human rela-tions." Just as the properties of a circle or a triangle remain constant whether the actual figure is made of paper or of wood, so the social dy-namics of dyads and triads are inherent in themselves, Simmel thought, regardless of the individuals involved. It is, of course, possible that the members of a particular dyad or triad can disregard the tendencies at-tached to number, especially if they are aware of them. It is also possi-ble that a common ideological commitment, such as the vows in relig-ious life, may override the effects of a given number, to some extent. But the underlying dynamics will still exist, and will result in certain com-mon patterns when many groups are examined. The Dyad A dyad, Simmel stated, is different from all other groups, in that, while outsiders may see it as a unit, from the inside each member sees only the other person, and not a supra-individual collectivity.2 If either individual should leave, the dyad would cease to exist. Each member thus feels herself and her partner to be indispensable, since "for its life the dyad needs both; for its death only one.''3 The dyad is, therefore, more conscious of the possibility of group dissolution, and feels "both endangered and irreplaceable." Dyadic relations are also characterized by greater intimacy than larger groups--it is the uniqueness of these two particular individuals that gives the dyad its special flavor and which can often become "the core value and chief matter of its existence."4 Since only one other.individual besides oneself composes a dyad, the group "does not attain that super-personal life" which the individual feels to be independent of his presence and participation.5 Dyad mem-bers are unable to delegate responsibility to "the group," to expect things from "the group," or to let "the group" get away with some-thing. In a larger group, by contrast, an individual may fail to develop ownership of group decisions, or may passively benefit from her mem-bership with a minimum of personal contributions. Dyads and Triads Dyadic Living Relationships in Religious Life There are both positive and negative implications of the dynamics of dyadic relationships in religious life. On the positive side, dyadic liv-ing encourages the personal assumption of responsibility for the quality of group living. If the house i~ dirty or if common prayer is neglected, there is no one to blame but oneself and one other individual. Dyadic living has also been a fruitful way for religious to develop their ability to achieve intimacy and individual growth,6 psychological capacities that were often stunted in the large institutional living arrangements of for-mer decades. Other aspects of dyadic interactions, however, have at least the potential for negative effects--both for the congregation as well as for the individuals involved. Since the departure of either member de-stroys a dyad, an individual religious living in such an arrangement may have to do a sort of "dual discernment" when considering a ministerial change: taking into consideration both whether it is time for himself to move on as well as whether it is a good time for his dyadic partner to have to find a new living arrangement. For this reason, dyads tend to be the most stable of small groups. Since stability, uniqueness, and intimacy are inherent in the dyadic form, the individuals living in dyads may not necessarily have psycho-logically unhealthy traits, even if they remain together longer than out-siders would deem wise. For those who do have such traits, however, dyadic living will exacerbate them. Furthermore, a mutual dependency may develop within the dyad over time, even if none existed initially. For dyad members who are or have become excessively dependent on each other, dissolution of the dyad (by death or serious illness, for ex-ample) will cause intense psychological distress. There is also evidence that dyadic living can be detrimental to the larger congregation. This is true whether the congregation is following the traditional "intentional community" model or one of the newer as-sociational forms. In an intentional community, members are bound to-gether by a common religious ideology which encourages the subordi-nation, at least in some key instances, of the individual to the larger group.7 Previous research on intentional communities has shown that dy-adic attachments often erode this group loyalty, which is the essential foundation of the communal lifestyle.8 For this reason, successful inten-tional communities have always included some mechanism either to elimi-nate dyads or to subordinate them. Sometimes the suppression of dyads has been heavy-handed and psychologically destructive, as in the at-tempts to eliminate "particular friendships" in pre-Vatican II religious 46 / Review for Religious, January-February 1990 life, and at times it has led to unusual patterns such as the forced adop-tion of "group marriage" in the Oneida community. By whatever means, however, no intentional community has ever survived that has allowed dyadic attachment to develop unhindered.9 Many religious congregations, of course, have discarded the inten-tional community model and have adopted a looser form of association. One such model which has been recently advanced is that of "mission" as the uniting principle behind a community. Religious may live and work in widely scattered situations and yet still consider themselves bound together by the shared missionary vision of their founder: Community is not the living situation. It is not all going to Great Amer-ica together, it is not dressing alike, and it is not working in the same facility. Community is the result of our bondedness around a common mission, Christ's mission, the kingdom, according to the spirit and charism of our founder or foundress as experienced in this particular group. ~0 But the very intimacy and uniqueness inherent in the dyad can often eclipse this dedication to mission and attenuate any mission-based bonds to the larger group. If this happens, the dyad will stagnate at the self-absorbed stage which Wombacher says is a danger to those individuals and groups which fail to go outside of themselves in true generative and creative service of others. ~ A dyad that has been extremely stable for a long period of time may make it very difficult for its members to sum-mon the courage to move on. There may be instances where both mem-bers attempt to move together; such endeavors are subject to the same difficulties that married professionals often face in locating two suitable jobs in the same area. This would detract from the mission-bonded con-gregation's ideal of following the leading of the Spirit into the works most needed by the People of God. To the extent that stable dyads form in religious life, therefore, the community--whether a close-knit intentional community or a mission-based association--may be less able to count on the loyalty of its mem-bers. This is especially true since other social mechanisms are simulta-neously conspiring to keep the dyad an exclusive "twosome." The fol-lowing section will consider the addition of third members to a dyad, and the reasons for the instability of this new living arrangement. The Triad There is a qualitative difference between a dyad and a triad; adding a fourth or fifth member to a group does not change it nearly as much Dyads and Triads as adding the third. ~2 For the first time, it becomes possible in a triad for each group member to have two kinds of relationships with the oth-ers: a direct (A~)C) and an indirect (A~)BtbC) one. In a triad, a majority can out vote an individual member, and it becomes possible for the indi-vidual to envision the group existing after her departure. Division be-comes possible among the members: A and B may share some experi-ence, idea, or interest that C does not, while B and C may have some-thing in common that A does not have. This may lead to shifting alli-ances or interest groups, a situation that was impossible in a dyad. Se-crets, too, become possible in triads, and one member may be excluded, to a greater or lesser extent, from group activities. Also, if the original dyadic partners were unequal in some way, adding a third disrupts the subordinate/superordinate relationship---either by increasing the distance between the superordinate and the two subordinates, or by making it pos-sible for the subordinates to combine against the superordinate. Special group roles are also possible in a triad, which could not ex-ist before. Since "there is no triad in which dissent among two of the elements does not occur from time to time," ~3 the third member may be-come a mediator, who can be impartial because she is not involved with either or also is equally involved with both. Another new role is the Ter-tius Gaudens (Rejoicing Third), who profits by maintaining a division between the other two. There are two ways of benefiting from strife among one's fellow members: one can actively pursue some otherwise forbidden interest while the others are preoccupied, or one can passively allow oneself to be showered with gifts as the contending parties com-pete for one's support. To the extent that the tertius has less personally involved in the dispute, he is in a stronger position than the other two, and it may be to his advantage to perpetuate this situation. Finally, the third member may actually employ the tactic of "divide and conquer"-- producing conflict in order to break up an incipient coalition. The dis-ruptive effects of secrets, ~he exclusion of one or another member, re-joicing thirds and divide and conquer tactics mean that, if the dyad is an especially stable group form, the triad is an especially unstable one. Dyads and Triads in Religious Life Because of the inherent dynamics of dyads and triads, two religious living together (and perhaps also working together in a common minis-try) often find it difficult to attract a third person to join them or to re-tain a newcomer who has come, even if they sincerely desire to do so. Initially, this difficulty may not depend on the personalities of the indi-viduals involved, but simply on the disruptive effects of adding a third 411 / Review for Religious, January-February 1990 to any dyad. Over time, however, the members of stable dyads also de-velop habits and customs which make it even harder for an outsider to gain entrance, or to feel comfortable once she has. This situation has ob-vious ministerial--and communal--implications. A given school or par-ish may wish to attract new religious workers, yet otherwise interested applicants may be put off by the prospect of joining a preexisting duo. Congregations whose formation programs involve sending prospective members to live on mission with other religious may have difficulty find-ing a place where the new affiliate is not liable to be excluded (however inadvertently) by a dyad or scandalized by the divisions in a triad. Fi-nally, some individuals may gain an undeserved reputation for being hard to live or work with: if a religious tries and fails to break into several successive dyads, or if two dyad members are repeatedly joined by third persons who move out after one year, others in the congregation may as-cribe their difficulties to personal defects on their part. If the failed at-tempts also involve repeated ministerial changes on the part of the per-son joining the dyad, his professional resum6 may suffer. Rapid turn-over may also be a source of scandal to outsiders--lay parishioners, for example, or parents at a school--if the new religious lives apart from the preceding two. Conclusions As religious congregations enter the last decade of the twentieth cen-tury, they will be increasingly faced by the issues which dyadic and tri-adic living arrangements raise. Some communities may wish to avoid the ministerial inflexibility that excessively stable dyads tend to create. For-mation directors may need actively to work for the preservation of larger living arrangements in order to avoid the necessity of placing a novice in a triad. After the novitiate, temporarily professed may find their tran-sition to full community membership and ministry even more stressful if they have to adjust to life with a preexisting pair. On the other hand, joining a single religious (and thus creating a dyad) may result in the young religious beginning this extremely stable living arrangement at the outset of her community life. If dyadic living tends to attenuate the group loyalty even of long-term members, it is all the more likely to do so in new arrivals. Finally, as the members of a dyad age, congregations may find it necessary to provide counseling services when death or serious illness causes the breakup of a pair that has been together for several dec-ades. The obvious solution to difficulties raised by dyad and triad living is to expand the local community to four or five members. This is not Dyads and Triads always possible, however. For one thing, the decreasing number of ac-tive members makes it likely that most ministerial situations will con-tain only a very few religious. This would be especially true in areas out-side of the large cities in the traditionally Catholic Northeast and Mid-west. The trend toward apartment living also fosters dyads and triads, since four- or five-bedroom apartments are rare. In some congregations, a substantial proportion of the members are already in dyadic living ar-rangements, and the community government may lack the tradition of authority to request or require that these grbupings be dissolved. This being the case, dyad and triad living will probably be unavoid-able in religious communities, at least to some extent. There are, how-ever, positive steps which the members of a congregation can take to ad-dress the issues which such arrangements raise. First of all, the records of a community should be investigated, in order to determine whether the abstract predictions of sociological theory about dyads and triads are, in fact, reflected in this particular congregation. Are the living arrange-ments and ministerial placements more stable thaff they were twenty years ago? What is the average size of living groups within the congre-gation? How long, on the average, have dyads been together? How long have triads? The members of larger groups? Which type of living arrange-ment appears to be increasing in frequency? Which types are decreas-ing?~ 4 Once trends have been identified, a congregation may wish to initi-ate a communal discernment process to determine what the effects of dy-ads and triads have been for its members, and whether these effects are desirable or not. The members of dyads and triads, or members who have once tried to join such a living arrangement, could be surveyed for their opinions and insights. Two- or three-person living arrangements could become a topic for chapter or pre-chapter discussion and debate among all the members, since whatever policies a congregation adopts in this regard would have to be owned by the members affected. Some of the possible follow-up actions to this community discern-ment could include the establishment or enlargement of a specific coun-seling or facilitation program to work with the members involved in dy-ads and triads. Triads may choose to make regular and frequent use of a facilitator--perhaps on a biweekly or monthly basis--to alert them-selves to and to deal with instances of divide and conquer, rejoicing thirds, or exclusive factions that may arise. Newly-formed triads-- especially those formed of a previous dyad and a singleton--would be in particular need of this service. Job counseling and placement services 50 / Review for Religious, January-February 1990 may help the members of dyads decide when to move on, and, of course, extensive counseling services would be needed for long-standing dyad members when, as will inevitably happen, illness, retirement or death dissolves their pair. The members of a congregations may decide to place a limit on the number of years that can be spent in a given dyad. Since most congregations no longer intervene so actively in the lives of their members, however, special commur~ity-wide discernment and input would be necessary before such a step would be accepted and owned, especially by the dyads involved. The congregation's leadership would also have to provide information about alternatives--both in living and in ministry--for any pair of its members who did agree to separate and move on. The physical resources available to a congregation should also be ex-amined in the light of what is learned about dyads and triads in the com-munity. In the past decade or so, for example, many parish convents have been closed and either demolished or converted to other uses. Some of these may have been of an ideal size to house a group of five or six. Congregations may wish to identify the houses of the "right size" which are still available, and make arrangements to purchase them, if they do not already own them. Any new living space which is created-- apartment buildings that may be purchased or built, large-scale quarters attached to hospitals or retirement centers that may be modified-- should be created with the effects of dyads and triads in mind. Finally, creative social arrangements may be devised to maintain ties to the larger community in the members of dyads and triads. If a con-gregation has small discussion groups as part of its government process, dyad members may be assigned to different groups. For those orders still involved largely in teaching, summer ministry or vacation opportunities can be advertised, and dyad members urged to avail themselves of dif-ferent opportunities. Dyads and triads living in the same area may be in-terfaced, and perhaps exchange members for a week or even longer. As congregations begin to explore the implications of living in groups of two and three, other practices will doubtless be devised. These should be shared with other communities. Number is not destiny. No inevitable social laws require that a dyad be excessively stable, or that a triad dissolve in acrimony and misunder-standing. As the members of small groups become aware of the tenden-cies involved in their living arrangements, they may be able, with some help from the larger congregation, to deal with the problems that arise. It is hoped that this article will be a first step in the process by which Dyads and Triads religious communities harness the dynamics of dyads and triads and con-vert them to truly life-giving forces for the religious life of the future. NOTES ~ See Sandra Schneider, New Wineskins:Re-imagining Religious Life Today (New York: Paulist Press, 1986), pp. 252-255. 2 Georg Simmel, The Sociology ofGeorg Simmel, trans. Kurt H. Wolff, (New York: Free Press, 1950), p. 123. 3 lbid, p. 124. '~ lbid, p. 126. 5 Ibid, p. 123. 6 Ibid, p. 137. 7 Patricia Wittberg, "Transformation in Religious Commitment," REVIEW FOR RELm~OUS 1985, Vol. 44, pp. 161-167. 8 Benjamin Zablocki, The Joyful Community (Chicago: University of Chicago Press, 1980), pp. 116-120. 9 Benjamin Zablocki, Alienation and Charisma (New York: Free Press, 1980), p. 289. ~0 Kristin Wombacher O.P., (n.d.) "American Religious Life Since Vatican II: Change and Continuity." Unpublished paper, p. 245. ~ lbid, p. 235. ~2 Simmel, op cit, p. 139. ~3 lbid, p. 148. 14 Please note that this article does not predict that there will be no stable triads in a congregation, merely that these will be relatively few compared to the number of stable dyads. Large, institutional groups of religious may also remain essentially un-changed over the years. This large group stability would be due, however, not to the abstract effects of number, but to the personal inability of the individual mem-bers to move on, whether because of age, psychological inflexibility, or the simple belief that a given congregational work would not survive were they to leave it. Evaluating Religious Community Costs David E. Meier, S.J. Fr. David Meier, S.J., serves as a financial consultor for the Detroit Province of the Society of Jesus. He is also the treasurer of the Jesuit Community at the University of Detroit. His address is Jesuit Community; Lansing-Reilly Hall; University of De-troit; 4001 W. McNichols; Detroit, Michigan 48221-9987. Point of view is a factor in literary evaluation, an element of artistic per-spective, and a determinant of political affiliation. Point of view is equally an essential criterion for determining what is meaningful in any financial assessment. A number of conditions can be identified which affect the financial data being analyzed. Some of these conditions merely color the data, so that a simple new cast of mind, like the addition of a filter on a camera lens, will provide an improved impression. Another condition may be rather like a fun-house mirror, which distorts the data, often so beyond one's normal frame of mind that the data loses all cogency. 1. Point of View--a Perspective When religious superiors are mystified because they do not find mean-ingful comparisons between per member costs of living in their local com-munities, their point of view is frequently at the heart of their mystery. Failure to advert to their perspective is what leads them to ask, "Why can't we get reliable comparisons between the per member costs at St. Agatha and St. Theresa?" Concern for lifestyle quickly introduces estimates for the amounts of money needed for community support under varied assumptions about a standard of living. Often enough the "common sense" expectations 52 Evaluating Religious Community Costs about a reduction in per diems are contradicted in the reality. Later in this article a number of conditions which merely color data will be examined. These should not be allowed to distract religious su-periors from a key condition which actually distorts the data which enter into their decisions. 2. Full CostDMarginai Cost Distinction Religious superiors should be conversant with the economic distinc-tion between full cost and marginal cost. This is the key condition for avoiding distortion in comparing per member costs for various commu-nity sizes. The effect of this distinction is especially significant when deal-ing with small numbers, say three to forty, which is representative of the size of most local religious communities. This distinction brings eco-nomic discernment down from the clouds to the refectory and the com-mon room. Consider, for example, an education community of thirty members which devotes hours of discussion trying to decide whether it is economi-cally preferable to have ten retired members rive apart in a separate com-munity from the twenty active teachers. Another study tries to make economic sense out of establishing a new community for a few retired members in a parish facility which has more room than is needed by the parish personnel. .The approach to these economic determinations will most often be reduced to measuring the per member cost. And here is where the dis-tortion can arise! Are the per member costs to be measured as full cost or marginal cost units? The difference can be of surprising magnitude. 3. Marginal Cost Marginal cost begins at the very edge of full cost. Whatever is the total cost of providing for the housing, food, personal, institutional, and automobile expenses of a 30 member community constitutes the commu

Issue 25.6 of the Review for Religious, 1966. ; Implementation of Vatican II by Paul VI Religious Community and the Primi-tive Church by Thomas Barrosse, A Reflection on Perfectae Caritatis by Gustave.Martelet, S.J. The Family Fallacy by Hilary Smith, O.G.D. Are Teaching Brothers Still Needed? by J. M. R. Tillard, O.P. Devouonal Confession by Dale Olen, O.F.M.Gap. Deepening Vocational Com~nitmen~ by Sister Marian Dolores, S'.:N.J.M. Humility and Pei'~onality by wali' s. S.S. Subli~nation~ by.Sister M. Rosalie, O.P. Religious and Gr~duate!!Studie~ by Michael P. 8heri~n, Blueprint.for Dialogue by Thomas Dubay, S.M. Survey of Roman DoE~uments Views, News, Previews QuesUons and ~nswers Book Reviews Indices for Volume 25, 1966 939' 971 986 1000 1018 1030 1042 1051 1055 1062 1070 1084 1088 ]092 1106 1127 VOLUME 25 N'UM~ER 6 ~Vovember 196~ Notice to Subscribers Because of constantly increasing costs, REVIEW FOR RELIGIOUS finds it necessary to increase the cost of its individual issues as well as of its sub-scriptions. The new rates, effective in 19(37, will be the following: (1) Individual issues of the REVIEW will cost one dollar; this price will apply not only to all issues beginning with 19(37 but also to all previously published issues. (2) Subscriptions in the United States, Canada, and Mexico will cost $5.00 per year; $9.00 for tw9 years. (~) Subscriptions to other countries will cost $5.50 per year; $10.00 for two years. (4) All the above prices are in terms of U.S.A. dollars; accordingly all payments must be made in U.S.A. funds. These prices wilI affect all individual issues sokl on or after January 1, 1967. The new subscription prices will be applicable to all subscriptions-- new and renewed--beginning with the January, 1967, issue of the REvmw. PAUL VI Implementation of Cer-tain Decrees of Vatican Council II The~ postconciliar administration of the Church clearly requires that there be established for the Church's affairs new norms and dispositions which correspond to the requirements of the Council and which are better adapted to the new goals and areas of the apostolate that the work of the Council has brought to the Church's at-tention as existing in the world of our time--a pro-foundly changed world that needs the full glow of light and longs for the supernatural warmth of charity. Because of these considerations, as soon as the Council was finished, We accordingly established study commis-sions to collect, each in its own area, information and to frame a practical program; the purpose of all this was that definite norms might be set down for the implemen-tation of the conciliar decrees which had already been granted a delay from imm. ediate execution. These com-missions, as We wrote with satisfaction in Our motu pro-prio letter, Munus apostolicum, of June 10, 1966, dili-gently occupied themselves with their assigned task; and at the assigned time they made known their findings to Us. After We had attentively considered their findings, We judged that it was now time for the aforementioned norms to be published. Since, however, the'entire mat-ter is one that pertains to discipline, an area to which ek-perience may be able to contribute further suggestions; and since, moreover, a separate commission is engaged in the revision and emendation of the Code Of Canon Law in which all the laws of the Church will be codified to-gether in a fitting, appropriate, and determined way; We * This is a translation of the motu proprio apostolic letter, Ecclesiae sanctae, issued on August 6, 1966; the translation was made [rom the Latin text as given in Osservatore romano, August 13, 1966, pp. 1-3~ 4. 4. 4, Implementation Vatican I1 VOLUME 25, 1966 have thought that it would be wise and prudent for Us to publish these norms for an experimental period. During this interval of time episcopal conferences may communicate to Us any observations and comments which the execution of these norms may convince them should be made; likewise, they can also propose new ideas to Us. Accordingly, after thinking the matter over carefully, on Our own initiative-and by Our apostolic authority, We decree and promulgate the following norms for the implementation of the decrees of the Council beginning with.the words: Christus Dominus (on the pastoral office of bishops in the Church), Presbyterorum ordinis (on the ministry and life of priests), Per[ectae caritatis (on the adaptation and renewal of religious life), and Ad genres divinitus (on the missionary activity of the Church); and We order them to be observed for an ex-perimental period; that is, until the new Code of Canon Law is promulgated unless in the meantime the Apostolic See should provide otherwise. These norms will begin to be effective on October 11, 1966, the Feast of the Motherhood of the Blessed Virgin Mary, the day on which four years ago the Council was solemnly inaugurated by Our predecessor of venerable memory, John XXIII. All the matters determined by Us in this motu proprio letter We order to be fixed and unalterable, all contrary things, even those worthy of very special mention, not-withstanding. Given at Rome at St. Peter's on August 6, 1966, the Feast of the Transfiguration of our Lord Jesus Christ, in the fourth year of Our pontificate. Paul PP. VI ÷ ÷ ÷ Paul REVIEW FOR RELIGIOUS NORMS FOR THE DECREES ON BISHOPS AND ON PRIESTS The episcopal office, which the Second Vatican Coun-cil has clarified in the dogmatic constitution, Lumen gen-tium, and in the decree, Christus Dominus, was divinely established for the building up of the Mystical Body of Christ which is the Church. For this reason these holy pastors must show a perse-vering zeal in the fulfillment of their duty of teaching, sanctifying, and shepherding the People of God. In doing this, they should generously share with the roman pon-tiff the solicitude of all the churches, they should ear-nestly provide for the good administration of the dio-ceses entrusted to them, and finally they should work together for the good of their several churches. In the direction of the dioceses e.ntrusted to them the bishops require helpers and counselors, the first of which are the priests; hence bishops should willingly listen to these latter and even be desirous of consulting ~hem, though in all matters there should always be retained as fixed the bishop's power of acting, freely, of setting up directives and norms, and of enacting laws in accord with his own conscientious concept of his office and with the principles of the government of the Church (see the dog-matic constitution, Lumen gentium~, n. 27). In order, therefore, that the bishops may be able to fulfill their pastoral duty more ea,sily and fittingly and in order that they might translate into practice the prin-ciples solemnly approved by the Council in the decrees, Christus Dominus and Presbyterorum ordinis, the fol-lowing norms are established. Distribution of the Clergy and Assistance to Dioceses (N. 6 of the decree, Christus Dominus, and n. 10 of the decree, Presbyterorum ordinis) 1. If it is deemed opportune, there should be set up at the Apostolic See a special committee the purpose of which will be to provide general ~rinciples for a better distribution of the clergy in the light of the needs of the various churches. ,, 2. It will be the duty of patriarchal synods and of epis-copal conferences, the prescriptionls of the Apostolic See being observed, to enact ordinances and to publish norms for the bishops by which there may be secured a fitting distribution of the clergy coming from their own terri-tory as well as of those coming fr6m other regions. Such a distribution should provide [orl the needs of all the dioceses of a given territory; the welfare of the churches in mission lands and in countries~ with a lack of clergy should also be cared for. Therefore, every episcopal con-ference should establish a commission whose work it will be to investigate the needs of the various dioceses of the territory as well as the possibilities of the dioceses for giving from their own clergy to other dioceses, to put into execution the determinations made and approved by the conferences with regard to the distribution of the clergy, and to convey these determinations to the bishops of the territory. ~ 3. In order that the transfer of clerics from one diocese to another be made easier--the p(actice of incardination and excardination being retame~d though ~n a form adapted to new circumstances--the following prescrip-tions are set down. § 1. Clerics in seminaries shoqld be trained so that they are solicitous not only for ithe diocese for whose service they are ordained but also for the entire Church + + + Implementation o~ Vatican Ii VOLUME 25, 1966 941 Paul VI REVIEW FOR RELIGIOUS and so that with the permission of their own bishop they are ready to devote themselves to particular churches whose needs are great. § 2. Except in the case of genuine necessity in the home diocese, ordinaries and hierarchs should not refuse permission to go elsewhere to those clerics whom they know are prepared and whom they judge to be suited when such clerics ask to perform their sacred ministry in regions having a serious lack of clergy; however, they should see to it that the rights and duties of these clerics are defined by a written agreement with the lbcal ordi-nary of the region that has been asked for. : § 3. In the case of clerics 'intending to transfer from their own diocese to a diocese of another' country, the same ordinaries should see to it that they are adequately prepared to exercise the sacred ministry in such places; that is, they should see to it that such clerics .acquire a knowledge of th~ language of that region and that they have an understanding of its institutions, of its social conditions, and of its usages and customs. § 4. Ordinaries can grant their clerics permission to transfer to another diocese for a determined time, which caff also be renewed indefinitely; t.his should be done, however, in such a way that such clerics remain incardi-hated in their own diocese and enjoy, when they return to it, all the rights they would have if they had devoted themselves to the sacred ministry in it. § 5. A cleric, however, who has legitimately transferred from his own diocege to another is ipso iure incardinated into the latter diocese after five years if he has manifested in writing such an intention both to the ordinary of the diocese he is in and to his own ordinary provided that within four months neither of these has expressed in. writing a contrary opinion. 4. Moreover, for the accomplishment of special pas-toral or missionary activities for various regions or social groups which need special help, there can be usefully established by the Apostolic See prelatures which consist of specially trained priests of the secular clergy and which are under the direction of their own prelate and possess their own statutes. It will be the duty of this prelate to: establish, and di-rect a national or international seminary in which stu-dents are appropriately trained. This prelate also has the right of incardinating such students and of promot-ing them to orders under the title of service to the prel-ature. The prelate should provide for the spiritual life of those promoted under the aforementioned title, for their special training which should be completed without de-lay, and for their special ministry in the light of agree- ments made with the local ordinai'ies to whom the priests are sent. Likewise, he should pro~,ide for their decent sus-tenance which should be met by the agreements that have been made or by the goods 0[ the prelature itself or by other suitable means. Similarly, he should provide for those who because of poor health or for other reasons must give up the work entrusted to them. Provided agreements have been made with the prel-ature, nothing prevents laymen, whether unmarried or married, from dedicating themselves and their profes-sional experience to the service of the prelature's works and undertakings. Such prelatures are not to be established except after consultation with the episcopal conferences of the terri-tory in which the prelature will carry out its work. In doing its work, the prelature should take every care to observe the rights of the local ordinaries and to have close and continual relationships with the episcopal con ferences. 5. Finally, with regard to the use of ecclesiastical goods it is also within the co~npetency of patriarchal synods and episcopal conferences to enact ordinances by which, attention being paid first of all to the needs of the dio- 'ceses of the territory, there are imposed on the dioceses certain levies to be paid for the sake of apostolic or char-itable works or for the sake of churches which possess 'small resources or which for special reasons are in need. Power ol Bishops o[ Dioceses (N. 8 of the decree, Christus dominus) 6. The norms for the execution of number 8 have been established in the motu proprio apostolic letter, De episcoporum muneribus, dated June 15, 1966. Fostering Pastoral and Scientific Study (N. 16 of the de-cree, Christus Dominus, and n. 19 of the decree, Presby-terorum ordinis) 7. The bishops, either individually orin cooperation, should see to it that during the year after, ordination all priests, even those engaged in the ministry, complete a series of pastoral lectures and that they also attend at stated times other lectures which are to provide them with the occasion of acquiring fuller knowledge of pas-toral matters and of theological, moral, and liturgical science, of strengthening their spiritual life, and of com-municating in a mutual and fraternal way their apos-tolic experiences. The bishops or the episcopal conferences, according to the circumstances of each territory, should see to it that one or more priests of proved knowledge and virtue Implementation Vatican H VOLUME 25, 1966 943 REVIEW FOR RELIGIOUS ~944 be chosen as., directors of studies for the purpose of pro- . rooting and: organizing the pastoral: lectures as well as the other helps judged to be n.ecessary for the ~cientific and pastoral fqrma.tion of the~priests of a given territo~; such helps incl.ude st.udy centers, traveling libraries, cate-chetical, homiletic,: or liturgical congresses, and ~the like. Remuneration and Sbcial Wellare of Priests (N. 16 of the de~ree, Christus Dominus, and nos. 20-1 of the de-cree, Presb~?terorum ~dinis) 8. Patriarchal synods and episcopal conferences should see to it that norms be set up, whether for each diocese or for several dioceses in common or for the entire te~i-tory, by which appropriate provisions are made for the due sustenance of clerics who are or have been engaged in the service of the People of God. The remuneration to be made to clerics should be essentially the same for all in the same circumstances, due regard being had [or the nature of a given office and for circumstances time and .place; the remu.neration should be sufficient .to enable clerics to lead a decent life and also to be of help to the poor. ¯ ,The reform of the system of benefices is entrusted to the commission.for the revision of the Code of Canon Law. In the meantime bishops, after conferring with their council of priests, should take care to provide for a just distribution of goods including also the revenues coming from benefices. The same episcopal conferences should~see to it that at least in those regions where the sustenance of the clergy depends completely or in large part on the offer-ings of th'e faithful each diocese has a special fund in which off, rings for thi~ purpose are collected. The ad-ministrator of this fund should be the bishop of th~ dio-cese ,himself who can be ass!sted, however, by delegated priests and, when it is advantageous, by laymen experi-enced in financial'mhtters.' Finally, the same episcopal conferences should see~ to it that in each country, ecclesiastical and civil laws always being observed, there should be either interdioc-esan institutions or institutions coestablished [or vari-ous dioceses" or'a consociation for an entire country by which sufficient provision' may be. made' under the vigi-lance of °the hierarchy for an adequate health insurance and benefit program and for the sustenance of-clerics who are sick, injured, or aged; It will be left to the revision 0f the Code of Canon Law to set down conditions for the establishment in each diocese or region of another ,common fund by which bishops can meet other obligations to persons serv-ing ~the Chulch and provide [or other needs of the dio- cese and by which richer dioceses can also help poorer dioceses. Care o1 Special Groups (N. 1"8 of the decree, Christus, Dominus) 9. 'In consideration ~ of today's great numbers of emi-grants and' travelers, the episcopal conferences' are asked to entrust to a specially delegated, priest or to a special commission everything pertaining t.o the study and direc-tion of the spiritual care of th~s~ groups. Nomination of,Bishops (N. 20 of the decree; Christus Dominus) . ¯ 10. Wi~h full retention of the roman pontiff's right of freely nominating and constituting bishops and without prejudice to the discipline of the Eastern Churches, the episcopal conferences in accordance wi~h the norms given or to be given by the Apostolic See should each year consult in secret and with prudence about the pro-motion of ecclesiastical persons to the office of. bishop in their territory; and they should propose the names of candidates to the Apostolic 'See. Resigr~.ation of Bishops (N. 21 of the decree, Christus Dominus) 11. For the implementation of the prescription of number 21 of the decree, Christus Dominus, all bish-ops of dioceses as well as other persons comparable to them in law are 'earnestly requested that before the com-pletion of their seventy-fifth year~ and of their own accord they tender their ~resignation of their office, to the.c6m-petent authority which will provide for the matter after considering all the circumstances of each case. A bishop whose resignation from office has' been ac-cepted can maintain, if he desires, his residence in the diocese. Moreover, the diocese itself should provide an appropriate and worthy sustenafice for a resigned bishop. It is the duty of the conferences of bishops to determine in a general way 'the conditions according to which the dio(ese should fulfill this duty. Boundaries o[ Dioceses (Nos. 22--4 of the decree, Christus Domin~us) 12.- § 1. In order that the boundaries of dioceses can be duly revised, the episcopal conferences, each for its own territory, should examine the present territorial di-visions of. the churches, setting up, if necessary, a special commission for this. For this examination it is necessary that the status of the dioceses with regard to territory, persons, and things be duly investigated, Individual bishops who are directly affected as well as the bishops ÷ ÷ ÷ Implementation vatican 1I VOLUME 25, 1966 945 ÷ ÷ ÷ Paul VI REVIEW FOR RELIGIOUS 946 of the entire ecclesiastical province or region within whose limits the revision of dioceses takes place should be consulted; as far as possible there should be used the help of genuinely expert persons whether ecclesi-astical or lay; the intrinsic reasons suggesting the chang-ing of boundaries should be considered with calmness; there should be considered for possible introduction all the changes treated in numbers 22-3 of the decree,~ Christus Dominus; in the divisi6n or dismembering of dioceses care should be taken to achieve an equitable and suitable distribution of priests and of seminarians, regard being had for the needs of the ministry of salva-tion to be exercised in each diocese and for the special circumstances and wishes of the priests and seminarians. § 2 With regard to the Eastern Churches it is desira-ble that in determining the boundaries for eparchies account should also be taken of the greater closeness of those places in which the faithful of the same rite live. Faculties of Auxiliary Bishops (Nos. 25--6 of the de-cree, Christus Dominus) 13.-§ 1. Auxiliary bishops must be established for a given diocese whenever this is demanded by the genuine needs of the apostolat~ exercised there. In the matter of the power to be given to an auxiliary bishop the chief considerations to be kept in mind are the following: the welfare of the Lord's flock that is to b.e shepherded, the status of membership in the episcopal college with which the auxiliary is honored, and his effective cooperation with the bishop of the diocese. § 2. The bishop of the diocese should make his auxil-iary either a vicar general or syncellus or an episcopal vicar, dependent, however, in every case exclusively on the authority of the bishop of the diocese. § 3. In order that the common welfare of the diocese be sufficiently provided for and that the dignity of the auxiliary bishop be safeguarded, the Council desired to make known its wish that when a see is vacant those who possess the right of doing so should entrust the di-rection of the diocese to the auxiliary or, when there are more than one, to one of th~ auxiliaries. Neverthe-less, ~ unless in a given case some other arrangement be made by competent authority, an auxiliary bishop as vicar general or as episcopal vicar does not lose the powers and faculties he possesses by law when the see is occupied. When, therefore, an auxiliar)~ is not elected to the office of vicar capitular, he retains the power con-ferred on him by law until a new bishop takes possession of the see; he should exercise this power in full concord with the vicar capitular who is the head of the admin-istration of the diocese. Episcopal Vicars (N. 27 of the decree, Christus Dominus) 14. - § 1. The new office of episcopal vicar was legally instituted by the Council in order that the bishop through the increase of these new co-workers might be able to carry out his pastoral direction as well as possible. Therefore it is left to the free decision of the bishop of a diocese to constitute one or more episcopal vicars accord-ing to the special needs of the place; moreover, his fac-ulty remains intact of naming one or more vicars general according to the norm of canon 366 of the Code of Canon Law. § 2. Episcopal vicars who according to the bishop's nomination are such in a given part of the diocese or in,~a certain type of activities or with regard to the faith-ful of a given rite or to groups of persons possess the ordinary vicarious power which common law gives to the vicar general. Therefore, within the limits of their com-petency they have the habitual faculties granted by the Apostolic See to the bishop as well as the execution of rescripts unless something else has been expressly pro-vided for or was purposely reserved to the person of the bishop. Nevertheless, the bishop of a diocese is free to reserve matters that he chooses to himself or to the vicar general; likewise, he is free to confer on the episcopal vicar the special mandate prescribed by common law for certain matters. § 3. As a co-worker of the episcopal office the episcopal vicar should refer everything done or to be done to the bishop of the diocese; moreover, he should never act in opposition to the latter's mind and will. Furthermore, he should not neglect to institute frequent conferences with the other co-workers of the bishop--~specially with the vicar general in ways to be determined by the bishop of the diocese; the purpose of such conferences is to strengthen unity of discipline among the clergy and the people and to obtain greater results in the diocese. § 4. A request denied by a vicar general or by an epis-copal vicar cannot be validly granted by another vicar of the same bishop even though he has considered the reasons for the denial of the vicar who made it. Moreover, a request denied by a vicar general or syn-cellus or by an episcopal vicar and afterward obtained from the bishop is invalid if no mention was made of the previous denial; a request, however, denied by the bishop cannot be validly obtained from a vicar general or an episcopal vicar without the consent of the bishop even if the previous denial has been mentioned. § 5. Episcopal vicars who are not auxiliary bishops are nominated for a set time to be determined in the very act of establishing them; nevertheless, they can be re- + + + Implementation Vatican I1 VOLUME 25, 1966 947 + ÷ ÷ Paul Vl REVIE~V FOR RELIGIOUS moved at the will of the bishop. When the see is vacant, they lose their office unless they are auxiliary bishops; it is, however, advisable for the vicar capitular to use them as his delegates so that the good of the diocese will not be harmed. The Council of Priests and the Pastoral Council (N. 27 of the decree, Christus Dominus, and n. 7 of the decree, Presbyterorum ordinis) 15. The following points refer to the council of priests: § 1. In each diocese according to ways and forms to be determined by the bishop there should be a council of priests; that is, a group or senate of priests representing the priests as a whole; this senate is to be such that by its advice it can effectively assist the bishop in the admin-istration of the diocese. In this council the bishop should listen to his priests, consult them, and confer with them about matters pertaining to the needs of pastoral work and to the good of the diocese. § 2. Insofar as they have a part in the care of souls and in the works of the apostolate religious will also be able to be admitted among the members of the council of priests. § 3. The council of priests has only a consultive voice. 24. When the see is vacant, the council .of priests ceases unless in special circumstances authenticated by the Holy See the vicar capitular or the apostolic admin-istrator confirms it. However, the new bishop will establish his own new council of priests. 16. The following points refer to the pastoral council so highly recommended by the decree, Christus Dominus: § 1. The work of the pastoral council is to investigate and appraise all pastoral works and to make practical conclusions concerning such works. All this is to be done in such a way that conformity with the gospel be pro-moted with regard to the life and action of the People of God. § 2. The pastoral council, which has only a consultive voice, can be constituted in various ways. Ordinarily, even though by its nature it is a permanent institution, its membership and activity can be for a definite time, performing its work on given occasions. The bishop can convoke it whenever it will seem opportune to him. § 3. In the pastoral council clerics, religious, and lay persons, specially chosen by the bishop, have a part. § 4. In order that the purpose of this council be actu-ally achieved in practice, it is desirable that its work in common be preceded by previous stndy with the help, if the matter warrants it, of institutes or offices which are at work in the area of the council's purpose. § 5. When hierarchies of diverse rites are present in the same territory, it is strongly recommended that as far as possible the pastoral council be interritual; that is, that it consist of clerics, religious, and lay persons of the diverse rites. § 6. Other dispositions are left to the free determina-tion of the bishop of the diocese, account being taken of the matters mentioned in number 17. 17.-§ 1. In matters involving the council of priests, the pastoral council, and their relations to each other or to the committees already existing by reason of present law, it is advisable that the bishops, especially when they are met in their conferences, take common counsel and publish similar norms in all the dioceses of the territory. The bishops should also take care that all diocesan councils be coordinated as closely as possible by a clear-cut determination of competency, by mutual sharing of members, by common or successive sessions, and by other such means. §2. In the meantime until they are revised, the bishop's councils that are in existence by reason of ex-isting law, that is, his cathedral chapter, his group of consultors, and others of the same type if there be such, retain their own work and their own competency. Suppression of Rights and Privileges in the Conferral of O~ces and Benefices (N. 28 of the decree, Christus Dominus) 18.-§ 1. The good of souls demands that the bishop possess due liberty to confer offices and benefices, even those without the care of souls, in a suitable and equi-table manner on the clerics who are best fitted for them. The Apostolic See will no longer reserve to itself the conferral of offices or benefices, whether with or without the care of souls, unless they be consistorial; in the law of the formulation of every benefice those clauses will be eliminated in the future which restrict the freedom of the bishop with regard to the conferral of the benefice; non-onerous privileges, hitherto granted to physical or moral persons and involving the right of election, nomi-nation, or presentation for any non-consistorial office or benefice, are abrogated; also abrogated are customs and rights of nominating, electing, and presenting priests for a parochial office or benefice; the law of competitive examinations is suppressed for offices and benefices, in-cluding those without the care of souls. With regard to what are called popular elections, it is the duty of the episcopal conferences where such elec-tions exist to propose to the Apostolic See what seems ÷ ÷ + Implementation of Vatican I1 VOLUME 25, 1966 9,i9 ÷ ÷ ÷ Paul VI REVIEW FOR RELIGIOUS 950 most opportune with a view of abrogating them as far as possible. § 2. If, however, rights and privileges in this matter were established by reason of a convention between the Apostolic See and a nation or by reason of a contract made with physical or moral persons, the matter of the cessation of such rights and privileges must be taken up with the interested parties. Deans (N. 30 of the decree, Christus Dominus) 19.-§ 1. Among the closer co-workers of the bishop of a diocese are to be included those priests who exercise a pastoral function of a supraparochial nature; among such are vicars forane who are also called archpriests or deans and among Eastern Christians protopriests. For the exercise of this position there should be appointed priests who are outstanding for their knowledge and their apostolic activity and who, when they are given due faculties by the bishop, can suitably promote and direct common pastoral action in the territory entrusted to them. Accordingly, this office is not affixed to a deter-mined parish. 2. Vicars forane, archpriests, or deans are appointed for a set time to be determined by special law; however, they can be removed at the will of the bishop. In the case of the nomination, transfer, or removal of parish priests in the territory of which the deans are in charge, it is advisable that the bishop of the diocese consult them. Removal, Transfer, and Resignation of Pastors (N. 31 of the decree, Christus Dominus) 20.-§ 1. Without ~rejudice to the present law of religious, the bishop can legitimately remove any pastor from a parish whenever in the opinion of the bishop his ministry, even without any serious fault of his own, is made harmful or at least ineffective because of any of the causes listed in law or for similar reasons; until the revision of the Code the mode of proceeding in this matter is to be that laid down for irremovable pastors (cc. 2157-=61 of the Code of Canon Law), the law of the Eastern churches retaining its force. § 2. If the good of souls or the'need or welfare of the Church. demands it, the bishop can transfer a pastor from his parish in which he is successful to another parish or to any other ecclesiastical office. If, however, the pastor refuses, the bishop, in order that the transfer be validly enacted, should follow in every detail the way of acting noted above. § 3. In order .that the prescriptions of number 31 of the decree, Christus Dominus, can be put into execu- tion, it is requested of all pastors that of their own accord before the completion of their seventy-fifth year they submit their resignation to their own bishop who, hav-ing considered all the circumstances, will decide whether to accept or defer the resignation. The bishop should provide those who resign with suitable sustenance and habitation. Establishment, Suppression, and Change of Parishes (N. 32 of the decree, Christus Dominus) 21.-§ 1. Every effort should be made that there be suitable partitioning or division of parishes in which because of the excessive number of the faithful or the excessive extent of the territory or because of any reason whatsoever apostolic activity can be exercised only with difficulty or in a less than suitable way. Likewise, parishes that are too small should be united into one as far as the matter demands and circumstances allow. § 2. Parishes should no longer be united by full right to chapters of canons. If any are so united, after consul-tation with the chapter and the council of priests they should be separated and a pastor established-~selected either from the capitulars or not--who should possess all the faculties which belong to pastors .according to the prescriptions of law. § 3. By his own authority and after consultation with the council of priests the bishop of a diocese can es-tablish, suppress, and change parishes; however, he must do this in such a way that if there are conventions be-tween the Apostolic See and the civil government or if there are rights involved belonging to physical or moral persons, the matter be suitably adjuste~d with the pre~ ceding subjects by the competent authority. Religious (Nos. 33--5 of the decree, Christus Dominus) 22. The norms set forth here apply to all religious, men and women, of whatever rite, but without prejudice to the rights of the Eastern patriarchs. 23-§ 1. All religious, including .exempt ones, working in places where a rite different from their own is the only one or is so much greater with respect to the num-be of its faithful that in common estimation it is judged. to be the only one, are dependent on the local ordinary or hierarch in those things which involve the external works of the ministry; and they are subject to him ac-cording to the norms of law. § 2. Where, however, there are many local ordinaries or hierarchs, the same religious in discharging their func-tions among the faithful of different rites are bound by the norms which are given by the common consent of these ordinaries and hierarchs. VOLUME 25, 1966 951 Paul, REVIEW FOR RELIGIOUS , 24. Although. the exemption of religious within its own legitima.te confines also applies in mission localities, still, because of the special circumstances of the sacred ministry exercised in those places and according to the' mind of the decree, .dd gentes divinitus," the special stat-utes are to be observed that have been giv.en or approved by the Apostolic See with regard to the relationships be-tween the local ordinary and the religious superior, es-pecially in the case'of; a mission entrusted to a given institute. 25.-§ 1. All religious, including exempt ones, .are bound by the laws, decrees, and ordinances enacted by the local ordinary with regard, to the various works con-cerned with the exercise of the sacred apostolate as well as with pastoral, and social action pr~scribed or recom-mended by the local ordinary. § 2. They are likewise bound ,by the laws, decrees, and ordinances ~nacted by the local ordinary or by the conference of bishops regarding among other things~ the following matters: a) the public"use of all means of social communica-tion according to the norm of numbers 20 and 21 of the decree, Inter miril~ca; ~ . , b) attendance at public spectacles; c) membership or cooperati.on with societies or asso-ciations which the 'local. ordinary or the episcopal con-ference has declared forbidden; d) dccle~iasti~al garb, thqugh there remain in force canofi 596 6f the ~Code of Canon Law and canon 139 of the Code of Canofi Law f6r. the East'.ern Church; the matter of ecdlesiastic.al g~.,rb 'is to include the following regulation: The l'6dal, ordinary or the episcopal confer-ence, in order ~6'~ ~oid'scarid~ilizin'g the faithful, can prohibit, the clergy, both secular and religious, including the exempt,,on~s., from publi,cly wearing lay garb. ¯ 26. Furthermore, the sarape ~r$1igio~us are bound by the laws and decrees' efia~teff by the local ordinary with re-gard to the public exercise 6f -~orship. They "are bound to this in their 6wn churches" ~nd in their public as well as their semipublic oratories if the faithful ordinarily attend them, without prejud.ic~, however,, to the rite iegitimately used f~r theirs.,, own c.ommunity only and account bei.ng taken of ~the o'rdo for the choral Divine Office and for the. sacred functions pertaining to the spe-cial purpose ~f"the institute. 27.-§.1. The epis.copal .conference of each nat.ion, having consulted the religious superiors involved in the matter, can determine norms with regard to the soliciting Of donations;, the~ norms must be observed by all reli-gious, not excluding those who by reason of their insti-. tute are called and are mendicants, without prejudice, however, to their right to beg. § 2. Likewise, religious should not begin the collec-tion of funds by means of a public ,subscription without the consent of the ordinaries of the places in which the funds are collected. ~ 28. The proper or special ~vorks of ~ach institute are those which with the approval of the Apostolic See have been undertaken from its foundation or on account of venerable traditions and which accordingly have been defined and regulated by the constitutions and other proper laws of the institu.t_e. These works, should be zealously fostered by' re!igious, special account being made of the spiritual necessities of the dioceses and fra-ternal concord being maintained with the diocesan clergy and with other institutes engaged in similar works. 29.-§ 1. The.proper or special works exercised in the institute's houses, even those that are rented, are de-pendent on the superiors of the institute who should direct and regulate them according to the constitu-tions. Nevertheless, works of this kind are also subject to the jurisdiction of the local ordinary according to the norm of law. § 2. However, works, ' even though proper and special to the institute, which are entrusted to it by the local ordinary are subject to the ordinary's authority and direction, there being retained, however, the right of religious superiors to watch over the life of their mem-bers as well as to watch over, together with the local ordinary, the execution of the functions entrusted to them. 30.- § 1. ~)ther matters of law being observed, a writ-ten agreement should be made between the local ordi-nary and the competent superior in the case of,the com-mitting of a work of" the apostolate to an institute by the local ordinary. This agreement among other things should clearly define details concerning the work to be done, the members to be .devoted to it, and its financial aspects. § 2. For these works genuinely fitted religious should be selected by their proper ,religious superior after mu-tual consultation with the local ordinary; and if it is a question of an ecclesiastical office to be conferred on a member, the religious should be nbminated by the local ordinary himself, with the presentatibn or at least the assent' of his proper superior and for a period of time determined by mutual consent. 31. Even when'a task is to' be entrusted to a given religious by the "local ordinary or by the episcopal con-ference, this should he"done with the consent of his superior and through a written agreement. ÷ ÷ ÷ Implementation oJ Vatican H VOLUME 25, 1966 953 Paul VI REVIEW FOR RELIGIOUS 954 32. For a serious reaSon any religious can be removed from the work entrusted to him both at the wish of the commissioning authdrity after the religious superior has been advised arid at the wish of the superior after the one commissioning ~has been advised. In this matter both have parity in law and the consent of the other is not required; neither one is bound to disclose, and much less to prove, t6 the other the reason for his decision, without prejudice, however, to non-suspensive appeal to the Apostolic See. 33.-§ 1. The local ordinary by his own authority and with the consent of the competent religious superior can entrust a parish to a religious institt~te even by erecting it in a religious church of the institute. This commis-sioning of a parish can be done permanently or' for a def-inite period of time; in either case it should be done by m~ans of a written agreement between the ordinary and the comp'etent superior of the institute; in this agreement among other matters there should be expressly and clearly set forth mat'ters pertaining to the work to be done, the persons to be assigned it, and to the finances involved. § 2. With the permission of the proper superior the local ordinary can constitute a religious as pastor of a parish not entrusted ~to the inStitute; in this case a spe-cially adapted agreement should be made with the com-petent superior of the ~nstltute. 34. - § 1. A religious house, whether formal or nonfor-mal; pertaining to an exempt institute cannot be sup-pressed without the consent of the Apostolic See and without consultation of the local ordinary. § 2. Religious superiors should not be hasty in seek-ing to suppress for whatever reason a house or a work; for they Should r~member that all religious have the duty to work hard and diligently not only for the build-ing up and increase of the entire Mystical Body of Ch'rigt but also for the welfare of the particular churches. § 3. When, however, suppression Of a house or work is asked for by superio?s, especially when the reason is lack of persons, the local ordinary should consider the peti-tion in a benignant way. 35. Even.when established by the Apostolic See, asso-ciations 'of the faithful which are under the leadership an~ direction of a religiou.s institute are under the juris-diction and vigilance of the local ordinary who has the right and duty of visiting them according to the norms of the sacred canons. If they are engaged in the external works of the apostolate or in .the promotion .of divine worship, they must observe the prescriptions made in these matters b9 the local ordinary or the episcopal conference. 36.-§ 1. The apostolic zeal of the members of the in-stitutes of perfection who do not profess a purely con-templative life should not be limited to works proper to each institute or to others that are occasionally as-sumed in such a way that local ordinaries, having con-sidered the special characteristics of each institute and with the consent of the competent religious superior, can-not call on not only priest religious but also on all men and women members to assist in the various ministries of the dioceses or regions because of the needs of souls and lack of clergy. § 2. If in the judgment of the local ordinary the help of religious is thought necessary or highly useful [or ex-ercising the multiple work of the apostolate and for fos-tering undertakings of a pastoral nature in secular par-ishes or in diocesan associations, religious superiors should as far as they can furnish the desired help when the same ordinary asks for it. 37. In all churches as well as in all public or semi-public oratories belonging to religious which as a matter of fact and habitually are open to the faithful, the local ordinary can order that episc6pal documents be publicly read and catechetical instructions be given and that spe-cial offerings be collected for specified parochial, dioc-esan, national, or universal purposes, all of which offer-ings are to be carefully sent to the episcopal curia. 38. If the faithful ord!narily attend them, the local ordinary has the right of visiting the churches and ora-tories, even semipublic ones, of religious, including the exempt ones, in order to assure the observance of the gen-eral laws and of the episcopal decrees with regard to di-. vine worship. If it happens that abuse is noted in this area and if warnings given the religious superior have been without effect, he himself can take care of the mat-ter by his own authority. 39. - § 1. In accord with the norm of number 35, 4, of the decree, Christus Dorninus, the general ordering of the. Catholic schools of religious institutes, their right of directing them being safeguarded as well as the norms given in the decree, number 35, 5, concerning the previ-ous mutual consultations between bishops and religious superiors, involves the overall distribution of all Catholic schools in the diocese, their, intercooperation, and their supervision to see to it that they are no less suitable than other schools for the achievement of their c~fltural and social purposes. § 2. With the exception of purely internal schools open exclusively to members of an institute, the schools, colleges, oratories, recreation centers, homes, orphanages of religious institutes as well as other similar institutions of theirs for works of religion or of charity, whether ÷ ÷ ÷ Implementation Vatican I1 VOLUME 25, 1966 " "" 955 spiritual or temporal, can be visited by the local ordinary either personally or through another in accord with the norm of the sacred canons." 40. The norms for the inclusion of religious in dioce-san works and ministries to be exercised under the direc-tion of the bishop should also be applied, suitable adapta-tions being made, to other works and ministries which exceed diocesan boundaries. + ÷ + Paul VI REVIEW FOR RELIGIOUS 956 Episcopal Conferences (N. 38 of the decree, Christus Dominus) 41. - § 1. The bishops of countries or territories in which an episcopal conference is not yet had should act promptly to establish one in accord with the norm of the decree, Christus Dominus; and they should frame statutes for it and send them to the Apostolic See for examination. § 2. Already established episcopal conferences must draw up their own statutes according to the prescrip-tions of the Council; or, if they already have a set of statutes, they should revise them in accord with the mind of the same Council and submit them for examination to the Apostolic See. § 3. Bishops of countries in which it is difficult to es-tablish a conference, after consultation with the Apostolic See, should join that conference which best fits the needs of the apostolate of their own nation. § 4. Episcopal conferences 6f many nations, that is, international ones, can be established only with the ap-proval of the Holy See whose right it is to establish special norms. Moreover, whenever any projects or plans of an international nature are undertaken, the Holy See should be advised about them beforehand. § 5. Relationships between episcopal conferences, es-pecially those of neighboring countries, can be main-tained in an opportune and suitable way by the secre-tariats of the conferences. The secretariats can among other matters be concerned with the following activities: a) to communicate the principal ways of proceeding especially in pastoral matters and activity; b) to send written reports giving the decisions of the conference or to send the proceedings or documents which are issued by the common agreement of the bishops; c) to point out various undertakings of the apostolate that have been proposed or recommended by the epis-copal conference and that may be useful in similar cases; d) to propose serious matters which in modern times and in particular circumstances seem to be of the greatest importance; e) to indicate dangers or errors in the country that may creep into other nations, making this indication so that suitable and opportune means can be taken to prevent, remove, or limit them; and to do other similar things. Boundaries of Ecclesiastical Provinces or Regions (Nos. 39-41 of the decree, Christus Dominus) 42. The conferences of bishops should attentively study whether the better achievement of the welfare of souls a) requires a more suitable determination of the boundaries of ecclesiastical provinces or b) indicates the establish-ment of ecclesiastical regions. If the answer to these points is affirmative, the conferences should send to the Holy See the ways by which needed revisions of the boundaries of ecclesiastical provinces and the needed establishment of regions are to be enacted in law. More-over, they should indicate to the Holy See the ways in which those dioceses in the territory should be aggregated which up to now have been immediately subject to the Holy See. Pastoral Directories (N. 44 of the decree, Christus Domi-nu$) 43. With regard to pastoral directories, patriarchal synods and episcopal conferences are asked to be prompt in studying the general and special questions to be treated in the directories and to communicate their advice and desires as soon as possible to the Apostolic See. II NORMS FOR THE DECREE ON RELIGIOUS LIFE In order that the effects of the Council may be care-fully brought to maturity, religious institutes should first of all promote a newness of spirit and then in a prudent but inventive way see to the suitable renewal of life and discipline by carefully studying the dogmatic constitu-tion, Lumen gentium (Chapters 5 and 6) as well as the decree, Perfectae caritatis, and by putting into effect the teaching and norms of the Council. The following norms, which apply and give insistence to the decree, Perfectae caritatis, hold with suitable adaptation for all religious, Latin as well as Eastern; they describe a way of proceeding and lay down certain pre-scriptions. PART I THE WAY TO PROMOTE A SUITABLE RENEWAL OF RELIGIOUS LIFE I. Those Who Should Promote a Suitable Renewal 1. The principal role in the renewal and adaptation of religious life pertains to tbe institutes themselves; they + ÷ ÷ Im~lementation o] Vatican 11 VOLUME 25, 1966 957 ÷ ÷ ÷ Paul REVIEW FOR RELIGIOUS 958 will achieve this especially through general chapters or, in the case of the Eastern Churches, through synax~es. The work of the chapters will be achieved no~t only by passing laws but even more so by promoting ~piritual and apostolic vitality. 2. The cooperation of all superiors and members is necessary, to renew religious life in themselves, to prepare the spirit of the chapters, to complete their work, and to faithfully observe the laws and norms enacted by the chapters. ~ 3. In order to promote a fitting renewal in each in-stitute, within two or at most three years there should meet a specia! general chapter, ordinary or extraordinary. If the chapter itself so decides by a secret vote, the chapter can be divided into two parts separated in time by an interval of generally not more than a,.year. 4. In: preparing for this chapter the general council should make suitable provision for extensive and free consultation of the members and it should put the re-stilts of this consultation into a usable form in order that the work of the chapter may be helped and orientated. This can be done, for example, by consulting conventual and proVincial~ chapters, by establishing comniissions, by issuing questionfiaires, and so forth. ~ 5. In the case of stauropegiac monasteries [Eastern monasteries with' a special type of exemption] it will be the duty of the patriarch to enact norms for achieving this consultation. 6. This general Tchapter has the right to change for experimental purposes .given noinns of the constitutions or, in the case of the Eastern churches, of the typica pro-vided that the purpose, nature, and characteristics of the institute are retained.,. Experimentations in things agaihst the general law, a matter t6 be done with prudence, will be gladly permitted by the Holy See as opportunity war-rants. These experimentations can be extended until the next ordinary general chapter which will itself have the power to again extend .them but not beyond the immediately following chapter. 7. The general council will enjoy the same power in the time period between these chapters according to con-ditions to be determined by them; in the case of the East-ern churches, this power will be had in independent monasteries by the hegoumenos with the lesser synaxis. 8. Definitive approbation of the constitutions is re-served to the competent authority. 9. With regard to the revision of the constitutions of nuns, each monastery after the fashion of a chapter or also the nuns individually should express their opinions which, in order that the unity of the religious family may be fostered according to its own characteristics, should be collected by the supreme authority of the order if there is one and otherwise by a delegate of the Holy See or, in the case of Eastern religious, by the patriarch or the local hierarch. Opinions and advice can also be ob-tained from consessions of federations or from other legitimately convoked meetings. 10. If in monasteries of nuns certain experimentations for a time with regard to observances should be judged opportune, they can be permitted by the general superiors or by delegates of the Holy See and, among the Eastern churches, by the patriarch or the local hierarch. Neverthe-less, account should be taken of the mentality and atti-tudes of cloistered persons who have need for stability and security. 11. It will be the duty of the authorities mentioned above to see to it that the text of the constitutions is re-vised with the advice and help of the monasteries them-selves and that they are submitted for the approval of the Holy See or the competent hierarchy. 1I. Revision of Constitutions and Typica 12. The general laws of each institute (whether called constitutions, typica, rules, or. any other name) should include the following elements: a) gospel and theological principles concerning the religious life and its union with the Church as well as pertinent and specific declarations in which "are recog-nized and preserved the spirit and characteristic aims of the founders as well as the sound traditions- all of which constitute the heritage of each institute" (n. 2, b) of the decree, Per[ectae caritatis); b) the juridical norms necessary for clearly defining the characteristics, purposes, and means of the institute; these norms should not be overmultiplied but should al-ways be expressed in an adequate way. 13, The union of both these elements--the spiritual, namely, and the juridical--is necessary in order that the principal documents of the institutes may have a stable foundation and that a genuine spirit and a vitalizing norm pervade them; hence care should be taken to avoid composing a text that is only juridical or merely exhorta-tory. 14. From the fundamental document of institutes there should be excluded those matters that are already obsolete or changeable according to the customs of a given age or reflect merely local customs. Those norms which reflect the present age, the physical and psychic, status of the, members, and ,the special char-acteristics of today should be placed in secondary docu- 4- 4- Implementation o/ Vatican I! VOLUME 25, 1966 959 Paul REVIEWFOR RELIGIOUS 96O ments which are called "directgries," custom books, or some other such title. " IlL Criteria of(SuitableRenewal 15. The norms and the spirit to which a suitable re-newal should correspond '~hould be derived not,only from the decree, Perfectae caritatis, but .also from the other documents of the Second Vatican' Council, especially from Chapters" 5 and 6 of the ,dogmatic constitution, Lumen gentium. 16. Institutes should see to it that the principles es-tablished in number 2 of the decree, Perfectae caritatis, generally inform the renewal of their Own religious life; therefore: - , § 1. The sLudy and meditation of Scripture should be deeply fostered in all the members from the novitiate on. Likewise, care should be taken that all ,the members ~hare by' fitting means in the mystery and life: of .the Church. § 2. The doctrine of religious life in all its various aspects (theological, historical, canonical, and so forth) should be investigated 'and explained. § 3. In order to secure the good of the Church, in-stitutes should strive for a full. knowledge of their origi-nM spirit so that, this spirit having been faithfully pre-served in the adaptations that are decided on, religious life may be purified 6f alien elements~and freed from ob-solete matters. , ~ ~ 17. Those things are~ to be regarded, as obsolete which do not constitute the nature and purpose of the institute and, having lost'their significance and relevance; no longer truly help religious, life, account,~however, being taken of the witness which the religious state should pro-vide according to its own function., ' , . '~ 18. The way ~of governing should be such that "~hap-ters and councils., each in their,:own ,way should ex-press the shared responsibility of all thd members for the welfare of the entire community" (n. 14 iof the decree, Per[ectae caritatis);,,this will be principally,achieved if tlie members have a truly effective part in. the selection of the'membership bf-chapters and councils. Similarly, the way of governing should be such that 'in~ accor~d.with the demands of modern times~ the exercise of authority is made more efficacious and more unencumbered. Hence superiors of ever.y level should be given adequate powers so that useless or overly freqiaent recourse to!higher au-thorities is not multiplied. 19. Moreover; a suitable renewal cannot be made once and for all but must be fostered in a continuous way by the help of the fervor of the members and by the solici-tude ~of chapters and superiors. PART II MATrER$ FOR ADAPTATION AND RENEWAL I. The Divine O~ice o]'Brothers and Sisters (N. 3 of the decree, Perfe~ctge caritatis) 20. Although religious who recite a 'duly approved Little Office are engaged in the public prayer of the Church (see the 'consfitution, 'Sacrosanctum Concilium, n. 98)., still it is highly recommended to institutes that in place of a Little Office 'they recite either in ~part or in whole the Divine Office so that they may take more in-umate part in the liturgical life of the Church. However, Eastern'members should recite the doxologies, and the divine praises in accord with their own typica and cus-toms. II. Mental Prayer (N. 6 of the decree, Perfdctae caritatis) 21.'In order that reli~gious may participate more inti-mately a.nd fruitfully in the sacred mystery of the Eucha-rist and that their life be nourished riaore abundantly, greater place should be given to mental prayer in prefer-ence to a multiplicity of vocal prayers, there being main-tained,, however, the exercises of devotion commonly re-ceived in the Chui~ch and du~ care being taken that the members are diligently instructed in the conduct of"~he spiritual life. ' III. Mortification (Nos. 5 and 12 of the decree, Per]ectae caritatis) 22. Religious more than the rest of the f~iitfiful should be devoted to works of penance and mortification. How-ever," the ,special penitential observances~ of institutes .should, as far as there is need, be r~evised so that, du9 con-sideration having been given to the traditions of the East .or the West and to modern conditions, the .members can actually put them into practice together with new forms taken from today's mode of living. IV. Poverty (N. 13 of the decree, Per]ectae caritatis) 23. Institutes, especially through their general chap-ters, should diligently and concretely promote the spirit and practice of poverty in accord with the mind of num-ber 13 of the decree, Per[ectae caritatis; in accord with their distinctive nature they should also seek and insist on new forms of poverty which will make the exercise and witness of poverty more efficacious for the present time. 24. Institutes of simple vows should themselves decide in their gdneral chapter whether there should be intro-duced into the constitutions a renunciation of patrimony + + ÷ Implementation 'Vatican II VOLUME 25, 1966 961 already acquired or to be acquired and, if it is decided to do so, whether it should be obligatory or voluntary and when it should be done, that is, whether before perpetual profession or after some years. Paul VI REVIEW FOR RELIGIOUS 96~ .V. Common Life (N. 15 of the decree, Perfectae caritatis) 25. In institutes devoted to works of the apostolate .common life, since it is of great importance if the mem-bers as a family united in Christ are to reactualize their brotherly fellowship, should be promoted by every means in a way that is fitted to the vocation of the institnte. 26, In institutes of this kind the daily order can often not be ~the same in all the houses nor at times in the same house for. all its.members. However, it should also be so arranged that the religious besides the time given to spiritual matters and to work may have some time for themselves and caw enjoy suitable recreation. 27. General chapters and synaxes should investigate ways in which those members who are called lay brothers, cooperators, or some other name can gradually obtain active voice in specific acts of the community and in elections as well.as passive voice with regard to certain positions; in this way they will become more closely .joined to the life and works of the community, and priests .will be able,to devote themselves with more freedom to the ministries. 28. In monasteries which have come to the decision of ¯ having,'Only one class of nuns, choir obligations should be specified in the constitutions, consideration being .giye.n to the diversity of persons which the distinction of works and special vocations requires. 29. Sisters devoted to the exte~'nal service of monas-teries, called oblates or some other name, should be gov-erned by special statutes in which consideration should be given to their vocation which is not purely contempla-tive and to the exigencies of the vocation of the nuns in ufiion with whom they live even though they are not nuns. The superioress of the monastery has a serious'respon-sibility to,take solicitor's care of them, to provide them .w.ith a suitable religious formation, to treat them with a g~nuine spirit of love, and to foster their bond of fellow-ship with the community of nuns. VI. The Cloister of Nuns (N. 16 of the decree, Perlectae caritatis) 30. The papal cloister of monasteries is to be consid-ered as an ascetical institution which is specially linked to their'distinctive vocation since it is a sign, defense, and special form of their withdrawal from the world. Nuns of the Eastern rites should observe their own kind of cloister in the same spirit. 31. This cloister is to be adapted in such a way that material separation from the' outside is always retained. However, each family according to its own spirit can de-termine and specify in the constitutions particular norms for this material separation. 32. Minor cloister is abrogated. Nuns, therefore, who by their institute are devoted to external works should define this cloister in their constitutions. But nuns who, t~hough contemplat.ive by reason of their institute, have nevertheless under'taken external works, should, after a sufficient amount of tJ.me granted them for deliberation, either give UP their external works and retain papal cloister or retain the works and define their own cloister in the constitutions, their status as nuns bein~ retained. ' VII. The Training of,Religious (N. 18 of the decree, Perfectae caritatis) 33. The training of members from the novitiate on should not be conducted in the. same way in all institutes, but rather consideration should be given to the distinc-tive nature of each institute. In revising and adapting training, an adequate and prudent place should be given to experience. . 34. The matters set down in the decree, Optata.m totius (on the training of priests), should be suitably, adapted in accord with the nature of each insti.tute.and faith-fully observed in the way of training religious clerics. ¯ 35. Further training to be given after the novitiate, in a way. suited to the individual institute is necessary for all members even those of the contemplativ, e life, for brothers in lay institutes, and for sisters in institutes de-voted to apostolic works. This training; already in. exist-ence in many institutes under the name of juniorate, scholasticate, or some other title, should in general ex-tend for the entire period of; temporary vows. 36. This training should be given in suitable houses; and, lest it be merely thebretical, it should be comple-mented by an apprenticelike exercise of the works and functions that are in accord with the characteristics and circumstances of each institute so that the ones being trained may be gradually introduced to the life which they will live thereafter. 37. Without prejudice to the characteristic formation in each institute, when individual institutes cannot suffi-ciently provide academic or technical training, this can be supplied by a fraternal collaboration of a number of them. This can take different forms and ways: common lectures or courses, the lending of teachers, even the con-solidation of teachers and equipment in a common Implementation Vatican II VOLUME 25, "1966 963 school to be attended by members of a number of insti-tutes. Institutes which are provided with the necessary means should willingly give help to others. 38. After adequate experimentation, it will be the duty of each institute to draw up its own adapted norms for the training of members. VIII. The Union and. Suppression of Institutes (Nos. 21-2 of the decree, Perfectae caritatis) 39. The promotion of union of any kind among in-stitutes presupposes an adequate spiritual, psychological, and juridical preparation in accord with the mind of Perfectae caritatis. To achieve this it will often be advan-tageous for institutes to be helped by an adviser approved by the competent authority. 40. In the cases and circumstances just mentioned, the good of the Church is to be looked for, due consideration, however, being given to the special nature of each in-stitute and to the freedom of individual members. 41. After all circumstances have been considered, the following when found together should retain a specie/1 place among the criteria which can contribute to form-ing the judgment to suppress an institute or a monas-tery: a small number of religious relative to the years of existence; lack of candidates over a number of years; ad-vanced age of the greater part of the members. If sup-pression is decided on, provision should be made that the suppressed institution be joined "if it be possible, to an-other, more vigorous institute or monastery which is not very different in purpose and spirit" (n. 21 of the decree, Perfectae caritatis). Each religious, however, should be previously consulted; and everything should be done in charity. Paul Vl REVIEW FOR RELIGIOUS 964 IX. Conferences and Unions of Majqr Superiors and Superioresses (N. 23 of the decree, Perfectae caritatis) 42. Care should be taken that the union of superiors general and the union of superioresses general be able to be heard and consulted by means of a commission estab-lished with the Sacred Congregation of Religious. 43. It is of the greatest importance that the national conferences or unions of major superiors and of major superioresses should confidently and respectfully cooper-ate with the episcopal conferences (see n. 35, 5 of the decree, Christus Dominus; n. 33 of the decree, Ad gentes divinitus). Hence it is hoped that matters pertaining to both sides will be treated in mixed commissions composed of bishops and major superiors or superioresses. CONCLUSION 44. These norms, which apply to religious of the en-tire Church, leave intact the general laws of the Church, whether of the Latin Church or of the Eastern Churches, as well as the specific laws of religious institutes unless these norms change them explicitly or implicitly. III NORMS FOR IMPLEMENTING THE DECREE ON MISSIONARY ACTIVITY Vatican Council II's decree, ,4d genres divinitus (on the missionary activity of the Church), should be es-teemed by the entire Church and be faithfully observed by everyone so that the entire People of God should be-come genuinely missionary and conscious of its mission-ary obligation; local ordinaries should see to it that the decree comes to the knowledge of all the faithful: there should be clergy conferences and sermons to the people to explain and emphasize the common obligation of all with regard to missionary activity. In order to make the application of the decree easier and more faithful, the following enactments are given: 1. The theology of missions should be included in the theological doctrine that is to be taught and progressively deepened; this is to be done in such a way that the mis-sionary nature of the Church is clearly visible. More-over, the ways of the Lord in His preparation for the gospel and the possibility of salvation for those not evangelized should be considered; and emphasis must be given to the necessity of evangelization and of incorpora-tion into the Church (Chapter 1 of the decree, Ad gentes divinitus). All these matters should be kept in view when studies in seminaries and universities are newly organized and duly ordered (n. 39). 2. Episcopal conferences are invited to propose to the Holy See as soon as possible general questions abont the missions which can be considered in the coming meeting of the synod of bishops (n. 29). 3. To increase the missionary spirit in the Christian people, prayers and daily sacrifices should be fostered in such a way that the annual Mission Day shonld appear as a spontaneous indication of that spirit (n. 36). Bishops and episcopal conferences should compose petitions for the missions to be inserted into the Prayer of the Faithful at Mass. 4. In each diocese a priest should be designated for the effective promotion of missionary undertakings, and he should also be a member of the pastoral council of the diocese (n. 38). ÷ ÷ ÷ Implementation o! Vatican 1I VOLUME 25, 1966 965 + ÷ ÷ Paul REVIEW FOR RELIGIOUS 966 5. To promote the missionary spirit students in semi-naries and young people of Catholic associations should be encouraged to have contacts with seminary students and similar associations in the missions so that a mutual understanding may foster in the Christian people a mis-sionary and ecclesial consciousness (n. 38). 6. Being aware of the urgency of the evangelization of the world, bishops should promote missionary voca-tions among their clerics and young people; and to in-stitutes engaged in 'missionary work they should furnish the means and opportunities by which they may make the needs of the missions known in the diocese and. may arouse vocations (n. 38). In arousing vocations for the missions care should be taken to set forth the mission of the Church to all peoples and the ways in which various types (institutes, priests, religious, and lay persons of both sexes) try_ to achieve this mission. Chiefly, however, .the special missionary vocation "for life" (nos. 23, 24) should be extolled and illustrated by examples. 7. The Pontifical Missionary Works should be pro-moted in all dioceses; and their statutes, especially those with regard.to the transmission of assistance~ should be duly obser.ved (n. 38): 8. Since.the .offerings given to the missions by the faithful of their own accord are not nearly sufficient, it is recommended that as soon as possible there .be enacted a set contribution, proportioned to the revenues of each, which both the diocese and the parishes and other group-ings of the diocese should pay each year and which should be distributed by the Holy See, all other obligations of the faithful remaining (n. 38). 9. Episcopal conferences should have an episcopal' com-mission for the missions whose, work it will be to foster among the dioceses missionary activity and consciousness and an abiding attitude of cooperation, to be .in contact with other episcopal conferences, and to, investigate ways in which as far as possible equitable arrangements of missionary help may be safeguarded (n. 38). 10. Because missionary institutes remain very neces-sary, all should acknowledge that they have had the work of evangelization entrusted to them by ecclesiastical au-thority in order to carry out the missionary dutyof the entire People of God (n. 27). 11. Bishops should also use missionary institutes in order that they might enkindle the faithful with a desire for missionary activity; bishops should also furnish them opportunities, right order being observed, of arousing and fostering in young people vocations to the missions and of asking for contributions (nos. 23, 37, 38). In order, however, that greater unity and effectiven&s be achieved, the bishops should use a national or regional missionary council which will consist of the directors of the Pontifical Works and of the missionary institutes existing in the country or region. 12. Each missionary institute should as soon as possible take care of its own adaptation and renewal especial!y with regard to its methods of evangelization and of Chris-tian initiation (nos. 13, 14) as well as to its way of living in communities (n~ 3 of the decree, Perfectae caritatis). 13. - § 1. It is necessary that for all missions there be only one competent curial, department; namely, the Sacred Congregation for the Propagation of the Faith. Since, however, certain missions for special reasons are still subject temporarily to other curial departments, there should be established in these other departments a missionary section that should have close relations with the Sacred Congregation for the Propagation of the Faith in order that in the organizing and directing of the mis-sions a completely constant and uniform norm can be had (n. 29). § 2. To the Sacred Congregation for the Propagation of the Faith are subject the Pontifical Missionary Works; namely, the Pontifical Work for the Propagation of the Faith, the Work of St. Peter for native clergy; the Union of the Clergy for the Missions, and the Work of the Holy Childhood. 14. The president of the secretariat for fostering the unity of Christians is by reason of his office a member of the Sacred Congregation for the Propagation of the Faith while the secretary of the same secretariat is included among the consultors of the Sacred Congregation for the Propagation of the Faith (n. 29). Similarly, the Sacred Congregation for the Propagation of the Faith should be represented at the secretariat for fostering the unity of Christians. 15. In the direction of the Sacred Congregation for the Propagation of the Faith twenty-four representatives take part with a deliberative vote unless in individual cases the supreme pontiff should decide otherwise; namely, twelve prelates from the missions and four, from other regions, four from superiors of institutes, four from the Pontifical Works; all of these shonld meet twice a year. Members of this board are appointed for five years with almost a fifth part being changed every year. When they have finished one term, they can be appointed for an-other five years. In accord with norms to be sent as soon as possible from the Apostolic See, episcopal conferences, institutes, and the Pontifical ~rorks should propose to the supreme pontiff the names of those from whom the supreme pontiff may select the representatives mentioned above as + .+ + Implementation oS Vatican II VOLUME 25, 1966 .967 Paul REVIEW FOR RELIGIOUS 968 well as the names of those, including persons living on the missions, from,whom consultors can be selected. 16. Representatives of religious institutes on the mis-sions and of regional works for the missions as well as of councils of laymen have a part in the meetings of this congregation with consultive vote (n. 29). 17. After consulting the episcopal conferences and mis-sionary institutes, the Sacred Congregation for the Propa-gation of ,the Faith should delineate .as soon as possible the general principles according to which agreements should be made between local ordinaries and mission in-stitutes with regard to" the regulation of their mutual, re-lationships (n. 32). In making these agreements consideration', should be given both. to the continuance of missionary work andoto the needs of the institutes (n. 32). 18. Because~ it is desirable that episcopal.conferences be joined intooorganic groups along socio-cultural lines, the Sacred Congregation for the Propagation of the Fi~ith (n. 29) should promote such coordinations of episcopal conferences. " Together with the Sacred Congregation for.the Propa-gation of the Faith, the work of these conferences~ will be the following: 1°. To seek ways, including new ones, in which by joint effort- the faithful and the missionary institutes may insert themselves into the peoples and groups among whom they live or to whom they are sent (nos. 10, 11) and :with whom they should conduct a dialogue of salvation. 2°. To establish study groups who should investigate peoples' ways of thinking about the universe, about man, and about man's interior attitude toward God and who should subsume for theological consideration'whatever is good or true. Such theological study should furnish the necessary foundation :for making adaptations, the consideration ~of which should also be a duty of the aforementioned study groups. Among other 'matters these adaptations should be concerned with. methods of ~vangelizing, liturgical forms, religious life, arid ecclesiastical legislation (n. 19). As far as methods of evangelization and of catechesis ~a~e concerned, the Sacred Congregation for the Propaga-tion of the Faith should promote close cooperation with advanced-level pastoral institutes. As far as liturgical forms are concerned, the study groups should send documents and opinions, to the Com-mittee for the Implementation of The Constitution on the Liturgy. ~As far as the religious ~state is concerned (n. 18), care should be taken that external form (exemplified by ex- ternal appearances, clothing, arts, and so forth) not be given more attention than the religious characteristics of peoples which should be assumed or assimilated to evan-gelical perfection. 3°. To promote at determined times meetings of those teaching in seminaries in order, after consultation with the study groups already mentioned, to adapt courses of study and to mutually exchange information so that better attention be directed to today's needs in the matter of priestly training (n. 16). 4°. To examine the best way in which manpower (priests, catechists, institutes, and so forth) can be dis-tributed in the territory and especially the way in which care can be taken of the scarcity of manpower in places that are highly populated. 19. In distributing resources a suitable part should be reserved each year for the formation and sustenance of the local clergy, the missionaries, the catechists, and the study groups mentioned in number 18. Bishops should send reports about these matters to the Sacred Congrega-tion for the Propagation of the Faith (nos. 17, 29). 20. A pastoral council should be duly established; its work will be, in accord with number 27 of the decree, Christus Dominus, "to investigate, appraise, and draw practical conclusions about matters pertaining to pastoral works," to do its share in preparing the diocesan synod, and to take care of the execution of the statutes of the synod (n. 30). 91. On the missions there should be established con-ferences of religious men and unions of religious women in which the major superiors of all institutes of the same nation or region should take part and by which their undertakings may be coordinated (n. 33). 22. According to possibilities and needs scientific in-stitutes should be multiplied; they should cooperate by common consent in order that the work of investigation and specialization be well organized; and duplication of works of the same nature should be avoided in the same region (n. 34). 23. In order that immigrants from mission countries be duly received and assisted by suitable pastoral care on the part of bishops of countries who have long been Christian, cooperation with missionary bishops is neces-sary (n. 38). 24. With regard to lay persons on the missions: § 1. Urgent emphasis should be put on the following: sincere intention of serving, the missions, maturity, suit-able preparation, professional specialization, and a suffi-ciently long time to be spent on the mission. ÷ 4. 4- Implementation 'Vatican 11 § 2. Consociations of lay persons for the missions should be effectively intercoordinated. § 3. The bishop of the mission locality should be so-licitous [or such lay persons. § 4. The social security of such lay persons should be safeguarded (n. 41). ,÷ ÷ Paul Vi REVIEW FOR RELIGIOUS 97~ THOMAS BARROSSE, C.S.C. Religious Community and the Primitive Chul'ch In the opening chapters of the Acts of the Apostles St. Luke describes how the Church began her life. The Spirit came. The Apostles preached. The gospel was believed. The believers were baptized, and the Church had come into existence. At the end of Chapter 2, Luke furnishes a vignette of life in the primitive Christian community. In Chapters 3 and 4 he introduces the threat of persecution and opposition. Then, once more, at the end of Chapter 4, he provides a sketch of life in the earliest Church. These pictures presented in Acts 2 and 4 are somewhat idealized. In Chapters 5 and 6, he will. quite frankly fill the shadows in: the deceit of Ananias and Sapphira and the grumbling of the Diaspora Jewish Christians against their Palestinian fellow believers. But he wishes first to present the life of the primitive community in its best light so that the memory of the earliest Apostolic Chureh can haunt his Christian readers down through thd years as a model they will want to emulate. ~ The casual, or even the careful, present-day reader of the Gospels of Mark and Luke might form for himself a rather individualistic conception of the ideal Christian: a person who believes (for "he who believes and is baptized will be saved"--Mk 16:16), who loves (for to the questioia, "What must I do to possess eternal life?" thd answer' is, "You must love the Lord your God. and your neighbor --Lk 10:25-7), who is completely detached (for "he who does not renounce all that he possesses cannot be my dis-ciple"-- Lk 14:33), who remains faithful through tribula-tion (for "he who perseveres to the end will be saved"m Mk 13:13). This conception is false, of course, and the Book of Acts, which shows how what the Lord Jesus pre-pared by His ministry and effected by His sufferings and Thomas Barrosse, C.S.C., is on the staff of the general-ate of the Congre-gation of the Holy Cross; Via Aurelia Antica, 391; Rome, Italy. VOLUME 25, 1"966 " ÷ + ÷ Tho~mas Barrosse, REVIEW FOR RELIGIOUS glory actually came to be, makes it very clear that the work of Christ was the creation of a communily of faith, of love, and of hope in the midst of tribulations. Here is the picture Luke paints in Chapter 2 (vv. 41-5): "Those who received [Peter's] word [with faith] were bap-tized"-- a community constituted by faith and baptism. "They were persevering in the teaching of the Apostles" --a community that maintained itself in existence by nourishing its faith. But also a community of love--for "they were persevering., in the common life--hoin6n[a --[which manifested itself in] the breaking of the bread [--the common, eucharistic meal--] and the [common] prayers" but which manifested itself too in their sharing of material goods since "the believers., considered all things common and were selling their property and be-longings and dividing up the proceeds among all accord-ing as anyone had need." Their love was not restricted to the group: they were an open community since "they were persevering daily in the temple., and enjoying favor with all the people." This same picture recurs in Chapter 4 (vv. 32-5): "The whole multitude of believers were one heart and one soul, and no one said any of his belongings were his own, but all things were common for them . " The shadow of the cross, which already falls across the community in Chapter 4 when Peter and John are ar-rested and threatened, gradually crystallizes into a princi-ple of life. It is finally formulated in 14:22 when Paul points out that only "through many tribulations must we come into the kingdom of God." Let us see how much the thought of this ideal Christian community depicted by Luke in Acts influenced the origins of religious life. Students of Christian monasticism (a way of life that would diversify and proliferate into the many forms of religious life which we know today) usually find its be-ginnings in fourth century Christian Egypt. Before that time there existed in the Church both celibates (especially virgins and widows) and "ascetics" (literally, "exercisers" or "practicers"). The celibates felt that it was given to them to forego married life for the sake of the kingdom of heaven (Mr 19:11 f.) or that they had the gift of re-maining unmarried to give undivided attention to the Lord (1 Cot 7:7 and 32-5). The ascetics applied certain New Testament passages--like Jesus' advice to the rich young man to sell all his belongings if he wanted to be perfect (Mr 19:21)--quite literally to themselves in their attempts to live a full Christian life. But the Christian ideal--or the ideal Christian--was the martyr. The martyr was the believer who by his total self-re-nunciation showed his perfect love--and even the celi- bates and ascetics hoped and prayed for the great favor of undergoing martyrdomA Clement of Alexandria in the third century could echo Ignatius of Antioch and Polycarp of Smyrna in the second in saying: "We call martyrdom perfection (telei6sis) not because the man has reached the end (telos) of his life, as others do, but be-cause he has displayed the perfect (tdleios) work of love." e For this reason, it was the martyr who was considered the Christian most resembling Christ and the Apostles. "The Lord," says Clement of Alexandria again, "was the first to drink the cup . In imitation of him, the Apostles as. perfect men suffered for the churches which they founded." 3 Even before, but especially after, the age of martyrs ended, the Church fathers tried to show that other ideal Christians could be found. They pointed out how espe-cially the celibates and the ascetics were, like the martyrs, "athletes" or "soldiers" of Christ who showed their per-fect faith and love by their perfect self-renunciation. If martyrdom might be called a second baptism, so might profession of the celibate or ascetical life.4 In fourth century Egypt St. Anthony turned the private initiative of scattered ascetics into an organized mass movement. Undertaking the life of an ascetic, he learned this virtuous and prayerful way of life from other Christians who lived it more or less in retirement. He came to appreciate from them how he might more literally put the various suggestions and injunctions of the New Testament into practice in his own life. Then after twenty years of solitude and struggle for mastery over himself, he became, at their request, the teacher of large numbers who were stirred by his example. His contemporary and acquaintance, St. Athanasius, in Chap-ter 1 of his Li~e o~ Anthony describes how the Lord "gave Anthony grace in speech so that., he induced many to choose the solitary life." The biographer con-tinues: "From that time there have been monasteries [that is, hermitages] even in the mountains, and the desert was made a city by monks . " ~ Anthony's dis-course on the ascetic life in Chapters 16 to ~ of this work has even been called the first rule of life for monks. x See St. Athanasius, Life of Anthony, Chapters 46 and ~t7, in Early Christian Biographies, trans. Sister Mary Emily Keenan (New York: Fathers of the Church, 1952), pp. 177-8. a Stromata 4, 4 (translated and commented by E. Malone, The Monk and the Martyr [Washingtou: Catholic University, 1950], p. 5). Religious ~ Stromata 4, 9 (translated [and here slightly adapted] in E. Ma- Community lone, The Monk and the Martyr, p. 6). * Malot~e, The Monk and the Martyr, Chapters Three to Six. ~Athanasius, Life o[ Anthony, in Keenan, Early Christian Biog-raphies, p. 149. VOLUME 25, 1966 973 ÷ ÷ Thomas Barrosse, C,.S.C. REVIEW FOR RELIGIOUS 97,1 At times these "monks" (that is, "solitaries") lived two or more together.~ But their association remained limited and voluntary. They were basically hermits (that is, "des-ert"- dwellers) or anchorites (that is, people in "retire-ment"). This sort of life in modified form has continued on in the Church to the present day--in the West among the Carthusians and the Camaldolese, for example, and in communities of semi-solitaries in the East. It won the ad-miration of the' western European writers of the patristic age, and many of them looked upon it as a higher life than the one to which we now turn. While Anthony lived in northern Egypt, another as-cetic, Pachomius, was organizing the ascetical life on another pattern to the south. After some training in the life under another, older man, he began to gather dis-ciples and train them. He organized them into a com-munity-- koin6nla--the very word that Luke uses in Acts 2:42 to describe the "common life" of the primitive Church. He composed a detailed rule for these cenobites (that is, men with a "common life"). Theodore, close disciple and successor of Pachomius, presents it as a "model for whoever desires to bring souls together ac-cording to God in order that they may become perfect." 7 We must not think of it merely as a practical measure to train fervent individuals. If we read on in Pachomius' life, we find that he worked gradually to dispose his disciples "to bind themselves to one another in perfect community after the manner of what stands written in Acts of the believers: 'They were a single heart and a single soul, and all goods belonged to them in common; there was no one who said of what belonged to him, "It is mine.' . s In addition, they referred to one another as "brothers," the term the Book of Acts and the New Testament epistles use to designate the relationship of early Christians to one another. One of his early lives even describes a visit of Pachomius' disciples to Anthony after their master's death, in which the latter declares "that he gathered souls around him in order to offer them pure to the Lord is a fact which shows that he is su-perior to us and that the way he followed is the Apostle's way, that is, the koin6nia" 9 When Pachomius~ disciples press Anthony with the question: "If the common life . is the higher way of the Apostles, then why did you not live in community.?" the anchorite answers that elbid., Chapters 11 and 91, in Keenan, Early Christian Biogra-phies, pp. 145 and 213. * L. Lefort (ed.), Les vies coptes de saint Pachdme (Louvain: Mu-s~ on, 1943), pp. 60-1. s Ibid., p. 276. 0 Ibid., pp. 3 and 65. he had no choice when he became a monk: there were no communities to join.1° This idea that the common life was, in its original inspiration, an attempt to create an ideal Christian com-munity on the pattern of the primitive Church of Acts 2 and 4 recurs frequently and emphatically in the teach-ing of Pachomius' successors. Theodore, for example, says: "It is by a favor of God. that the holy koin6nla ap-peared on earth., by which he made the Apostolic life known to men desirous of modeling themselves after the Apostles . ,, n The idea is found decades later even among the anchorites of the north. When John Cassian, who clearly regarded the eremitical life as superior to the cenobitic, visited the monks of northern Egypt, them-selves anchorites, he learned their conviction that the cenobitic way of life was the Apostles' own foundation! He cites one of the anchorites he interviewed: The system of Cenobites took its rise in the days of the preaching of the Apostles. For such was all that multitude of believers in Jerusalem which is thus described in the Acts of the Apostles--[he then cites Acts 4:32-5 and 2:45]. The whole Church, I say, was then such as now are those few who can be found with difficulty in coenobia. But when at the death of the Apostles the multitude of believers began to wax cold . those who still maintained the fervour of the apostles, mindful of that former perfection, left their cities and intercourse with those who thought that carelessness and a laxer life was per-missible to themselves and the Church of God, and began to live in rural and more seqnestered spots, and there, in private and on their own account, to practise those things wlfich they had learnt to h~ve been ordered by the apostles throughout the whole body of the Church in general . He goes on to explain how they are called "monks" (that is, "solitaries") because of their retirement and "cenobites" because of their community life. He con-cludes: That then alone was the earliest kind of monks, which is first not only in time but also in grace, and which continued un-broken for a very long period up to the time of Abbot Paul and Anthony; and even to this day we see its traces remaining in strict coenobia. The anchorites, he says, began only with Paul the Hermit and Anthony, who were the "flowers and fruit" of the common life.~2 The monastic life, especially in its Antonian form, spread over Palestine and Syria. After the mid-fourth 10 Ibid., pp. 268 and 323. n H. Bacht, "Pakh6me et ses disciples," in Thdologie de la vie mo1n.aos tCiqoune f(ePraernics:e A18u,b Ciehr,a 1p9te6r1 5), (ptr.a 6n7s.lated by E. Gibson in .4 Select Library o[ Nicene and Post-Nicene Fathers, 2od series, v. 11 [New York: Christian Literature Company, 1894; reprinted Grand Rapids: Eerdmans, 1955], pp. 480-1. . ¯ ÷ ÷ ÷ Religious Communit~ VOLUME 25, 1966 975 ÷ Thomas, BarrCo.sSs.eC, . ~EVIEW FO~ ~ELIGIOU$ 976 century it existed in Cappadocia (what is today south central Turkey) in a form that in many ways strikingly resembles the Pachomian pattern but quite ~possibly without any dependence on Egypt. It found an important organizer and legislator in St. Basil the Great. Cappadocian monasticism was exclusively cenobitic, and Basil's Longer Rules tell us why.13 These rules, more a commentary on monastic life and usages than a set of regulations, .begin (Preface) with the question "Why have we come together?" The answer is: "To live the devout life'S---or "To do what God wants." What he wants, he himself tells us(qq. 1-3): "You must love the Lord your God with your whole heart., and your neighbor." Basil goes on to explain the life of monks as an attempt to prac-tice this love. He emphasizes the need of some degree of retirement from possible distractions and the desirability of association with. like-minded companions (qq. 6-7), but he explicitly rejects a solitary life because the love Christ taught us does not permit each p.erson to look simply after his own. concerns while the solitary life, he says, does just this (q. 7). He buttresses his argument on the need for community by numerous New Testament citations on fraternal charity and union as the distinctive marks of those who are one with Christ. He climaxes his remarks by pointing out that life in community preserves what was "characteristic of the saints, of whom it is recorded in the Book of Acts: 'And all they that be-lieved were together and had all things common,' and again: 'And the multitude of believers had one heart and one soul; neither did anyone say that aught of (he things which he possessed was his own, but all things were com-mon tinto them' " (q. 7).14 So important does Basil consider this' union that he will not permit more than one community-one "fra-ternity" or "brotherhood," ag he prefers to say--in any one town (q. 35). Once more, his climactic argument against division into several communities is the 'ideal picture of the close-knit primitive Church sketched in Acts 2 and 4, to which he joins Paul's description of the Church in Ephesians 4. The Basilian community is not so close-knit as to be cl6sed in on itself. If the Egyptian hermits and communi-ties worked not only to support themselves b~t also to be able to give alms?5 the Cappadocian fraternities ran hospices for the sick and the poor, orphanages, and ~Translated in Saint Basil, Ascetical Works, trans. Sister M. Monica Wagner (New York: Fathers of the Church, 1950), pp. 223- 37. 1~ Ibid., p. 252. ~Athanasius, Life of Anthony, Chapter 43, in Keenan, Early Christian Biographies, pp. 174-5. schools, and considered work for the community or for the outsiders more important than austerities.1° They were in a sense "the nucleus and the elite of the 'parish,' and [their] liturgy seems [to have been] identical with that of the local church, but with this difference that the ordinary Christians did not participate in it except to only a quite limited extent." 17 In the Africa that lay west of Egypt the ascetical lif9 was also known. St. Augustine's name is associated with its organization not only because he was among the firs~ bishops to have his clergy live a monastic life with him but because of the letter (n, 211) in which he prescribes observances for a community of women in his diocese and which seems to be the source of the Rule of St. Augustine. In all his efforts to organize monastic li'fe, lie looked to forming an ideal Christian community after the pat7 tern of the primitive Church of Acts 2 and 4. The com-munity of lay monks that he organized shortly after his conversion had as its model, his early biographer Pos-sidius tells us, the "common life" (societas) lived "under the holy Apostles" in Acts. The monastic organi~zation of his clergy in the bishop's house at Hippo had as its purpose, Augustine himself explains, "that, as far as we can, we may imitate the saints of whom the book of the Acts of the Apostles speaks," and he quotes Acts 4.is In his letter to the community of women mentioned above, he begins: "This is what we prescribe that you observe in the monastery in which you live. In the first place, since this is the reason for your coming together, you must live in unity in the house, and you must have a single soul and a single heart turned toward God. You must not speak among yourselves of personal goods, but rather have all things in common." 10 He continues: "It is thus that you read in the Acts of the Apostles that 'all things were common unto them, and distribution was made to everyone according as he had need.' "20 These texts of Acts depicting the life of the primitive Church haunted Augustine.21 He returns to them no less than fifty-three times in his different works. An examina- 18 C. Butler, Benedictine Monachism (2nd ed.; London: Longmans, 1924), pp. 16-7; J. Gribomont, "Saint Basile," in Thdologie de la vie monastique, p. 113. x7 p. Salmon, The Breviary through the Centuries (Collegeville: Liturgical Press, 1962), pp. 130-1, footnote 4. xs For citations and references see M. Verheijen, "Saint Augustin," in Thdologie de la vie monastique, pp. 201-2~ a9 Ibid., pp. 203-4. ~See the entire letter in Saint Augustine, Letters, trans. Sister Wilfrid Parsons, v. 5 (New York: Fathers of the Church, 1956), pp.- 38-51. The passage cited occurs on pp, 41-2. ~ For most of the following statistics and details see Verheijen, "Saint Augustin," pp. 204--12. + + 4- Religious . Community VOLUME 25, 1966 tion of these passages shows that he recognized in this vignette of the early Church a picture of the community of love which Christians on earth should be, made one in Christ by the presence of the Holy Spirit, Himself infinite love--a unity which is at the same time an antici-pation and beginning of the fuller community of love which the Church will be throughout eternity. The life of communities of monks, clerical or lay, and the life of communities of virgins was simply the realization of this ideal by these people in a way not possible for the gen-erality of Christians. Whet/we examine early European monasticism, we dis-cover a heavy Egyptian influence. All over ancient Christian Europe the eremitical life was known and praised. So was the cenobitic. The great organizer of western monasticism concerned himself only with draw-ing up a rule for cenobites. He organized and modified. Up to the time of St. Benedict, Abbot Cuthbert Butler explains, monks, though looked upon as bound, whether by vows or without them, irrevocably to the practice of the monastic life, so that to abandon it was considered an apostasy, still were not tied to a particular monastery or community, but were allowed with little difficulty to pass from one house to another. St Benedict's most special and tangible contribution to the de-velopment of monasticism was the introduction of the vow of stability . [By this means] he put a stop to such liberty of passage from monastery to monastery and incorporated the monk by his profession in the community of his own monastery. St Benedict thus bound the monks of a monastery together into a permanent family, united by bonds that lasted for life.'~ ÷ ÷ 4- Thomas Barrosse, .S.C. REVIEW FOR RELIGIOUS In examining his Rule the casual reader may feel he finds relatively little beyond Chapter 63 (on the order of the community) about the relations of the monks with one another. Several points, however, deserve attention. It is quite clear that all the "brothers"--that is, all the monks--have a voice in the running of the community. The abbot must submit all important matters for the ad-vice of all the brothers, and in even minor matters he must get the advice of at least the older members of the community (Chapter 3). It is clear too that the common life means not only living in the same monastery and praying and eating together but also having all material goods in common--hence, a really extensive sharing of life. In this context the Rule cites Acts 4 three times over.23 .~o ~B Iunt lCerh,a Bpetenresd 3ic3ti n(we hMeothnearc hmisomn,k psp s. h2o7u-8ld; have anything of their own), 34 (whether all should receive necessities in equal measure), and 55 (on the brothers' clothing and footwear). The Benedictine Rule (Prologue) declares as its pur-pose to establish a "school of the Lord's service"--not, however, in the sense of a place one leaves (for example, for eremitical life) when he has learned what is taught there. It is written (as the Prologue goes on to say) for those who will "persevere in the monastery until death." The expression "school" occurs of the Church itself in Christian literature of the patristic period (for example: the school of Christ as opposed to the schools of the philosophers).~4 It is not at all unlikely that it is meant to designate the monastery simply as a community where the Christian life can be lived progressively bett6rmand, of course, the Christian life is radically altruistic. The original Benedictine community was by no means closed in completely on itself. Chapter 53 of the Rule (on the reception of guests) has made BenediCtine hospi-tality proverbial. The monks', readiness to evangelize the countryside around their monasteries (for example, at Monte Cassino) and to go on foreign missions (for ex~- ample, Augustine and his companions, who went to England at Gregory the Great's behest) as well as to open monastic schools shows that they were disposed to work for the larger Christian community both outside their monasteries and in themY~ In short, in this respect the Benedictine community resembled the Basilian--Bene-dict says (Rule, Chapter 73) he owes much to his eastern predecessor--and even surpass~ed it. We may sum up what we have seen so far. Th~ phe-nomenon we call religious life originated in fourth century Egypt where Anthony and Pachomius gave as-cetics an organized way of life to follow. It assumed two forms: the eremitic or solitary form (Anthony's) ' and the cenobitic or community form (Pachomius'). The latter developed remarkably--perhaps independently of Egypt --in Cappadocia under Basil. It also found a great fifth century African organizer in Augustine and a sixth century European organizer in Benedict. Pachomius, Basil, and Augustine found the model of what they ,d~re trying to create in the idealized sketch of the primitive community of faith and fraternal love which Luke pre-sents in Acts 2 and 4. Though the inspir~ition of this vision is not so evident in B~nedict, his Rule, by its introduction of stability, mdr~ effectively provided for ~ permanent community in which the Christian life could be lived to the full, Now let us ask briefly about the other three.elements which today, with the common life, form the canonical -°4 See La R~gle du Maitre, ed. Adalbert de Vogii~, v. 1 (Paris: Cerf, 1964), pp. 115-6. = Butler, Benedictine Mona~hism, pp. 389-90, nuances this state-ment. Religious ~ommunity VOLUME 25, 1966 ÷ Thomas Barrosse, REVIEW FOR RELIGIOUS 980 minimum for the religious state: poverty, chastity, and obedience. How were they viewed by the great organizers? It has been customary for centuries to look upon these three--religious poverty, celibacy, and obedience--as an asceticism meant to counter the obstacles to love, in which, of course, the perfection .of the Christian life consists,zn Today, when it has become the style to dis-parage asceticism, this conception has lost appeal. We must recognize quite frankly, however, that in the early centuries of organized monastic life celibacy and poverty and obedience were repeatedly presented as an asceticism --that is, as a tangible expression of that readiness to leave all for Christ which we can call detachment and which is the necessary condition for love. But--what is of more importance for us at the moment--they were also looked upon as being in themselves expressions of love and means to create the ideal Christian community. The case of poverty is clearest. It is true that we can find numerous passages in the sources we have been con-sidering in which the abandonment of material posses-sions appears as a renunciation--a giving up--of material goods. It appears as a means to cast off "anxiety for the morrow" (Mt 6:24). It is presented as getting rid of one's goods preliminary to the following of Christ (Mt 19:21). But even in the case of the anchorites--for example, Anthony himself--disposing of one's goods usually takes the form of selling them to give the proceeds to the poor in accord with Jesus' counsel to the rich young man (Mr 19:21).27 Even more, after the initial renunciation, the cenobite's possession of anything as his own is r~gularly exchtded by our sources as being opposed to a truly common life. Citations from Acts 2 and 4 freque.ntly serve to exclttde private possessions precisely as infidelity to full community of life. Many of the passages examined above will illustrate this if they are reexamined. Let us, instead, examine one other. St Augustine in his treatise on the Work of Monks indicates both renunciation and community as involved in monastic poverty.~s First, renunciation. He writes: Let us suppose a person is converted to this life from a life of luxury, and that he is afflicted with no physical infirmity.,Are we so incapable of understanding the sweetness of Christ that we do not know how great a swelling of deeply rooted pride is healed when, after the removal of the superfluities with ~See John Cassian, Conference 1, Chapter 6 (in Gibson, Nicene and Post-Nicene Fathers, 2nd series, v. I1, p. 297); Thomas Aquinas, Summa theologiae 2-2, q.186, a.7. ~rAthanasius, LiIe o] Anthony, Chapters 2 and 3, in Keenan, Early Christian Biographies, pp. 135-6. ~ Chapter 25, translated in Saint Augustine, Treatises on Various Subjects, trans. Sister Mary Sarah Muldowney (New York: Fathers of the Church, 1952), p. 377. which his spirit was fatally possessed, the humility of the worker does not refuse to perform lowly labors to obtain the few supplies which remain necessary for this natural life? Secondly, community. He continues: If, however, a person is converted to this life from poverty, let him not consider that he is doing merely what he used to do, if, turning from the love of increasing his own private fortune, however little, and no longer seeking what things are his own but rather those of Jesus' Christ, he has devoted him-self to the charity of common life, intending to live in com-panionship with those who have one heart and one soul in God, so that no one calls anything his own but all things are held in common. Celibacy, of course, was practiced by Christians from the New Testament period itself. The motive St. Paul assigns for it in 1 Cor 7:35 is contemplative: to provide "undivided attention to the Lord." The motive Jesus as-signs in Mt 19:12: "for the sake of the kingdom of heaven" (which means "for the sake of the reign of God") can be considered apostolic: that is, celibacy to devote oneself wholly to the spread of God's reign by the preach-ing of the gospel. After all, injunctions to go out to pro-claim the kingdom without delaying even to bury one's father or to take leave of one's relatives occur in the Gospel (Lk 9:57-62; see Mt 8:19-22). Among the Pachomians, Theodore says: "Let us pre-serve the gift [a reference perhaps to the 'gift' of celibacy mentioned in 1 Cor 7:7 or possibly Mt 19:11] which has come to us beyond the deserts of our efforts. Let. us preserve the law [of the koin6nla], each one of us being a subject of edification for his neighbor." And a recent commentator remarks: The edification of one's neighbor--which means, immedi-ately, of one's brothers--is an essential element of the law on which the koin6nla rests. The realization of this law can-not be attained except when the bonds of purely natural love 'according to the flesh' have been broken and all the brothers bound together in a spiritual love. From this source come repeated regulations prescribing separation from one's family and controlling relations witl~ those who are related by blood.-~ Basil too--one more text will have to suffice--sees the renunciation of one's own family--and even more of a family of orie's own--aS a means to be "brother" equally to all members of the brotherhood. He writes: ÷ Superiors should not allow those who have been perma- ÷ nently admitted to the community to be distracted in any + way--by allowing them either to leave the company of their brethren and live in private on the pretext of visiting their Religious relatives or to be burdened with the responsibility of caring Community for their relatives according to the flesh. The Scripture abso-lutely forbids the words "mine" and "thine" to be uttered ~ Bacht, "Pakh6me,'" pp. 67-8. VOLUME 25, 1966 among the. brethren, saying: "And the multitude of believers had but one heart and ~ne soul; neither did anyone say that aught of the things which he possessed was his own." The par-ents or brothers of a membe; of the community, therefore, if they live piously should be treated by all the brethren as fathers or other relatives possessed in common: "For whosoever shall do the will of my Fathe~ that is in Heaven, he is my brother and sister and mother," says the Lord. In our opinion, moveover, the care of these persons would devolve upon the superiOr of the community.so + + + Thomas Barrosse, C.S.C. REVIEWFOR RELIGIOUS We may find this position somewhat extreme by our standards. The basic understanding of celibacy is what makes the text important to us at the moment, and that basic understanding is clear: the. foregoing of family re-lationships is .the means to effect a more perfect com-munity of life with a larger number of fervent Ghristians. Obedience is more difficult. The anchorite placed him-self under a master or teacher to be trained in overcoming self-will but especially to be educated to the ascetical life. Obedience was an asceticism or a disciple-master re-lationship. The' arrangement was voluntary. The leader-ship of communities was Charismatic: Pachomius' virtue explains the following he had, and after his death his community almost disintegrated more than once until his disciples could agree that the successor was equipped to guide them as Pachomius had been. For Basil, the role of the superior (or the superiors--since there can be several in one "brotherhood"---qq. 26 f.) is to direct and guide the individual "in everything." So too in Augustine (Letter 211). The superior, in short, appears as a sort of rnagister. 'Before thee introduction of stability, the monk could move to another community if he was not satisfied with the gu, idance he was given. When the community became fixed and the superior-ship more institutional, the situation changed somewhat. It~must be admitted that superiors were elected--presum-ably for their leadership qualities. But if the choice was limited to members of the community or other considera-tions Anfluenced the voting, obedience might possibly place a monk under a poor master, and remaining in-definitely under his authority would then be nothing more than ~an indefinitely prolonged asceticism. But perhaps we have missed an important aspect of the superior's role more implied than explicitly stated in our sources--that is, the position of the superior as the center of unity for the community. From the end of the very first Christian century we have a heavy emphasis on the head of the local Christian community, the bishop, as the foctts of the Church's unity, This seems to be the so Question 32, translated by Wagner in St. Basil, Ascetical Wor. ks, p. 295. meaning of Ignatius of Antioch's axiom: "Where the bishop is, there is the church." 81 We must reflect for a moment on this third and perhaps principal dimension of authority as a necessity for any and all community and of obedience as being first and directly the insertion of oneself into a community---or gift of oneself to a communitywand only secondarily and consequently the placing of oneself under a su-perior's authority. The extent of any superior's au-thority is determined by the nature of the community in which it is exercised. If the authority of superiors is so extensive in religious life, it is precisely because the gift we make of ourselves to the community is so extensive: we undertake the sharing of practically the whole of our lives with others--prayer, work, responsibilities, material goods, and so forth. How the authority is exercised--for example, by frequent peremptory commands or by dis-cussions in which a superior usually agrees with the con-sensus reached--is quite incidental to this aspect of re-ligious obedience (though it is less so, of course, to obedience as an asceticism). It might be pointed out parenthetically, however, that the way in which the highest (episcopal) authority was actually exercised in the patristic Church and the way Basil and Benedict speak of superiors exercising their attthority suggests a procedure closer to the second than to the first of these two extremes,a2 Looking ttpon obedience as being sub-stantially the gift of oneself to a community means look-ing upon it in a very ancient and traditional way and perceiving it as an influence over the individual religious in his whole community life, even when the superior actually intervenes only rarely. We have been all too brief in our consideration of poverty, celibacy, and obedience. But perhaps we have 21 See V. Corwin, St. Ignatius and Christianity in Antioch (New Haven: Yale, 1960), pp. 80-7, 192-8, 214, and 256-7. Ignatius phrases it slightly differently in his letter to the Smyrneans 8, 2. Why else is nothing to be done "apart from" the bishop and only that Eu-charist is to be considered valid over which he presides or someone named by him (Ad Smyrn. 8, 1)? He is certainly not thinking of a "power of orders" to confect sacraments or of a "power of jurisdic-tion" if we are to judge from the main thrust of his arguments. There is no church apart from the bishop because he is its "center of unity," to use the phrase Vatican II applies to him in its Decree on the Missionary Activity o~ the Church, n. 30 (just after urging all missionary workers to have but one heart and one soul in accord with Acts 4:32). Interestingly, the Rule of Taiz~ (Taiz~: Presses de Taiz~, 1965), p. 55, opens its treatment of the prior (which is its treatment of obedience) with a brief paragraph on the need for nnity; then it explains: "The prior focuses the u6ity of the commu-nity." ~See Y. Congar, "The Hierarchy as Service," in his Power and Poverty. in the Church (London: Chapman, 1964), pp. 15-79, espe-cially from p. 40 on. + ÷ ÷ Religi~s Community 98-3 ÷ ÷ ÷ Thomas Ba~rosse, C.~.C. REVIEW FOR RELIGIOUS 984 spent enough time on them to show that all the essential elements of canonical "religious life as we know it in the Church today can be conceived of just as the cenobitic life as a whole was at its origins: as part of the attempt to create an ideal Christian community on the model of that idyllic picture of the primitive Apostolic Church which St. Luke presents in the opening chapters of Acts. That the apostolates of the active communities can be fitted into this picture too should be clear from what we have seen of the openness to the needs of the Church of their times exhibited by the Basilian, Augustinian, and Benedictine communities. To show that this concept has not been lost between the origins and our own day, let us conclude with two texts. The Pontificale Romanum, dating substantially from the Middle Ages, contains a ceremony for the profession of an abbot--to be used before he is blessed in case a novice or someone not a member of the order in question should be elected. At the end of the Ceremony, the pre-siding bishop gives a short explanation of what he has done in accepting the profession: Although all of us through th~ grace of baptism are brothers in Christ and have one Father in heaven if, to the best of our ability, we do what he commands, without any doubt we are most closely united when we join ourselves to one another in ~common] prayer and mutual service just as we read the holy tathers in the primitive Church, who had but one heart anal one soul, did. Many of them, their hearts inflamed with the love of Christ, sold their posSessions and material belongings, gathered the proceeds together, and brought them in joy (o t~e Apostles. The Apostles took these proceeds and distributed them to all in accord with the needs of each. So it is that this man [newly professed], under God's inspiration and encouraged by their example, desires to be joined to the community of the religious of [this order]. We grant him

Issue 18.5 of the Review for Religious, 1959. ; ~ Review for Religious SEPTEMBER 15, 1959 Friendship'~ Among Religious By Columban Browning, C.P. 257 Conquering Serious Sin By John C. Schwarz, S.J. Perpetual Vows, ~ By Hugo j. Gerleman, S.J. Mother Anna Tabouret By Sister Mary Kenneth, H.H.M. 265 273 279 Survey of Roman Documents Views, Newsi Previe~ ~ Questions and Answers Book ReviewsEi" VOLUME 18 293. 3bo 303 °- NUMBEK 5 Volume 18 Septem.ber 15~ 1959 Number 5 OUR CONTRIBUTORS REV. COLUMBAN BROWNING is stationed at Mother of Good Counsel Seminary~ Warrenton, Missouri. REV. JOHN C. SCHWARZ is stationed at 892 W. Boston, Detroit 2, Michigan. REV. HUGO J. GERLEMAN is instructor of tertians at St. Joseph Hall, 2601 North Union, Decatur, Illinois. SISTER MARY KENNETH is stationed at 17435 Northwood Avenue, Lakewood 7, Ohio. REVIEW FOR RELIGIOUS, Sept. 1959, Vol. 18, No. 5. Published bi-monthly by The Queen's Work, 3115 South Grand Boulevard, St. Louis 18, Missouri. Edited by the .Jesuit Fathers of St. Mary's College, St. Marys, Kansas, with ec-clesiastical approval. Second class mail privilege authorized at St. Louis, Mis-souri. Copyright, 1959, "by The Queen's Work. Subscription price'in Ior. S. A. and Canada: 3 dollars a year; 50 cents a copy. Printed in U. S. A. Editor: R. F. Smith, S.J. Associate Editors: Augustine G. Ellard, S.J.; Gerald Kelly,, S.J.; Henry Willmering, S.J. Assistant Editors: John E. Becker, S.J.; Robert F. Weiss, S.J: Departmental Editors: Joseph F. Gallen, S.J.; E~arl A. Weis, S.J. Please send all renewals, new subscriptions, and business correspondence to: Review for Religious, 3115 South Grand Boulevard, St. Louis 18, Missouri. Please send all manuscripts and editorial correspondence to: Review for Religious, St. Mary's College, St. Marys, Kansas. Friendship Among Religious Columban Browning~ C.P. IT WOULD BE HARD to find a religious who has not been warned about the dan'ger of particular friendship. It would be equally hard to find a religious who has not experienced an amount of conflict in striving for a balanced attitude toward friendship. Most religious have heard the warning about particu-lar fr.iendship many.~times: in the novitiate, in retreats, in monthly conferences, and in spiritual books. The warning about false friendship is, of course, a very necessary one. There can be a real danger of forming an exclusive friendship that hinders a religious in the singular love of God that is the primary goal of the 'religious life. Such a friendship can even become a serious threat to the chastity that religious pro-fess. Religious souls sacrifice the normal outlets of their emotions which other young people find in the married state. Since com-plete adjustment to a life of chastity is not always easily attained, there is a natural tendency for religious to seek emotional com-pensation in those closest to them, namely, their fellow religious. The danger of this is greatly aggravated in one who is not fully mature in his emotional life. And it is often a common danger for those who are new in the religious life. These newcomers in the religious life are in a process of adjustment, and it is easy to understand that they may meet with an amount of emotional tension. This tension can easily seek relief in the exclusive attach-ment to a fellow religious. Our purpose here is not to repeat the age-old and ~¢ery neces-sary warning. Enough has been said about this already. The nature and signs of false friendship are sufficiently known to all: exclusiveness, jealousy, the need for signs of affection, daydream-ing about the 'friend,' and so on. We presume this knowledge, and we fully realize all the potential dangers involved. Our purpose here is to suggest that overemphasis of the dangers of particular friendship may perhaps produce a very harmful effect. And this effect is to make religious afraid to have any friends, It may even give rise to a general atmosphere in a 257 COLUMBAN BROWNING Review for Religious religious community in which all friendships are looked upon with an eye of suspicion. Corruption in the arts can tear down rather than build up, and so can the corruption of friendship. But just as we do not condemn beauty as such because of its abuses, so also we must not despise friendship just because it sometimes goes awry. Particular friendship is a characteristic of the emotionally immature religious. There can be a place in religion for those who are lacking somewhat in maturity though they may require more in the way of protection and guidance. But we feel that the greater number of religious are mature enough to avoid the corrupting force of particular friendship. And this being so, is it right that all religious be deprived of good healthy friendship just because for some it is a grave danger? In other words, it is a question of proper balance. If a sane and balanced view is not taken by superiors as well as individual religious, there is a serious danger that an atmosphere emerge in which human hearts must of necessity turn to granite. The result will be that the warmth of charity will vanish and a cold, im-personal spirit will chill the very life of the community. Friendship is an .integral and very necessary part of human life. It is one of the good and higher things of life that can be a positive help toward a more whole-hearted love for God. Just as music, art, literature, and beauty of all kinds are intended to lift up the mind and heart to God, so also is God's gift of friendship. The inspired word of God more than once praises the boon of friendship. We read in the Book of Sirach: "A faithful friend is a sturdy shelter; he who finds one find~ a treasure. A faithful friend is beyond price, no sum can balance his worth. A faithful friend is a lifesaving remedy, such as he who fears God finds; for he who fears God behaves accordingly, and his friend shall be like himself." (6:14-17) This being so, surely good wholesome friendship should not be excluded from the religious life without a ,hearing. The lives of many religious saints strongly endorse the words of Sacred Scripture. As examples, we need only recall the strong bond of friendship that existed between St. Teresa of Avila and Mother Anne of Jesus or that between St. Therese and her three sisters in Carmel. The friendship of these holy souls was certainly 258 September, 1959" FRIENDSHIP AMONG RELIGIOUS not a hindrance but rather a. help to their more perfect love of God. That such has been the case in the lives of these great saints should be proof enough that friendship in itself is a gift of God for our sanctification. The Need for Human Friendship No human being can live a normal life without friendship. God made man a social being, and his entire life is lived in the company of others. God gave man this company because by his nature he needs it. This need is greater in a woman than in a man. A woman has greater emotional needs, and one of these needs is for support in her strivings. When a young persdn steps inside the door of a novitiate, he does not leave this basic need behind him. By that step he sacrifices the normal means of finding his support. But the need very definitely remains. Pope Pius XII singled out this fact in the words he addressed to the superiors general of religious women assembled in Rome in 1952. He said! And now dearest daughters, we pass on to exhort yo~ urgently on two points. First, motherly affection in the guidance of your Sisters. ¯ Psychologists say, and it is probably true, that when in authority it is harder for woman' than for man to find the exact balance between severity and kindness. This makes it all the more necessary fo.,r you to cultivate your motherly feelings. Remember that for your sisters, as for yourselves, religious life demands a great sacrifice. They have given up their families, the joys of married life and a home of their own. It is a sacrifice of great worth and importance for the apostolate of the Church, but it is none the less a sacrifice, and those possessed of greatness of soul and delicacy of sentiment feel it the most keenly . . . and you as superiors general should be the first to breathe into the common life of your sisters the warmth of family love. (Acta et Documenta, 1952, p. 333) When a young person enters the religious life, he is de-termined to surrender his whole heart and soul to God -- to find in Him the complete realization of all his ambitions. He is putting himself on the way to that goal. But he is not ordinarily capable of that whole-hearted love from the beginning. As he learns the first steps of religious life, he will need the strong support and encouragement of the Master or Mistress. Even when he finishes the novitiate, he will not be completely rooted in God, so that he will still need human support. To his dying day, in fact, he will most likely be very much on the way. He will, in other words, need strong human support all along. 259 COLUMBAN BROWNING Review for Religious He may find this support in his superiors, his confessor or spiritual director. But realism forces us to admit that a religious frequently does not find the most ideal support at these sources. Personalities enter in; there is fear of authority'that lurks in the minds of so many, to say nothing of the many other compli-cating, factors. Frequently, therefore, a religious may need the firm support that comes from friendship. And where should he look for this friend if not among his fellow religious? A true friend will not aggravate the burdens by agreeing with all com-plaints but will rather animate the confidant to bear his trials patiently and help him to reach higher in his spiritual ideals. It all comes down to this: When a religious is learning to love God with all his heart, and all his life he is learning this, he cannot live in an absolute vacuum. Being human, he will need the firm support of human friendship. If he tries to live without this or if circumstances force him to live without it for a long time, there is grave danger that his ideals will gradually diminish. From sheer lack of ability to "go it alone" he is apt to find him-s~ lf falling back rather than going forward. And in this situation he may find himself turning his attention back to the things that he has given up, and sooner or later he will realize that he no longer has any real desire to live all for God. We wonder how many ex-religious would still be happy religious today if they had had the support of true and loyal friends. From what has been said, it may appear that relying on the help of friends is a very imperfect thing in itself, and may be admitted only as a crutch for the beginner. But such is not the case. In God's plan of providence He has made man with a n~ed for friendship, and He intends that it be an important factor in his sanctification all through life. St. Aelred, who has written a beautiful treatise on this subject, makes this" clear. He says that friendship "is possible between the good, it makes progress between those who are better, and it is consummated between those who are perfect." He also says: "Wonderful must he be who can afford to do without friends and without love. More wonderful than God Himself." (De amore amicitiae) St. Teresa of Avila stresses the advantages of friendship in living a spiritual life when she says: It is a great evil for a soul to be alone in the midst of such great dangers . I would advise those who are giving themselves to prayer, particularly at first, to form friendships . . . with those who are doing 260 September, 1959 FRIENDSHIP AMONG RELIGIOUS the same thing. It is a matter of the last importance, even if it lead only to helping one another by prayer . Now, if in their dealings with one another, and in the indulgence of human affection not even of the best kind, men seek friends with whom they can refresh themselves. I know no reason why it should not be lawful for him who is beginning to love and serve God in earnest to confide his joys and sorrows to another. [Life of St. Teresa of Jesus, trans, by David Lewis (West-minster: Newman, 1943), ch. 7, pp. 54-55,1 From such ahthoritative statements it is evident that true friendship between human beings is patterned after God's own friendship with man and that its goal is closer union with God Himself. As the austere hermit St. Peter Damian so beautifully expresses it: "When I look on thy face, on thee who are dear to me, I lift my gaze toward Him Who, united to thee, I desire to reach" (Letters, 2:12). Still on the psychological plane, let us consider the matter in relation to the religious vow of chastity. Dangers to chastity are usually cited as the motive for avoiding particular friendship. But may we not say that true and healthy f~riendship can be one of the greatest protectors of chastity? The religious has sacrificed the normal emotional outlets. Keeping his basic emotional needs he is, in a sense, in a state of violence in the religious life. Here we must recall what we have already said -- that the religious is destined to find his all in God, but that reaching this goal is a life-long process. The warmth of well regulated fri~nd-ship is the normal and God-given support to help the religious to learn to live entirely for God. When he has the comfort of such friendship, he will ordinarily tend to regret less what he has given up. As a result he will find more contentment and natural joy in the religious life. Without this support he is apt to ex-perience a kind of emotional starvation. S~ch a state produces tension, and tension is a fertile source of unlawful desires. A tense religious is in danger of acting hastily and seeking com-pensation for what he is missing. Much of this tension could be avoided if the religious did not feel so alone and unwanted. True supernatural love and friendship, in other words, can give the religious a sense of dignity that fosters purity. Another thing that may be to the point here: There seems to be an ever increasing number of religious who suffer from what doctbrs call psychosomatic illnesses. Ailments develop for which the physician can find no physical cause. Doctors usually diagnose these ailments as being the effect of nervous tension. How many 261 COLUMBAN BROWNING Review for Religious of these poor religious feel that they have any real friends in the religious life? Must we not say that much of this could be avoided if the medicine of human friendship were in better standing? The best antidote to tension and nervousness is contentment. And human nature is ordinarily not contented and at rest without the warmth of human love that is the effect of friendship. Certain Qualifications Lest we appear to be a little too idealistic and too trustful of human nature, a number of qualifications may. be in place. The first has to do with the need for universal charity in religion. We know that charity toward all was one of the key doctrines of our Lord. And since the religious life is the embodi-ment of His teaching, it is obvious that supernatural, universal charity must always hold a prominent place in any religious community. At first sight our proposal may sound like a denial of this. If misunderstood and misinterpreted, it could .indeed become such. No religious can ever exclude anyone from his charity. As far as community life is concerned, a uniformity and consistency must be observed in all dealings with fellow religious. But at the same time it is contrary to human nature itself to expect a religious to feel the same toward all. Inevitably he will feel closer to some than to others, and he will be able to speak more freely and confidently to these. It is among these that he will normally be inclined to seek his friends. To expect otherwise would be to. do violence to human nature itself. And we need to recall that human nature is not destroyed but rather elevated by living a spiritual life. At the same time, preference for these few should never lead the religious to spend all his time with them or to form a clique with them. When this happens, we have a counterfeit of true friendship that is inconsistent with" the religious life. True friendship does not narrow the human heart but rather expands it and makes it capable of loving all more. When we think maturely, we judge things by their true nature rather than by their occasional abuses. Are we, therefore, to forbid all re-ligious to have any friends just because there is some danger of abuse? The occasional abuses should be dealt with individually 262 September, 1959 FRIENDSHIP AMONG RELIGIOUS rather than be considered a pretext to~condemn the entire tree because of a few bad fruits. Another necessary clarification pertains to superiors. It is a good and true principle that a superior should deal with all his subjects alike. It is a false principle, though sometimes quoted, that a superior should have no friends. A superior must maintain an equality in all his external dealings with his subjects. But he too is human and needs a friend -- perhaps more than does the ordinary religious. The very burdens he bears may require that he have some human support lest those burdens crush him. To deny him this outlet is to be cruel and inhuman. Of course, such a friendship in a superior contains potential dangers. There'is the danger of his showing preference for his friends in an external way, to the great detriment of peace and contentment in' the community. There is the further danger of his letting his friends determine his policies as superior, also a grave abuse. But again, are we to condemn something that is good and necessary in itself just because of a few abuses? The surest way to avoid such abuses is by appointing only those as superior who are mature enough to exercise prudence and good judgment. Very small houses present a problem all their own that needs to be considered. The fewer the number of religious in a house, the greater is the need for universal charity and: the greater need for one or two friends to avoid isolating themselves from the rest. There is no need to stress the severe trial of living in a small house that is divided. But again we must remember that this state of things is a counterfeit of true friendship, and the whole question of friendship should not be judged by such abuses. A religious who is assigned to a small house may find him-self in a situation in which close friendship is practically im-possible. His companions are few, and he may not be able to feel close to any of them. The same inability to make friends may arise from other circumstances, even in larger houses~ When such situations exist, the religious is forced to, do without what is ordinarily necessary for happy living. But the religious who has cultivated only healthy friendships will be able to meet this challenge and will accept this cross from the hands of God for his purification. If we are to be purified and made capable of loving God more, we must a~ept the crosses that God sends. 263 COLUMBAN ]~ROWNING And just as He sometimes cuts away other supports that are ordinarily considered basic necessities in order to purify us, so also in the case of friendship. The religious must therefore be prepared for such situations and must see them in the light of God's all loving providence for him. Bearing this cross patiently will expand the heart and equip the religious to be more mature in friendship when the opportunity for them arises again. Finally, lest we give the impression of overlooking in practice the real danger of friendship becoming particular and exclusive, another clarification is in place. Of course, there is always an amount of danger of this. Even a true and healthy friendship can deteriorate. But this is a matter to be dealt with in particular cases. For many there is practically no danger of particular friendship. For most the danger is remote. For some it may be called serious. These particular dangers should not determine the mentality of a community toward friendship so that every-one who has a friend is considered suspect. A community that adopts this attitude as a more or less official policy creates a situation in which Christian charity is severely paralysed. Instead of the religious "living together in unity" and working together in the charity of Christ, bickering, discontent, selfishness, and downright cruelty can become the order of the day. When religious are forced to live in such an atmosphere, the heroism that is so necessary for anyone to develop the fulness of Christ is frustrated, o ¯ Conclusion The religious life has as its goal the binding of human hearts more closely to the God of all love. In striving for this goal, ev.ery religious is held back by the limitations of fallen human nature. Because of these limitations and the consequent failings that somewhat mar the perfection of every religious soul, there is a tendency to emphasize the negative to the detriment of the positive elements of the religious life. When a general atmosphere of negativism arises in a religious community, the vital spirit of the members of that community is severely paralysed. We feel that this negativism too often shows itself in the attitude toward friendship. May God speed the day when His wonderful gift of friendship is judged, not by occasional abuses, but by the positive incentive it provides for a whole hearted search for God. 264 Conquering Serious Sin John Co Schwarz, S.J. INA MEMORABLE address to the clerical students and priests at the Catholic University some months after her entrance into the Church, Clare Boothe Luce commented on the singular importance of love in the service of God. "All the world they say, loves a lover . And never before have I been together with so many young men who are deeply in love, for the first and last times in their lives. For you are to be the truest of all lovers: the priests of God's altars." Her graceful words a~e easily extended to all who consecrate themselves to life with Christ, to life with Love. For the religious deeply feels that his or her vocation precisely consists in striving to be "the truest of all lovers." But lofty as such aspirations surely are, the weight of d~ill human nature remains a constant factor and a daily experience. The actions of no less a saint thaff His own first vicar drew from' our Lord the comment, "The spirit indeed is willing, but the flesh is weak." Thus serious sin, the sorry surrender of the high aspirations of love, remains a possibility even for men and women who have taken their place in the consecrated, protected ranks of religious life. Temptation, even sharp temptation, remains altogether possible. The free-living and often loveless world around us will attempt to turn that possibility into glittering reality. And the urges and impulses of fallen human nature, pressuring from within, may add further strain. Hence, this presentation of basic reflections, remedies, and counter-measures against serious sin may not be amiss. Because the flesh remains weak, therefore serious sin cannot yet be filed under "impossibilities," and forgotten. Moreover, the experience of mortal sin could prove as productive of be-wilderment as of remorse. Nor will sure counsel and direction always be at hand. Especially if the experience were to be com-plicated by the shock of repetition, the path ahead could become greviously entangled. Hence some considerations on this little-frequented area of religious life may be of interest even to "the truest of all lovers." Now even serious sin can produce some profit, if the ex-perience prods one into a necessary check-up on key points of 265 JOHN C. SCHWARZ " Review for Religious religious observance and consecratip~i~ As physical pains signal the need for medical care, perhaps heretofore ignored, so it is with conduct of which conscience has voiced flat disapproval. A deepened sense of authentic humility can also result, as well as an increased, practical sympathy for the trials which others are experiencing from time to time-- students, for instance. And one will surely learn that mere general exhortations to avoid temptation may help little when the danger is close and vividly felt. Check Fading Motives But to check the key points of one's ~eligious observance, a valuable technique for av.oiding mortal sinas well as for remedying it, will involve attention to far more than me.re.exterior regularity or promptitude. That does have its importance, definitely. But the giant-step forward will be taken with the realization that serious sin, especially when repeated, exposes the slow fading of true values in the mind. The key to decisive will power, as Father Lindwo~sky has so strikingly demons.t~a.ted,1 lies in the vital realm of motivation. One's spiritual motives or values may have become, distant relatives living in the suburbs of the mind, ac~n?wledged, recognizable -- but t~ken for granted. Such ¯ motives perhaps no longer m?tivate,, or at least are diminishing in their impact on daily thought a.nd conduct. New knowledge is not the primary need, nor some scheme for "developing will power" after the manner of strengthening a muscle. Rather, persuade those distant relatives to move once again into the immediate family, day by day and hour by hour. Deep., attentive meditation with our blessed Lord on the basic truths of existence becomes necessary. Such truths are presented to the mind and heart in the annual retreat when reflections are made on the purposes of the vows, on our origin and diVine destiny, on the practices of religious life, on Christ's love as the only. happiness for the religiou~ soul. Possibly medi-tation has been failing to cut through the too-familiar exteriors of truths considered, and examinations of conscience may have ¯ lagged in their role of providing re-nourishment at crucial points in the exhausting day. Perhaps bit by bit the mind has slipped into the heresy that what Christ asks first is service, action, ~Johann Lindworsky, S.J., The Training of the Will (Milwaukee: Bruce, 1929). 266 September, 1959 CONQUERING SERIOUS SIN results, success, achievement -- an attitude more "at home" in General Motors -- failing in daffy practice to see that what He seeks is my whole mind, my whole heart, my whole soul -- in a word, myself. For that is what He has offered to me: Himself!. Temptation Topples Weak Motives Amid the undeniably wearing regimen of a long year teach-ing or nursing, the intimate grasp of the mind on basic truths, and above all on Him whom we love can falter. All feel this in greater or lesser degree. Add a sizeable f~ding of spiritual values with a startling growth, on a particular occasion or over an ex-tended period of time, in vividness of some temptation and trouble may loom just ahead. Or again, if sound and cherished values fade, the onslaught of some unforeseen crisis -- whether with superiors, students, declining health, or something similar -- will find human nature subtly craving compensation. If Christ becomes remote, thickets of temptation will crop up close. These foregoing notions, largely based on the scientific research of Lindworsky, a renowned priest-psychologist, find an interesting echo in the distinguished spiritual author, Father Edward Leen: "We fail, not because our wills are irresolute "or our passions strong -- but because we allow our intelligence to be obscured as to the meaning and purpose of life.~ It is no~ s0~ much our will that is at fault as our intelligence.'"-' If such notions seem to some an overly-academic approach to a concrete problem of serious sin, it may be noted that there is little of novelty here. Christian philosophers have been teach-ing for centuries that the will, although capable of free action, is nevertheless deeply dependent on what the intellect points out as desirable or not desirable for me l~ere and now. If a religious decides on such a check of his or her sense of spiritual values, on exterior observance, and consequently on union with Christ our Lord, it will be well to review also habitual performance in .situations calling for patience, for consideration of the feelings of others. A sharp tongue, a trigger-quick temper, a habit of freely commenting on the actions and personalities of others (always a gentle boost to one's own hungry ego) -- these cannot be ignored when clear signs appear for a necessary 2E-~-war~ Leen, In the Likeness of Christ (London: Sheed and Ward, 1936), p. 223. 267 JOHN C. SCHWARZ Review for Religious strengthening in any area of a religious life. Just as in the physical side of human life health means the well-being of all .parts, so spiritual sickness is easily caused by the collapse of any single part with a resultant weakness poisoning the entire system. Prescription: over-all strengthening. Such an over-all strengthening may come at high cost. But let a religious take heart whatever the cost. Our companion on the way is He who three times lifted Himself in agony from the dust.y road in Jerusalem and did not falter even at the blood-dimmed view of Calvary rising before Him. And this for me! as Paul exclaims. Courage is Christ's, a precious gift available to all who come to Him for it. Let a religious take heart, moreover, in the realization ~hat his or her will remains a powerful faculty ready to serve. That will-power is not debilitated, not collapsed, not "weak." But motives may have grown pallid. The will itself remains in normal condition. One has perhaps previously read such small testings of will .power as, "Couldn't you refrain from this or that for-bidden action if you were assured of death in its next perform-ance?" Seriously reflecting on such a'n eventuality, one is generally prompt to concede that such a motive (note!) would prove a quite effective spur. The will would briskly respond. Motives of a social nature, for one consecrated to Christ, should hold a special attraction. Blessings for souls on earth or in purgatory can be merited abundantly by sacrifice of self. Hopeless millions in the nation's slums, prisoners languishing in Communist camps, the afflicted and confined in a tSousand in-stitutions -- to submit but a few examples -- all these need Christ; and all can be helped wonderfully by the powerful prayer of self-discipline for and with Christ. Alertness in Temptation A further point of considerable moment in combating an inclination drawing a person toward the vortex of sin: prudent, alert conduct in time of temptation. A down-deep reluctance to wrench oneself from an unlawful attraction of some sort or another or a habit of delaying, of dallying and wondering -- such are the gradual weakenings which are the prelude to collapse and inevitable anguish of soul. Said Byron: "There are no 268 September, 1959 CONQUEt~ING SERIOUS SIN pleasures which the world can give comparable to those it can take away." On conduct in temptation, Fr. Gerald Kelly, S.J., observes: "A not uncommon source of mental disquiet among religious is the fact that they develop the habit of 'playing close to the line,' of taking 'little chances' in their reading, their entertainment, and so forth. Half-heartedness in the observance of chastity induces interior conflicts, even when it does not lead to open mortal sin.''3 Here obviously is a point for serious self-examina-tion: has one a set policy of nog only avoiding, but shying far from that which tempts? The Sacred Heart spoke to Margaret Mary in unmistakable words of half-hearted religious. He is whole-hearted. It is essential to see clearly the occasion of sin which has proven dangerous, to have clearly in mind, honestly and openly, that this or that place, reading, time of day, situation, or com-bination of circumstances can cause temptation to grow intense. Facing this fact, the wise person will either exert every possible effort to trace a wide path around the trouble zone, or, if that be impossible, at least halt for a brief moment of recollection and prayer beforehand. Even staunch St. Peter experienced one of the great agonizing falls in Christian history when he lingered in a hostile courtyard. Such courtyards await in every life, but many wisely learn from Peter to shun them. Reaction to temptation, though without panic or nervous-ness, should be instinctive. I become suddenly aware that my hand rests on the sizzling stove. Do I calmly reason, debate the issue, "Well, should I keep it there or not?" Rather, the reaction is swift, instinctive. Let there be an equal, recoil before tempta-tion. Of a married man, sincerely devoted and faithful, novelist Stephen Vincent Bengt wrote: "And there comes a time, no matter what the intention, when a new face heaves into view and a spark lights. I'm no Adonis, God knows, but it's happened to me once or twice. And I know what I do then. I run. I run like a rabbit. It isn't courageous or adventurous or fine . But I run. Because, when all's said and done, it takes two people to make an affair and you can't have it when one of them's not there." 31954 Proceedings of the Sisters' Institute o[ Spirituality (Notre Dame: University of Notre Dame Press, 1955), p. 102. 269 JOHN, C, SCHWARZ Review for Religious. In time of difficulty and temptation some 'relief may be achieved by physical change, taking a "break" for a few moments, fresh air, getting up, walking ---all such sudden motion and switch of environment jars the growing mood with which tempta-tion fascinates the mind and paralyzes the will. This fracture of mood discourages temptation even when it does not dispel it altogether. If one is alone, a companion to talk with might be found. If one is.idle, a quick recourse to interesting work or some engrossing distraction of mind often helps. A handy book or periodic.al may assist. The airline pilot, warned of a storm area ahead, does not make a simple act of trust in the capacities of his ship. He alters his course, avoids heavy weather altogether if humanly possible. He knows too much is at stake for a gamble. A Prayer-in-Action Present-day psychiatrists wisely warn against excessive focusing on problems such as are under consideration here. A worrisome :preoccupation with such matters only adds to their damage. Psychiatrists suggest rather that at least equal attentiOn be turned to the person's general outlook on life some-what in the manner suggested earlier in this article (on the refreshing of motives and values). Everyone concedes the in-juriou~ effects-of brooding, for instance, over this or that possi-bl~ gyrhptom of illness. If you don't truly have the affliction, v~oric)i inay soon obtain it for you; and if you do have it, worry may double it. The same thing occurs in the spiritual life. But this is not to outlaw intelligent concern and intelligent attention go the meanS Of disciplining whatever conduct is intolerable in life. An aid in this direction will be a limited, reasonable plan of self-restraint. How might this be done? Suppose a religious determines to undertake some small denial of pleasure or inclination twice each morning and twice again in the second half of the day, each time offering the peaceful decision to our Lord as a prayer, a prayer-in-action, begging iiumbly the needed grace of selfconquest for His sake. This will impose no weighty burden, attract no attention, cause no morbid focusing on the problem. Bypassing some item at table, assisting another when inconvenient to do so, postponing a desired relaxa-tion for ten.minutes, knuckling down to a task for which attrac, tion is absent, and, perhaps best of all -- an appalling suggestion offer.e.d with apologies-- arising promptly with the unfriendly 270 September, 1959 CONQUERING SERIOUS SIN clamor of the morning bell! Each of these, c~upled with a short aspiration of loving prayer, will recall to mind and heart that my true motives .aim always in one direction only. This is not suggested as the fa~miliar development of virtue "by repeated will acts." Rather, this is the conscious development of intimacy with our Lord by offering deliberate expressions of love to Him repeatedly. These expressions of love are offered in actions, in which I place Him first, my own inclinations second. This is prayer-in-action. A check can profitably be made at noon and at night: "Did I make my prayer-in-action twice, or more?" Let this check be made strictly, renewing then the Morning Offering and the Mass offering as well -- and return happily to duties "through Him, and with Him, and in Him." A Loving Lord Within Our Catholic faith highlights God's revelation to us that when the soul is in the state of grace God Himself dwells in that soul in a very special, intimate manner. God is her.e: Fat, her,, Son, and Holy Spirit -- all Three; and my heart especially re-sponds to the presence of the eternal Son .whos, e perso.n.~al lo~y_e has changed and colored my entire life. He is here, right, here, in the truest sense, a companion, a source of strength, a fortress against loneliness and that illusion of isolation which tl~e shock. of sin can bring. Father DeJaegher's little volume, One With Jesus (Westminster: Newman, 1948), will provide powerful assistance to many in attaining a new depth of insight into what God's indwelling can mean for daily living. The basic fact that God Himself dwells within can and must be a source of that st.rength which only a person who loves and is loved possesses, in the face of tdmptation. The human heart craves love, to love and be loved with true concern, personal attention and attachment. Christ offers us such love if only we will look to Him, clearly seeing the Heart of hearts offered to us. For that love, every earthly sacrifice is paltry in comparison. Great singleness of heart, supercharged with" Christ'-s grace, releases within any human personality power otherwise unsuspected. Singleness of heart: a Frances Xavier Cabrini~ a Matt Talbott or Therese of Lisieux, a Cornelia Connelly or 271 Philippine Duchesne, an Isaac Jogues,. Charles de Foucauld, or Elizabeth of the Trinity. These had one love only. Even in secular life, models of astounding singleness of determination are readily found: a Charles Lindbergh on his epic Atlantic flight, fighting the deadly paralysis of fatigue, doing cramped calisthen-ics in his narrow cockpit, reciting endless multiplication tables, and triumphing. For love of our Lord, then, a blueprint has been submitted for constructing (or re-constructing) an interior citadel against the lethal foe, serious sin. That blueprint outlines four basic steps: (1) A general check on fundamental spiritual truths. Love needs reasons. Familiar truths must be revitalized; familiar motives must sink new roots. (2) Prudent, alert conduct in the presence of t.emptation. (3) A new plan of self-restraint as love's prayer-in-action. (4) Insistent recollection of God truly within. For Christ's love is our whole existence, and our love must flow into action. The apostles, recall, had fished all the night in vain, without the Lord. But when He appeared, it took only a word, a change of approach, and success overwhelmed them. Thus He proved once again that He is indeed the way, the truth, and the life. For religious most of all, Christ is our way, our truth, and surely our very life if we wish to be "the truest of all lovers." 272 Perpetual, Vows Hu~jo J. Gerleman, S.J. IN HIS POEM, "The Ballad. of the White H6rs~," G. K. Ches-terton probes into .the radical differences between the spirit of Christianity and the spirit of pagan]sin -- old and new. One of the marks that he sees in the true Christian is his fidelity to his plighted word: And whether' ye swear a hive of monks, Or one fair wife to friend, This is the manner of Christian men, That their oath endures th~ end. [Bk. V, ll. 2~6-79] Therefore, by this sign will men know. ~'the ba~bari~an come again," that he will be fickle, unstable in his i~romises, .untrue to his vows and oaths. There is no way of knowing exactly what generation of men Chesterton wished to brand with his characterization of the neopagan, but one wonders whether our present generation may not have been included in his vision. Certainly when we consider the present attitude toward the marriage vow, we see what was once regarded as a sa~red and lasting obligation made frequently a matter of a passing whim. There is no need to give the.statistics of divorces since they are so well known. We also know that to some extent even Catholics have been affected by this plague of inconstancy in marriage~ Has this easy attitude towards a sacred and serious promise infiltrated even into the religious life? I have no ready statistics in the matter, but I think it safe to say that even religious are not immune to the tendencies of the age in which they live. Certainly the standard of living in a country, the level at which luxuries and comforts are enjoyed, affects the poverty of religious. Likewise ff a spirit of independence and impatience of restraints prevails in an age, it will make its influence felt on the religious. So it would not be surprising if infidelity to marriage vows and a general restlessness and instability in the face of difficulties, both so noticeable in many. men and women in our times, would 273 HuGo J. GERLEMAN Review for Religious find a counterpart in the lives of religious. Rather it would be surprising if this were not the case. 'It seems in a true sense that the spirit that should enter into the making of a vow is counter to a spirit that is running through our age. One element expected in the spirit with which vows should be taken can be typified by the common expressions, "to burn your bridges behind you," "to put your back to the wall."~ .Those expressions are obviously taken from warfare, from-battle, from fight against strong forces. Those warriors who burn their bridges behind them and who put their backs to the-wall cut off all chance of retreat. To survive they must overcome the enemy that confronts them. They have said "no" to their fears and to any possible cowardice. They are giving themselves psychological support by cutting off avenues of escape which poor human nature is prone to take. They, as it were, .force themselves to be brave -- now they have to fight it out. Whe~a person makes a vow, he does a like thing. He freely promises God to do the better thing; at the same time he realizes that he will come upon difficulties in making good his promise. In order to forestall the weakness of vacillating human nature, he wants to assure:himself of an undeviating will that will secure the performance of-the act under all circumstances. For this purpose he freelyobinds himself under sin to carry out what he is promis: ing. In-thus stabilizing his will by the vow we may say that he is putting his back to the wall, that he is burning his bridges behind ,him He is ~now committed to bravery, to heroism, if need-be, in meeting the attacks on his resolve. There are;~of course, many other considerations that enter the mi'nd and' affect the heart of one taking a vow. The vow, after all, is a means to an end. Through it the person taking the vow certainly wishes to give special honor to .God, to bind him-self more closely to his Creator, to be united to Him more in-timately in charity, and so om But with all these there is the intention to establish himself enduringly in his resolution, to confirm his will when difficulties arise. Stability of will, fidelity to his .promise-iso-what he is seeking. This ~otive has a place in the taking of every vow, but it has a special place i'n the taking of perpetual vows. Why this is so is perfectly clear. A perpetual vow means that perpetually, ¯ for all :the days of life left to a man, he is bound under sin to keep 274 September, 1959 PERPETUAL VOWS his promise to God. He deliberately wanted this, .freely bound~ himself. It means that, as far as :his own will is~ c?ncerne~, no change can be made; he is free to move in .only on~ direc~tion. He must until his dying day (when it is a question .of .the vows of religion) will to be poor, chaste, obedient. If he does not, he is unfaithful to his promise. This finality of his exc.lusive, dboice is what makes his vows perpetual. . . Of course, there is the possibility ~that in ~spite of the firm will-set of the religious an objective difficulty becomes manifest that is an impediment to the perpetual living' of his vow~s. In that case there is place for a dispensation by competent authority. - But it is an objective difficulty; therefore, as far as the.will of the individual is concerned, it can tend in only one direction until it is clear that the will of God indicates another way of life. This is all very obvious, but it is ~trap~ely tr~i~'"'that in the day-to-day living of one's life a person can let even the° obVious become blurred or keep it in the far corner of consciousness.' There have been not a few religious who V~ere boundby perl~etual vows but who gradually, almost imperceptibly~ s~arted .thinking in another way and lettihg their will tend in the.wrong direction. With this they began veering off the true course Of the religious life and hardly noticed it. As they became comfortable moving in their new direction, they began to depart even more from their religious ideals and manner of life. After some time .they found: themselves fully conscious of thinking and moving in an entirely different direction from that in which they~ shbuld" h~e:been tending. And they found that they were quite content' to be" in this condition. The thought of the finality of their selfgiving to God by perpetual vows had lost meaning by_then.:_T.he, will had been drained of its original decisiveness to be faithful-to:the end: Then difficulties, temptations, counter-attractions became, argu-ments for giving up their way of life. They .ended .by wanting to be dispensed from their vows . "" When a religious comes to such a pass, it:.might seem that the only sensible thing to do is to get that dispensation. NoW it may very well be that on the part.of the institute this becomes desirable; for when a member has lost the spirit of-the 'religious life, when the ideals of an intimate following .of Christ_ ar.~ gone, when it seems that he will not be content in religi.on,~-then the congregation or order may well judge, that the individua! is no longer a desirable member. This on the part of the institute, ° 275 Hugo J. GERLEMAI~ Review for Religious However, it seems that the individual ought to have the following truth clearly pointed out to him. He still has his per-petual- vows and is under the obligation, if it is at all possible at the stage at which he is, to recapture the spirit he has lost, to refashion the ideals he has let fade, to win back his peace and happmess in the following of Christ. This will no doubt require a hard struggle with himself. It will require humility, true reliance on God. The religious will have to pray and pray sin-cerely for the one thing needed just now. He may have to endure days of darkness and distress until God deigns to restore the light and peace that he has forfeited. It may seem to him that this is asking too much, ~hat it is laying too great aburden on weak human nature. Yet this is precisely what the obligation of his perpetual vow would demand. He solemnly promised to remain firm under difficulties, even those that are wholly or partially self-made. For his courage and comfort he may reflect that others have worked themselves out of a similar difficulty and recovered their original view and generosity to go on in pgace and happiness to the end in their vocation. Some seem to'fall into the state described above because of a r~ther unrealistic outlook on the vows of religion. They seem to imagine-- even though they have often been told the contrary -- that with the pronouncing of the vows difficulties in keeping them disappear, or at least are of such negligible force that one hardly notices them. Such a view, bf course, manifests a radical misunderstanding of the true nature of religious vows. As was said earlier, in a true sense it is precisely because real difficulties are exp.ected in one's striving for perfection that. the vows are taken. They are con-cerned with strong, dedp, hnd abiding human passions. It may be that these are somewhat dormant at the time the vows are pronounced, but it is rather to be expected that in the life of every religious at some time instincts and passions will reassert themselves, that the passion of sex, the passion of self-will arid independence, the passion of acquisitiveness will clamor for fulfillment, and that vehemently. This does not indicate that it was a mistake to take perpetual vows. It proves rather that it Was riot a mistake to take them -- they are now being experienced as necessary supports of the will to remain constant and faithful in a life of sacrifice, of generous self-giving to God. Now is just the time when the remembrance of them should give that help which weak human nature needs, if the religious is to remain 276 September, 1959 PERPETUAL VOWS faithful to the way of life which he has pledged in all seriousness to God. Right from the beginning, along with the deep conviction of the dignity and value of his intimate following of Christ in the life of the counsels, the religious ought to cultivate a growing spirit of fidelity and loyalty to God through the observance of his vows. He should keep his face set toward the mountain top of final perser~ierance in his way of life, as Christ set His face toward Jerusalem and the sacrifice to be consummated there. "But I have a baptism to be baptized with; and how distressed I am until it is accomplished" (Lk 12:50). " . . . he steadfastly set his face to go to Jerusalem" (Lk 9:51-52). And when the dread hour of His crisis came upon Him, He told His disciples: "But he comes [the prince of the world] that the world may know that I love the Father and that I do as the Father has commanded me. Arise, let us go hence" (Jn 14:31 ). And He went all the way, even to death on the cross. It is hoped that what has been said makes clear how great an error it is to have recourse too readily to the thought of a so-called "temporary vocation" as an easy way out of the obli-gations of one's perpetual vows. Authors who use the term surely wish to have the nature of such a vocation carefully under-stood. We are dealing with fallen human nature. When the vision of faith grows dim and the motives which depend on it become weak so that the person is no longer willing to face the true nature of the religious life and its demands, he may be inclined to hide his want of fidelity by thinking of himself as having only a "temporary vocation." This is readily granted by all, I believe, that even after a person has pronounced his perpetual vows, it can become ap-parent that there is a clear, objective difficulty in the way of continuing his religious life. Some loyal, determined religious have found that God in the mysterious designs of His providence apparently does not want them to go on as religious in spite of their own sincere will in the matter. The religious may be in certain danger of losing his mental health; he may not be able to succeed in the studies required in the institute that he has joined; his leaving may be necessary to provide for his parents who are in serious need. These and other objective reasons may exist that give grounds for the legitimate withdrawal from the religious life. Oftentimes this is experienced as a real hardship 277 HUGO J. GERLEMAN and is done against his own will, in the sense that it is only because of the conviction that such is God's will that he can bring himself to accept a dispensation from his vows. Such persons, of course, have no reason for any fear or anxiety. God knows their heart and their fidelity to the promise made to Him. He Simply has other plans for them. In His wise and loving ~r'oqidende He has allowed them to live for a period under re-ligious vows for their own ultimate good. Such then are sometimes called temporary vocations. But to use the term "temporary vocation" in any other sense, when there is question of perpetual vows, would seem to be a misnomer -- even something of a mockery. Certainly the religious cannot of his own volition, when the going becomes hard or interest is waning, determine that he has only a temporary vocation. As soon as he becomes conscious of entertaining such a thought, he should immediately reflect that, as far as his own will is concerned, he has left himself only one legitimate choice, and that is to fulfill the obligations of his vows to the end with the help of God. His vows are perpetual. This perpetual engage-ment can be terminated only if God so wills it. If the religious is not careful right at the start to confirm himself in his true posi-tion, he may gradually let himself be beguiled into a wrong way of th!nking. From the very first days of his religious life he ought to orientate himself in one direction and all along make sure of maintaining this orientation lest he allow himself to be thrown off course by the winds of adversity. God's attitude towards the taking of vows is revealed in the book of Ecclesiastes, where it is written: "If thou hast bowed.anything to God, defer not to pay it: for an unfaithful and foolish promise displeaseth Him: but whatsoever thou hast vowed, .pay it. And it is much better not to vow, than after a vow not to perform the things promised." (5:3-4) . St. Ignatius, who seems to have been the first to make the devotionabrenewal of the vows a matter of rule, gives the ex-ercise a threefold purpose: to increase the devotion of the religious, to renew in them the memory of the obligation by which they are bound to God, and to confirm themselves more solidly in their vocation (Constitutiones Societatis Jesu, IV, 5). The religious would .do well to recite each day the formula of his° vows and to renew in all sincerity the oblation he made of himself on the day he vowed to God perpetual poverty, chastity, and obedience. 278 Mother Anna Tabouret Sister Mary Kenneth, H.H.M. THE CONGREGATION of the Sisters of the Holy Humility of Mary is unique in the annals of American history in its ~mmigration to the United States as a community just ten short years after its French foundatiom The leader and the inspiration, the enthusiastic spark and the driving force of this daring venture, was a truly remarkable woman, Mother Anna Tabouret. Marie Tabouret was born December 1, 1828, in the peaceful little village of ~Nomeny in the province of Lorraine during the turbulent period of French history caused by the downfall of Napoleon. The shadow of tuberculosis darkened the Tabouret home in 1830 claiming the lives of an infant brother and the father, and threatening the life of the mother. Almost inevitably the two-year-old Marie became the undisputed center of attention in the bereaved household. - -- MariMe asdhaomueld T raebcoeuirveet ,a w seulli-taedbulec aetdedu chaetrisoenlf;, adnedte drmesinp.iete.d. hthea~t ill-health she herself tutored the child. Marie. proved to be so talented in music that by the.age of five she had mastered the fundamentals of this art. Although the mother saw the necessity of education, her maternal love blinded her to the child's most obvious need -- discipline. Marie grew accustomed to having all her desires gratified and her whims satisfied. With a child's keen sensitivity to adult weakness she .was quick to tak~ ad-vantage of her mother's love and her own delicate health. If she were crossed or her wishes thwarted, she would put her hand dramatically over her heart and exclaim, "Mon coeur! Mon coeur!" All thought of punishment would then be forgotten. The family housekeeper, a frequent witness of Marie's' temper, tried in vain to convince her mistress that such willfulness needed to be curbed. The child's legal guardian, appointed by her father; joined his counsel to that of the housekeeper; and finally it.was agreed that Marie should be sent to the village school where she could mingle with boys and girls of her own age. In class Marie learned to her astonishment that the other children were not impressed by her Cry of "Mon coeur!"; on the contrary; 279 SISTER MARY KENNETH Review for Religious they placed a much higher value on strength than they did on weakness. Thus the first restraint upon her strong, will was imposed by her school mates who made it clear to Marie that her own will could not and would not always prevail. When Marie was twelve her mother died and the grief-stricken orphan was taken to live with her guardian. Her frail constitution, further weakened by loneliness and sorrow, made her an easy victim to typhoid fever. After long weeks in bed and longer months of supposed recuperation, it was discovered that a serious curvature of the spine had developed to further impede her recovery. Although unable to attend school regularly for some years, she was able to receive her first Holy Communion with the other children of her age. On this day of days her heart was sad and lonely while her body was still weakened by illness, but she poured out all the desolation and sadness of her soul in prayer to the God truly present within her. When her health improved, she was sent to Paris to study at the Conservatory of Art and Music where she majored in piano and organ and where her talents were recognized as ex-traordinary. Sorrow again appeared in her life when her trusted guardian absconded with a portion of her inheritance. Although stunned by this unexpected treachery, Marie managed to com-plete her education by a prudent management of her finances. During the latter part of her stay in Paris she became the penitent of the great Dominican, Lacordaire, an opportunity which was one of the most powerful and influential graces of her entire life. His influence upon her spiritual development was to be almost limitless, transcending both time and place. His oft-repeated admonition to those who sought his advice was, "Strive to live always on the highest level of spiritual endeavor." Later she was to hand down this advice as a precious tradition to her community. At the completion of her education, she returned to her native province where she became organist and choir directress for several village churches. To an onlooker, and perhaps even to herself, her life seemed already set in its future course; but in reality her life work had not even begun. The first link in the chain of events which would forever unite the destiny of Marie Tabouret with that of a future religi-ous community was forged in her meeting the Reverend John 280 September, 1959 MOTHER ANNA TABOURET Joseph Begel. Through her work as parish organist she came into contact with this scholarly priest, pastor of two small adjoining parishes, who was deeply concerned with the religious education of the children under his care. Although Napoleon III had per-mitted passage of a bill returning education to the control of the Church, he was secretly anticlerical and was merely biding his time. Father Begel had obtained permission to use the town hall of Dommartin-sous-Amance for his religion classes; but as Napoleon's true attitude became more evident, this permission was rescinded. The problem of finding another suitable place for the classes was solved when Mlle. Antoinette Potier, a well-educated and well-to-do woman of Dommartin, offered the use of her home. She welcomed this chance to be of service to the poor of the village; and when Father Begel's :efforts to obtain religious teachers failed, she provided a home for a lay teacher, Julia Claudel, whom he employed. When the actual work of the ~chool began, Mlle. Claudel was assisted by the mistress of the house, An-toinette Potier, and her faithhfl house-keeper, Marie Gaillot. These three ladies, united by their common interest in the school, soon requested of Father Begel a simple program of daffy re-ligious practices which they might perform together. Through Father Begel, Marie Tabouret became acquainted with the school in the Potier home and was introduced to the three women who were conducting it. As she listened to Father Begel explaining his dream of providing qualified teachers for the poor and neglected villages of France, her own enthusiasm and interest were enkindled. In the quiet-spoken Antoinette Potier were detected the lineaments of a great sanctity already being proved in the crucible of physical suffering caused by tuber-culosis. As Marie considered Father Begel's ideals and then studied the gentle way in which these ideals were being brought to actuality, she was filled with a desire to be a part of this great work. At the age of twenty-seven.she received Father Begel's permission to join the little group. Soon other young women joined in the aposto!ate and Father Begel was able to staff schools in both of his parishes. When Mlle. Potier, on behalf of the others, asked for a more definite rule and a completely religious manner of life, Father Begel gave them a sodality manual to follow and suggested that they wear a blue uniform in honor of our Lady. On the feast of the 281 SISTER MARY KENNETH Review for Religious Assumption, 1855, the group assisted at Mass in the village chapel, dressed in a blue merino uniform with a cape of the same material, a white collar, and a simple peasant cap. They thus attracted no unwanted attention from an unfriendly government. During the next three years Father Begel studied the regu-lations of other congregations and finally drew up a constitution which he submitted to the bishop. On August 29, 1858, the bishop approved their rule but not the suggested title of the congre-gation. He wrote, "You propose to give to it the name of the Assumption of Mary. Permit me, M. le Curd, to submit there-upon my thought. I should prefer a name less high sounding and I would propose to name these daughters the Daughters or Sisters of the Holy Humility of Mary." Until this formal approval Was granted, the sisters had been permitted to make only private vows; but now four of their number pronounced public vows in the little chapel at Domo martin. They wore for the first time a starched white cap with a fluted frill, a black veil, and a silver band ring. On this occasion Antoinette Potier received the religious title of Mother Magdalen and Marie Tabouret became Sister Anna. Of this happy day, Mother Anna was later to write: "At last the day of our perpetual vows. It witnessed our solemn consecration to God. True we had vows but being only condi-tional we were in constant apprehension of being obliged to separate despite the bonds of charity which united us. Our union of views, our common desire to promote the greater glory of God, to instruct the poor, ignorant and abandoned children in small localities, to assist the poor and the sick out of our own poverty, to endure this poverty, humilition, and self-denial of both soul and body. But what of all this? Now we are permitted to consecrate ourselves to Jesus, soul, body and mind. What matters hardship?" ~ :When the community numbered twelve professed members, the sisters were able to staff four schools in the area, a seeming indication that their work was taking a firm root in the soil of France. As Napoleon's true attitude toward the Church became more and more evident, Father Begel courageously attacked the duplicity of the Emperor; and his refusal to permit the singing of the Te Deum in thanksgiving for the seizure of the Papal States resulted in the loss of his two pastorates. He was forced 282 September, 1959 MOTHER ANNA TABOURET to confine his priestly activities to the direction of the new re, ligious community; and the authorities then struck back in-directly by refusing the sisters teaching certification and by hampering their work in other small, annoying ways. At this time of crisis Father Begel received a request for the sisters to go to America to teach at a settlement of French immigrants in Louisville, Ol~io. Four of the sisters volunteered;. but as their difficulties with the government increased, it was: suggested that all might migrate. Bishop Amadeus Rappe (~f Cleveland wrote that he would welcome the entire community to his diocese. Sister Anna was greatly interested in the American venthre;- but she feared that the trip would be too strenuous for Mother Magdalen, whose health was rapidly failing. Mother Magdalen saw in the Bishop's invitation an answer from God to all their problems and prepared to sell her property to pay the expenses itnimvoel vweads itnh es ufcuhtu arne ucanrddeirntaakl,i nCgh.a Trlhees BLiasvhiogpe roief ,N daensctiyn eadt tthoi:s' further the progress of the Church in Africa by the foundation of the White Fathers. When the sisters consulted Bishop Lavi-gerie, he congratulated them on their fulfillment of his dearest dream, a missionary apostolate. Mother Magdalen directed the preparations for the trip, even to. the packing of her own trunk, although it was obvious to all that her death was near. On May 7, 1864, the saintly found-ress died, quietly and serenely, after making her act of resigna-~ tion to the will of God. Father Begel, the co-founder of the infant community, was almost inconsolable, Immediately the° community was involved in litigation as Mother Magdalen's relatives endeavored to break the provisions of her will. When their efforts proved successful, the little band of sisters was left practically destitute. In the dilemma and confusion resulting from Mother Magdalen's death and the loss of her property, Sister Anna, now appointed Mother, became the pillar and the support of the community. Behind her firm hand which grasped the reins of government was a brilliant mind equipped with unusual fore-sight and practical wisdom to cope with the multitudinous prob-lems that beset them. Physically she seemed inadequate for the task, b~it spiritually she was equal to the challenge of each new 283 SISTER MARY KENNETH Review for Religious day. She saw the futility of staying in a land where government opposition prevented them from doing the work of God. She realized the folly, humanly speaking, of going to America without funds of any kind; but when Bishop Rappe wrote, "You will find in America the same unfailing Providence you found in France," she placed herself and her community confidently in the hands of God. At the end of May, 1864, the little group, including Father Begel, ten professed sisters, one novice, and four orphans, sailed from Le Havre for America. As France grew smaller and smaller, finally fading entirely from view, they realized that they would never see their home land again. The voyage was further.saddened by the death of one of the orphans; and as Mother Anna gazed at the still little form, it seemed to her that the first link with France was already broken. The travelers arrived in New York on June 14, 1864. Bewil-derment at their inability to comprehend even a single word being spoken around them added to the confusion they felt as they waited, penniless and homeless, for official entry into the country. Their actual destination was Louisville, Ohio, where they received a heart-warming welcome from the enthusiastic French settlers. Father Begel, leaving the sisters at Louisville, went on to Cleveland to consult with Bishop Rappe. Upon his return Father Begel announced that the community was to be given the opportunity to purchase a farm of two hundred fifty acres in Pennsylvania. He glowingly conveyed Bishop Rappe's description of the fine 'brick building which was already on the property and praised the graciousness of the Bishop in making the offer to them. In his account of the farm, Father.Begel omitted mention of the fact that other communities attempting to live there had been forced to abandon the place because of its desola-tion, inaccessibility, and the difficulties involved in farming the swampy and rocky ground. Leaving two of their number at Louisville to teach the children of the French immigrants, the other sisters cheerfully and enthusiastically journeyed on to their new home. The sight that greeted them was enough to daunt the courage of the bravest. The property did indeed boast the praised brick struc-ture; but surrounding the building for acre upon acre were unhealthful swamps and thick, dense woods. The road leading 284 September, 1959 MOTHER ANNA TABOURET to the front door was nothing but a muddy path overgrown with weeds; the front yard was a marsh filled with rotting tree stumps: Vegetation of all kinds struggled for life, but the wild unconquered growth was far different from the trim lawns and neat gardens" of their beloved France, It was here in this hostile wilderness that the true qualities of Mother Anna's character reached their full flowering. With-out money, without friends, speaking a foreign language, she began a foundation that endured and prospered. Humanly,. her task seemed impossible, her obstacles insurmountable; but with' an unwavering, confidence in God she set herself to the work of accomplishing the impossible for His honor and glory. Her sound .practical judgment decided that the clearing 6f the land must be their first task if they were to survive at all From daw~ to dusk they labored -- these gentlewomen whose hands had been trained for the needle,rather than the plow. As they worked in the fields, felling trees, draining swamps, or plant-ing seeds, they sang hymns or played, the rosary. A potato crop was Mother Anna's first objective; .and when this harvest failed, dark days of misery and hunger descended upon the .community. Their troubles seemed to increase from day to day wi~h illness striking both sisters and orphans. This was the ~eriod" of which Mother Anna was to say, ~"Thing's were *too black to permit our feeling blue:" Finally she realized that thei~ 'affairs had reached such a crisis that unless help was forthcoming the whole venture would dissolve in failure. Her efforts to convince Father Begel of their dire situation had been unsuccessful as his only solution was the advice, "Take one more ~rphan and God will provide,for His own." Mother,Amia was willing to suffer any hardship to ensure the success of their° mission; .but when the very life of the congregation seemed at stake, she was cer-tain that the hour for action had struck. Without consulting Fathe~ Begel, she set off for Cleveland with Sister Odile and Sister Mary of the Angels. They walked. barefoot along the muddy ruts of the road into Youhgstown,~ Ohio, a distance of twelve miles, stopping at a creek to wash their feet and don their shoes before proceeding to the depot. After a trip on the night train, they arrived in Cleveland where kindly pedestrians directed' them from corner to .corner until they arrived at the Bishop's house. His amazed expression 285 SISTER MARY KENNETH Review for Religious prompted a speedy explanation of why they had come, unan-nounced, unexpected, uninvited: They blurted out their hopeless dilemma ~strangers .in d strange land -- no means of support -- no. means of communication with their American neighbors -- no food --- the failure of their crops-- the sickness of the orphans. Later Sister Odile was to admit, "I disgraced the community by sobbing aloud." -~- The bishop listened attentively and then asked, "What if I bid you remain and do the best you can, relying on Divine Providence?" Mother Anna replied, "We would obey, Bishop, but we have not sufficient food, clothing, nor bedding. We have orphans." We have sick ;sisters and sick children. Bishop, please, tell Father Begeltoi~ta~ke us home. France will not let us starve." The bishop gave them a small sum of money; but far more important, l~e assured them that if they. would remain and trust in_God, their, obedience would be r~warded. Perceiving in his words the ex.p~essed will of God, Mother Anna returned to the Vill~ and united all the efforts of the struggling community in a concentrated act of obedience. In an amazing way, the seemingly hopeless situation of the sisters began to improve. Everything thai Mothdr Anna's hand touched seemed to prosper; her will wbuld not admit defeat when she was acting under obedience. The wild, uncUltivated land gave way when faced with her de-termin_ at~ionto establish productive gardens and fruitful orchards. She worked side by side with the sisters in the field, laughing with this one, coaxing another, but always watchful that the work~progressed. . i .Wh.e~ m~ o~re o.r.phans arrived than could be cared for properly, she enlarged the housing facilities for both sisters and children. After two additions to the convent she had a suitable chapel erected for the Blessed Sacrament. She kept down building costs by producing the necessary materials on the farm itself. A saw mill-was built in the woods~ and she sought expert advice in select-ing .the trees to .be felled. The better lumber was then set aside to be seasoned for future buildings. A brick kiln. was erected in the front yard, and she herself sup~ervised the makir.g of the bricks. -. One of the most startling decisions for the little French community was Mother Anna's determination that they should become Americanized as completely and as quickly as possible. 286 September, 1959 MOYHER ANNA TABOURET She was convinced that all must learn the English language if they were to be effective in a teaching apostolate; and when a teacher of English was hired, she herself set the pace in acquiring a second tongue. At a time when money was very scarce she paid the necessary fee to have the community incorporated in the state of Pennsylvania. Her foresight in this particular matter was completely incomprehensible to her compatriots. When the deadly scourge of smallpox struck at the neigh-boring countryside, Mother Anna led the sisters into the homes of their American neighbors to nurse the victims of the epidemic. Thrusting aside all thought of personal contagion_ and fear, she turned all available convent space into hospital wards for the children. All through the long days and interminable nights of the siege, the sisters, under Mother Anna's leadership, fought the treacherous foe of infect_ion which had invaded the homes of the sick. One of the oi'iginal account books lists the cost of smallpox medicine at eighty-two dollars. A small fortune for those days! The heroism of the sisters at this ~ime evoked the admiration of their neighbors~ Catholics and Protestants alike; and as a token of gratitude the city of Lowell~ille, Ohio, pre-sented the community with a small sum of money. The gift came at a most opportune time,-for Mother Anna was struggling with the problem of settling.the debt on the Villa property. In an effort to raise the necessary three thou~sand dollars, the sisters had been soliciting fundg from the workers on a railroad that was being constructed near the Villa. When the officials of the company heard of the sisters' need, they encour-aged their employees to contribute generously. It was in gr,atitude for this unexpected assistance that Mother Anna offered to have the sisters care for any railroad men who were'injured or" taken ill" on the job. ¯." A two-room addition tO Father Begel's house, served as the infirmary which became known to the railroaders-gs "The Sisters~' .Hospital up Lowell Hill." As word spread of the excellent car.e g~v~en by the sisters, a larger building with suitable equipment soon .be.came necessary. The foundress decided ~to erect a hospital on the Villa property which would be large enough for the increased number of railroad patients. With her natural instinct for business she formulated a plan by which she could finish the clearing of the 287. SISTER MARY KENNETH Review for ReligioUs Villa woods, utilize her saw mill, and acquire the needed building funds. She drew up a. contract with the officials of the railroad by which they agreed to buy from her all the railroad ties she could produce. The constant buzzing of the mill from early morn-ing to late evening proved that the little saw mill was now her greatest asset. To solve the labor problem Mother Anna hired the vagrants whose predominant fault had lost them their rail-road jobs. Always a prudent women, she exacted a pledge of each one as she hired him. "I'll never touch a drop of the ~ld stuff as long as you boss me," was the frequently repeated promise as the recruiting of workers progressed. Instinctively, these rough men yielded her a ready obedience. With the erection of the hospital the. apostolate of the sisters was extended to include the care of the sick; and as the scope of the community's labors was enlarged~ more postulants applied for admission. With the .increased membership Mother Anna was able to supply teaching sisters to the nearby towns in Ohio and P~ennsylvania. In 1870 a group of~ ~isters volunteered to go to the diocese of St. Joseph, Misso.u~._i, in response to the bishop's plea for teachers. After other ~ssions had been established in Missouri, it was decided that the western group should function as a separ~ate community. In 1871. the separation was approved, and the sisters in Missouri formed a~ distinct congregation whose motherhouse was later to be establi.shed at Ottumwa, Iowa. Although Mother Anna was an eminently practical womari dealing efficiently with the details of ev.eryday life, spiritual values always occupied the foremost place in her mind. The ideals inspired by Lacordaire ever urgdd her to keep both herself and her sisters on the. very highest planes of ~piritual endeavor. Her character was marked by a rugged virility which scorned the unusual and the spectacular; if she was firm with her daugh-ters, she was even more rigorous with herself. In her dealings with her subjects she could accurately gauge the severity with which they could be dealt, and she did not exact the same gener-osity from all. Her personal opinions never biased her deci~i0ns and her keen intellect was able to weigh all sides of a question dispassionately before reaching a final' decision. In the governing of her community she insisted upon absolute obedience, and re-joiced when she received it. Anything and everything that made her daughters happy contributed to M~ther Anna's own happiness. She often planned 288 September, 1959 MOTHER ANNA TABOURET surprises for the community recreation hour and announced one night that soon a benefactress from France would be coming to pay the d0mmunity a visit. This lady was a trusted friend of the sisters who not only was greatly interested in them but also was able to render them invaluable assistance. When the time for the visitor's arrival came, Mother Anna invited all the sisters to the parlor where a °beautiful statue of the Blessed Virgin, more than life-size, awaited them. As a pledge of the community's devotion to Mary, this statue was placed above the high altar of-.the chapel where it remains today. It is at the foot of the community's benefactress that on each recurring August fifteenth the Mother of God is proclaimed the "supreme superior" of the congregation in an act of consecr~ition composed by Father Begel and recited by the General Superior. In the twenty years of her superiorship Mother Anna had guided her community in its struggle from seemingly impossible beginnings to circumstances in which the sisters were able to serve effectively as instruments of God's providence in the fields of education and charity. During this time her own health, "always deScate, l~ad been further weakened by the hardships of establishing the foundation. By 1882 the community seemed firmly established in America as evidenced by the increasing number of American subjects and the increased number of missions. Mother Anna believed that the time had come for the sisters to hold a canonical election. She, therefore, asked the Bishop's permission to resign, giving as the reasons her failing health and her desire that the sisters might freely elect a superior. The sentiment of the community was strongly opposed to her resignation and to the election of a new superior. While awaiting the Bishop's reply, patiently and humbly, Mother Anna began making quiet preparations for her retirement by moving her sleeping quarters to the attic with the other professed sisters. She seemed impelled b~ a powerful intuition that her retirement was near. The validity of her presentiment was apparent to a~l on July 1, 1883, when Mother Anna was stricken with a complete paralysis of her lower limbs. The Bishop, now compelled by the hand of God, accepted her resignation and presided over the election of her successor, Mother Odile. Mother Anna cheerfully resigned herself to the will of God and with characteristic foresight made plans for her new life as 289 SISTERMARY KENNETH Review for Religious an invalid. Her heart knew no idleness as it was constantly given to prayer, but she must have occupation not only for her mind but for her hands as well. After sorting and arranging the voluminous correspondence of Father Begel, she wrote an in-valuable life of the founder, who had died in 1884 and who had been replaced by his nephew, the Reverend Nicholas J. Franche. In addition to her writing she was now able to utilize her knowl-edge and love of music, and an organ was brought into her room to enable her to teach the young sisters the principles of harmony and theory. During the hours remaining after music lessons, thousands and thousands of postage stamps were cut, sorted, and packed for a community of Belgian missionaries. These priests used the stamps to make works of art which were then sold to ransom young African children. While busy with her stamps or needlework, the invalid was able to receive and enter-tain the many visitors who climbed to her attic room in search of advice or prayers. In the early days of her illness she had predicted that she would be an invalid as many years as she had been superior. The sisters laughed at this notion; but as the years passed on and death claimed more and more of the younger members, leaving Mother Anna to her life of suffering, many began to suspect the truth of her prophecy. She once confided to some of the sisters, "God has purposely forgotten that -He put me here in this corner. He sends me showers'of graces, but, you see, I owe Him a huge debt and have never been able to make a big payment. He is such a Good Master that instead of commanding His servants to bind me and cast me into the outer darkness He heeds my prayer, 'Be patient, dear Lord, and I will pay Thee all.' I must continue to work so that when He calls for me He will find me at my post:" For twenty long yea.rs she remained at her post, seeking no favors, asking no special services, denying' herself the luxuries of pity and idleness. Physically she had much to suffer; but the sufferings resulting from her difficult position in the community caused her~greater pain, for she still exercised tremendous power while ~ossessing no authority. Consulted by superiors and sub-jects alike,-she n~eticulously chose the prudent word so as to prevent wounding the charity of the community. Sometimes she reproached herself because the sisters were so very willing to serve her,.and she worried lest this service be rendered to her 290 September, 1959 MOTHER ANNA TABOURET personally rather than to" Christ through her. In .1902, as she approached her seventy-sixth birthday, some of the sisters recalled that her twenty-year prediction' was nearing its ful-fillment. Although Mother Anna had aged through the years as the paralysis progressed, the changes had been so gradual as to be almost imperceptible. Early in 1903 a severe cold led to pneumon-ia, and because her condition seemed critical she received the Last Sacraments. After the anointing she apparently regained her strength, but by May of that year it was obvious that her exile was almost over. When Mother Patrick, the General Superior, ¯suggested sending for Father Franche in order that she might be anointed again, the invalid merely replied, "As you will." The little girl who had screamed and stormed to have ¯ her own way, was now a woman of seventy-seven, eage~ bnly for the will of God. Father Franche hastened to the room of the "Saint of the Garret" as one priest had called her. She smiled as he approached the bed with the holy otis. After the anointing she received Holy Communion, and in about the time it would take to consume the Host she was dead. The Bridegroom had come and called for her at the "post" where she had been waiting for twenty years. Mother Anna was buried from the simple yet beautiful chapel that she herself had planned and erected. After the Requiem Mass the funeral procession passed down the ~ront yard which she had claimed from the wilderness, in front of the convent she had built, near the orphanage she had loved, past the hospital she had erected, in full view of the farmlands she had cleared, until .it reached the little cemetery she had plotted out for her daughters. She was buried near Father Begel, her friend in life and her companion in death. Over her grave her daughters erected a cross to let the world know that they had found The Valiant Woman. Future events were to prove the truth of their conviction. The tiny grain of mustard seed blown by the providence of God from the native soil of France to the strange, harsh ground of America has taken root and sprung up yielding more than seven hundred fifty professed members. "All these rise up and call her blessed." The status of the congregation, once diocesan, is now that of a pontifical institute, conducting elementary and 291 SISTER I~ARY KENNETH secondary schools, hospitals, confraternity classes, and a home for crippled children. The steady progress and consistent growth of the community, together with the efforts of her daughters to prove themselves worthy of so valiant a mother by the practice of holy humility are the best evidence for the validity of her epitaph: She hath looked well to the paths of her house; and hath not eaten her bread idle. (Prov 31:27) 292 Survey of Roman Documents R. F. Smith, S.J. IN THIS ARTICLE a summary will be given of the documents which appeared in Acta Apostolicae Sedis (A_AS) during April and May, 1959. Throughout the survey all page references will be to the 1959 AAS (v. 51). Two Consistories On March 12, 1959 (AAS, pp. 177-83), John XXIII held two consistories. In the first, a public one, His Holiness bestowed the red hat on three cardinals who had been previously created on December 15, 1958. In the second and secret consistory the Pontiff confirmed Cardinal Tisserant as Camerlengo of the Sacred College for the year 1959; he likewise ratified the election of Bishop Paul Cheikho as Pa-triarch of Babylon for the Chaldeans, published the list of prelates appointed since the last consistory, bestowed three cardinalatial churches in Rome, and accepted various postulations for the pallium. Easter Messages On Holy Saturday evening, March 28, 1959 (AAS, pp. 241-45), the Vicar of Christ broadcast to the entire world the customary Easter message. The living Church, he told his listeners, is the ever-present confirmation of the Resurrection of Christ. Like her founder, the Church has experienced enemies who sought to entomb her; but also like Him she has always risen again. Accordingly, he said, the feast of Easter should lead Catholics to intensify their fidelity to the Church. But, he continued, Easter also has a message for thd spiritual life of each of the faithful. Easter, he pointed out, is a mystery of death and life; so it is that at this time each of the faithful is asked to die to sin by purify-ing his conscience in the sacrament of penance and then to nourish himself with the vivifying flesh of the immaculate Lamb of God. The next day (AAS, pp. 245-52) the Pope delivered an Easter homily during th~ Solemn High Mass which he celebrated in St. Peter's. Speaking first of the passion and death of Christ, the Pontiff Observed that the passion of Christ is both sacrament and example; it is the first because it contains and transmits the power of divine grace;, and it is the second because it prompts all of us to the practice of that patience of which Christ is the supreme teacher. Then reflecting on the Resur-rection, the Pontiff pointed out that in this mystery of Easter the 293 R. F. ~SMITH Review for Religious Master of life has triumphed over death and His victory is the victory of the Church throughout the ages. Accordingly Christians must face the future with confidence, in spite of all .the machinations of the Prince of Darkness. For the victory of Christ over death is our guarantee of victory over the obstacles to justice, liberty, and peace. Saints, Blessed, Servants of God Several of th~ documents of the April-May issues of AAS were devoted to St. Pius X. On April 11, 1959 (AAS, pp. 316-18), the Holy .Father sent a written message to the people of Venice on the occasion of his sending to that city the relics of St. Pius for a month's stay. The sending of the relics, said the Pontiff, fulfills the prophetic words spoken by the saint when he left Venice for the conclave at which he was elected Pope: "Dead or alive, I shall return." His Holiness went on to say that previous to his own election as Pope he had hoped to be buried in Venice near the tomb of St. Mark; since, however, that is now impossible, he expressed the wish to be buried in St. Peter's near the altar of Pius X, his predecessor both in Venice and in Rome. On May 10, 1959 (AAS, pp. 373-75), the Vicar of Christ broadcast to the Venetians a panegyric of St. Plus X at the conclusion of the month of devotions in his honor; and a similar panegyric (AAS, pp. 367-71) was preached by him in the Piazza of St. Peter's to the faithful who had gathered there to welcome back the relics of St. Pius after their stay in Venice; onthe same occasion the Pope also gave a panegyric in honor of St. John Bosco whose relics were being brought at the same time for a stay in St. Peter's. On April 12, 1959 (AAS, pp. 289-94), John XXIII performed the first canonizations of his reign by solemnly declaring the sainthood of Blessed Charles of Sezze (1613-1670), confessor, Franciscan lay brother, and of Blessed Juana Joaquina de Vedruna de Mas (1783-. 1854), widow, foundress of the Carmelite Sisters of Charity. During the Mass after the canonizations the Holy Father delivered a homily on the two saints. Using a thought from St. Francis de Sales to the effect that Christian devotion and sanctity can be reached by everyone no matter what his state or condition of life may be, the Pontiff proceed-ed to show how the two new saints admirably prove the Salesian doc-trine. St. Charles was of a poor family; St. Joaquina was of noble birth; St. Charles was a farm laborer; St. Joaquina was raised in surroundings with no lack of material things. Yet both the one and the other reached the heights of sanctity. On April 13, 1959 (AAS, pp. 304-07), the Pontiff delivered an. allocution to thbse who had attended the canonization on the previous day. The two saints, the Pope said, teach us that the things that are worthwhile are not the things of the world, nor human honor, nor nobility of family, nor wealth, but the will of God. 294 September, 1959 ROMAN DOCUMENTS On March 11, 1959 (AAS, pp. 325-27),' the Sacred Congregation of Rites issued a decree approving the two miracles required for the beatification of the Servant of God, Helen Guerra (1835-1914), foun-dress of the Oblate Sisters of the Holy Ghost (popularly known as the Sisters of St. Zita). On the same date (AAS, pp. 328-30) the same Congregation also approved the necessary miracles for the beatification of the Servant of God Mary Margaret d'Youville (1701-1771), foundress and first superior general of the Congregation of the Sisters of Charity (Grey Nuns). Five weeks later on April 19, 1959 (AAS, pp. 387-90), the Congregation issued the decrees stating that it was safe to proceed ¯ with the beatification of both the Servants of God mentioned above. Then on April 26, 1959 (AAS, pp. 337-42), John XXIII issued the apostolic letter, "Renovans faciem terrae," by which the beatification of Helen Guerra was proclaimed to the Church; in the document the Pontiff points out that Leo XIII was moved by the Blessed's zeal for devotion to the Holy Spirit to commend special prayers to all Catholics during the Pentecost octave and later to write the encyclical Divinurn illud munus on the Holy Spirit. On May 3, 1959 (AAS, pp. 343-48), His Holiness issued the official notice of the beatification of Mary Margaret d'Youville in the apostolic letter, Caritatis praeconium. In the notice of the beatification the Pontiff singled out charity to-wards others as the commanding trait of the new Blessed, a trait that merited for her the title of "the mother of universal charity." On April 27, 1959 (AAS, pp. 352-54),'the Vicar of Christ delivered an allocution to Luccan Catholics present for the beatification of Blessed Helen. Having recalled that she was the teacher of St. Gemma Galgani, the Pontiff said that as St. Margaret Mary was the divine instrument for spreading devotion to the Sacred Heart, so Blessed Helen was God's instrument for spreading devotion to the Holy Spirit. Her own life, he continued, was a luminous manifestation of the superabundant fruits which the Holy Spirit infuses into those who are docile to His action. He concluded by saying that the life of the Blessed has a vital lesson for today; we n~eed a new coming of the Holy Spirit, a new Pehtecost to renew the face of the earth. O.n May 4, 1959 (AAS, pp. 363-64), His Holiness gave an allocution to the Canadians present in Rome for the beatification of Blessed Mary Margaret d'Youville. Pointing out that she is the first Canadian-b0rn blessed, he urged his listeners to imitate her profound faith, her perfect living out of various states of life, and especially her intense and. supernatural love of the pobr, the sick, and the unfortunate of every kind. On November 20, 1958 (AAS, pp. 274-77), the Sacred C~ngrega-tion of Rites approved the introduction of the cause of the Servant of God Aloysius Palazzolo (1827-1886), priest, founder of. the Sisters of the Poor (Italy). On January 28, 1959 (AAS, pp. 27~-78), the same 295 R. F. SMITH Review for Religious Congregation approved the reassumption of the cause of Blessed Mar~ of Providence (1825-1871), virgin, foundress of the Helpers of the Holy Souls. To Priests and Religious On February 10, 1959 (AAS, pp. 190-95), the Roman Pontiff gave an allocution to the Lenten preachers of Rome, discussing with them the traits that should mark their preaching. Wisdom, simplicity, and chari-ty, he said, should mark the sermon work of a priest. Wisdom should be shown in the choice of subject matter and the Pontiff recommended the following for their sermons: sin and its punishment, private and pub-lic worship, the sanctification of Sundays and holy days, the duties of the married state, the education of children, respect for the human person. Simplicity, he continued, should lead them not to seek their own renown but to work for the instruction of their hearers, while charity should urge them to seek only one thing: to draw their listeners to the love of God. On March 12, 1959 (AAS, pp. 198-202), the Pontiff addressed the members of the Apostolic Union of the Clergy, pointing out to them that a priest before all else must be a man of God. Like Abraham, a priest has left his own home to seek the land of promise in which, if he is true to his vocation, he will find Christ and Him crucified. Scrip-ture and the EucharisL he continued, must be the food of the priestly life; speaking of the latter, he said: "There is no perfection nor true love of.God Or of Christ without a profound devotion to the Eucharist." He' concluded by reminding his listeners that their love for souls must lead them to prayer, contemplation, and penance, for "This kind is driven out only by prayer and fasting" .(Mk 9:28). On April 21, 1959 (AAS, pp. 375-81), the Pontiff delivered an exhortation by radio broadcast to the clergy of .Venice gathered in the Basilica of St. Mark to honor the relics of St. Pius X. His Holiness began by remarking that a priest is granted what is not given even to the angels. Accordingly a priest must reflect this dignity in every aspect of his life and conduct. He advised his listeners that care of their own soul, manifested in prayer, recollection, study of sacred doctrine, and careful use of the sacrament of penance, must come before every pas-toral preoccupation. He emphasized this point by quoting St. John Chrysostom: "If the priest possesses all the virtues, then he is like the best kind of salt; and with it the whole people can be seasoned. This - will be done by seeing the priest ~ather than by hearing him; for the first way to learn is by seeing the good; and the second way is by hear-ing it." The Pope concluded his exhortation by urging his listeners to continued loyalty to the Church and to the pursuit of all human values, natural and supernatural. 296 September, 1959 ROMAN DOCUMENTS On April 16, 1959 (AAS, pp. 307-13), the Pontiff delivered an allocution to all branches of the Franciscan family on the 750th anni-sary of the pontifical confirmation of the Franciscan Rule. All branches of the Franciscans, the Pontiff stated, .are faithful to the fundamental points of the original Franciscan Rule: poverty, obedience, charity. Franciscan poverty, he went on to say, emphasizes the serene joy that comes from the giving up of material possessions. Obedience, especially that to the Roman Pontiff, he continued, is a necessity of religious life; history shows that obedience to the Holy See has led to success in the life of religious orders, while lack of obedience has led to unfortunate states of insubordination and unruliness. Finally he noted that charity has always been the soul of the Franciscan missionary spirit; it has made of the members of the Franciscan family conquistadors of souls for the triumph of the name, love, and kingdom of Christ crucified. Messages on Various Subjects Under the date of February 15, 1959 (AAS, pp. 206-08), John XXIII sent a written message to the first Eucharistic Congress of Cen-tral America. The Eucharist, the Pontiff declared, infuses into the heart of man a new energy of supernatural love which strengthens while it purifies human love. The Eucharist unifies the entire man until there is created in each individual the perfect man, created to the image of God and conformed to. the example of His Son. Moreover, he added, the Eucharist also helps human relations; for by calming the tumults of the spirit, it leads to goodness, justice, and mercy. Finally the Eu-charist strengthens family life; since Christ's love has given us the sacrament of the Eucharist, it is there that the highest spiritual union between man and wife can be realized. On April 19, 1959 (AAS, pp. 313-14), the Vicar of Christ sent a radio message to the faithful of Belgium on the tenth anniversary of the Belgian radio program, "The Missionary Hour." His message to the Belgi.a. ns can be summarized in two quotations which His Holiness took from the writings of Plus XII: "The missionary spirit and the Catholic spirit are one and the same thing." "The Catholic vitality of a nation is measured by the sacrifices it makes for the cause of the mis-sions." A week later (A_AS, pp. 349-52) the Pontiff addressed a group of Italian women devoted to the assistance of missionaries. He told them that missionary cooperation today is. urgent and imperative, for the last ten years have been critical ones for missionary activity. He pointed out to his listeners that missionary cooperation is not exhausted by material aid; if it were, then the problem of the missions would be only a human problem. As it is, however, the problem is a supernatural one; and material help, while necessary, is neither the principal nor the only form of assistance. To such help there must be added prayer and 297 R. F. SMITH Review for Religious above all suffering. He concluded by reminding his audience that mis-sionary cooperation will not only help the missionaries but will also revitalize their own dioceses and parishes. On February 10, 1959 (AAS, pp. 205-06), John XXIII sent a writ-ten message to the First National Congress of Spain on the Family, telling the members of the Congress that three principal loves exist in the heart of man: conjugal love, parental love, and filial love; to harm these loves, he said, is to profane what is sacred and to lead to the ruin of one's country and of all of humanity. On March 1, 1959 (AAS, pp. 195-97), the Pontiff addressed the Ninth National Con-gress of the Women's Italian Center; he reminded his listeners that the family finds its guardian and protector in the wife and mother of the family; hence in the face of present dangers to the family, they must as wives and mothers turn all their efforts to the preservation of family life. On May 1, 1959 (AAS, pp. 355-59), the Pontiff gave an allocution to a group of Italian workers, telling them that true happiness consists in not losing sight of man's supreme goal; hence he urged them always to seek celestial things even when they endeavor to raise their level of living. OH March 18, 1959 (AAS, pp. 202-04), His Holiness addressed members of the International Symposium on Prophylaxis, assuring them that their work was a labor of real charity, since they endeavor to prevent those physical and psychical disturbances which obscure the splendor of the divine spark that is human reason. On May 4, 1959 (AAS, pp.359-62), John XXIII spoke to the participants in the Third Italian Congress of Catholic Newspapers and Periodicals. He urged his listeners to employ the arms of truth and of charity in their work and advised them to be kind even when fighting what is wrong according to the saying of St. Augustine: "Kill the error, but love the erring." He concluded by exhorting his listeners to publish works that will reflect the wisdom, love, and beauty of God. On April 11, 1959 (AAS, pp. 303-04), the Pontiff addressed an international group of war veterans; he told them that peace can not be decreed by any earthly power but mt~st flow from the interior of each individual man. On April 1, 1959 (AAS, pp. 299-301), the Pope spoke to members of the Federation of Catholic Universities; he pleaded with them to con-centrate on building up a strong wall against today's materialism, con-cluding by asking them to be Christ-bearers, since Christ is the apex of all knowledge. On the same day (A/KS, pp. 259-60) the Pontiff ad-dressed the Second Congress of Negro Writers and Artists. He encour-aged them in their study of the unity and responsibilities of a Negro- African culture. He pointed out, however, that the Church is not to be identified with any one culture, for her work is of another order -- that of the religious salvation of man. Nevertheless, he added, the 298 September,. 1959 ROMAN DOCUMENTS Church is always ready to acknowledge, welcome, and animate all that is to the honor of human intelligence. He concluded his talk by urging his audience to have sympathy for and to collaborate with other cultures. On April 7, 1959 (AAS, pp. 301-02), the Vicar of Christ ad-dressed the members of the First Ciceronian Congress. He told them that because so many today pursue the study of mathematics and of tech-nology, it is necessary to stress Latin and similar subjec.ts; otherwise men will become like the machines they make: cold, hard, loveless. On February 16, 1959 (AAS, pp. 204-05), the Pontiff delivered the first radio message to Japan from V.atican City Radio, urging Japanese Catholics to greater sanctity in their lives. Miscellaneous Documents A decree of the Sacred Consistorial Congregation, dated February 28, 1959 (AAS, pp. 272-74), provides that a~l military vicars should make an ad limina visit to Rome every five years. In a special document of February 18, 1959 (AAS, p. 228), the Holy Father appointed the members of a Commission to organize the coming diocesan synod of Rome. By the apostolic letter, Boni pastoris, February 22, 1959 (AAS, pp. 183-87), John XXIII set up new norms to govern the activity of the Pontifical Commission for Motion Pictures, Radio, and Television. On March 6, 1959 (AAS, p. 271), the Holy Office prohibited the diffu-sion of all representations and writings which present the devotion to the Divine Mercy according to the forms proposed by Sister Faustina Kowalska; the removal of any such representations which may already be exposed for worship was left to the prudence of the bishops. On April 4, 1959 (AAS, pp. 271-72), the same Holy Office forbade Cathohcs to vote for candidates who are associated with Communists and who favor them in their way of acting. In a special radio message of April 27, 1959 (AAS, pp. 314-16), the Holy Father requested prayers during the month of May for the success of the projected General Council. 299 Views, News, Previews ST. CHARLES of Sezze, one of the two saints whose canonizations are noted in this issue's "Survey of Roman Documents," was born in 1613 in the small town of Sezze, Italy, a few miles to the south of Rome. Born Giancarlo Macchione, he received only a rudi-mentary education which taught him to read and to write; at the age of twenty-two he was received, against the wishes ~of his relatives, into the novitiate of the Roman Franciscan Province and was given the name of Charles. After his profession he was appointed to various houses of his province and was finally stationed in Rome at San Fran-cesco a Ripa where he continued to live until his death. Outwardly he led the humblest kind of life, being employed as gardener, cook, sacristan, and beggar for the community. Inwardly, however, he led a life of sublime mysticism. He was the recipient of many extraordinary mystical graces: visions, transverberations, intuitive knowl.edge of con-sciences. To Alexander VII, Clement IX, Clement X, and Clement XI he predicted their election to the papacy. The trials of his life ~vere comparable to his privileges. He was subject to intense interior desola-tion;" God also allowed him to be tried by vehement passions, especially those of anger and lust; and apparently it was only his practice of severe and continued penance that permitted him to persevere in the path of ~anctity in spite of the temptations to which his passions led. At the order of his superiors he composed in prose and verse a consider-able number of spiritual writings which are characterized by a style as simple as it is profound. A few of these writings have appeared in printing, but the great majority of them remain unpublished. St. Charles died on January 6, 1670; he was beatified two centuries later by Leo XIII; according to the decree of canonization the commemoration of St. Charles is to be made on January 6. St. Juana Joaquina de Vedruna de Mas, the second of the two saints mentioned in this issue's "Survey of Roman Documents," was born at Barcelona, Spain, on April 16, 1783, to a family both pious and well-to-do. Even as a young child she was the recipient of many signal graces, not the least of which was the ability to see God in all the events that happened to her. At an early age, she felt drawn to the religions life and at twelve she expressed a wish to join the Carmelites. Religious life, however, was not yet in God's plans for her; and at the age of six-teen she married a Barcelona lawyer, Theodore de Mas. Nine children were born to the marriage, six of whom later became religions. During her years of marriage, St. Joaquina showed herself a model wife and mother. When Napoleon invaded Spain, Joaquina and her children 300 VIEWS, NEWS, PREVIEWS were forced to flee from their home, while Theodore fought with the Spanish troops to repulse the invader. Soon after peace was established, Theodore died, worn out and exhausted by the hardships of the cam-paign against the Napoleonic invasion. Widowed at the age of thirty-three, Joaquina devoted herself to the care of her children. After they were raised and provided for, the desire for religious life reasserted it-self once more; and at the advice of a Capu.chin father she founded a new congregation, the Carmelite sisters of Charity. The purpose of the new institute was to educate the daughters of poor families and to care for the aged. At the time of the foundation of the institute St. Joaquina was forty-three. The rest of her life was largely occupied with the train-ing of her daughters in religion. Courage, humility, work, and joy were the characteristic qualities she wished to see in her religions. Her own spiritual life was characterized by an ardent devotion to the Most Blessed Trinity as well as by the practice of heavy penances. She died in Barcelona on August 28, 1854; at the time of her death her congrega-tion totaled twenty-~ven honses. St. Joaquina's cause was introduced on January 13, 1920, and she was beatified on May 19, 1940. Her feast is to be kept on August 28. The last command of Christ before He ascended into heaven was, according to Mark 16:15, "Go into the whole world, and preach the gospel to every creature." The command thns laid upon the whole Church through the Apostles should have special meaning for religions who have bound themselves to be the perfect followers of Christ. For this reason it is salutary to reflect on how much is still to be done before the gospel is preached to every creature. Of the 2,684,660,000 persons in the world professing a religion, only a little more than 31% are Chris-tians, while not quite 19% are Catholics. Even more sobering is the realization that only 47 % of the world's religions population is mono-theistic, the larger part of the human race being polytheistic, pantheis-tic, or the like. Missionary activity, then, must continue to be one of the primary activities of the Church and it is to be expected that as in the past religions will make that activity one of their chief preoccupa-tions. Inforrnations catholiques internationales for June 1, 1959, contains a valuable, country-by-country survey of vocations to the priesthood in Europe today. According to this survey Spain, which in 1769 pos-sessed 65,823 priests, now has only 23,372. In relation to Spain's total population, there is one priest for every 1,264 inhabitants; in this con-nection, however, it should be remembered that most of Spain's priests are massed in the northern part of the country, the southern part be- 301 VIEWS, NEWS, PREVIEWS ing decidedly lacking in priests and vocations. A survey made in Spanish seminaries during the years 1952-1957 showed that 30% abandoned their seminary studies during that time. Of all the European countries Portugal is worse off with regard to priests and vocations, having but one priest for every 1,773 inhabitants. The loss in seminaries in Por-tugal is high; only about 20% of those entering seminaries persevere in their studies and are ordained. Ireland is exceptionally well off, for it has one priest for every 593 inhabitants; it should also be noted that esch year for every Irish priest ordained for work in Ireland itself, another Irish priest is ordained for work in countries other than Ire-land. England with a total of 7,040 priests has one priest for every 1,214 Catholics. A notable characteristic of English vocations is the large number of late vocations. Holland is well off with regard to priests, having one priest for every 480 Catholics; since, however, most of these priests are not engaged in parish work, the actual working ratio is one priest in parish work for every 1,220 Catholics. It should also be noted that Dutch religious priests constitute 13% of the total number of priests in missionary work. Perseverance in seminary studies is a prob-lem in Holland; in 1925, 5~)% of those entering seminaries were ordained; at the present time, however, that percentage is down to.25 %. Belgium has one priest for every 878 inhabitants and has 30 vocations to the priesthood for every .10,000 population. West Germany has but one priest for every 1,568 Catholics; it consequently needs priests badly but an increase in vocations does not seem likely in the near future. Austria too needs priests, having but one priest in ministerial work for every 1,439 Catholics; it has been estimated that the country needs 1,700 more priests to adequately meet its needs. Italy possesses 1 priest for every 1,008 inhabitants, but the priests are badly distributed. North Italy has many priests, while the southern part needs a large increase in them. 70% of those beginning seminary studies drop out of the seminaries before ordination; moreover the age level of Italian priests is high, 55 % Of them being over 50 years of age. 302 uestions nswers [The following answers are given by Father Joseph F. Gallen, S.J., professor of canon law at Woodstock College, Woodstock, Maryland.] You have often said that it is the sense of canon law, the mind and will of the Holy See, and the doctrine of authors that a diocesan congregation should become pontifical. I ha~e heard others either refuse to accept or deny this bpinion. In anticipation of this objection, I carefully refrained from stating my own opinion in an article on this matter and explained the question from the opinion of others (R~.vx~.w FOR R~.LIGXOUS, 9 [1950], 63-68). The conclusion of the article is pertinent to the present objection. "The reader is now in a position to give his own answers to the questions of this article. These answers should be based primarily on the mind and will of the Holy See and on the common opinion in the Church. If the will of the Holy See is evident with regard to any action, arguments in favor of or contrary to that action are simply a matter of indifference." This question is outside the field of personal opinion, since the Holy See every five years asks a diocesan congregation in effect: "Have you or do you intend to make a petition for pontifical approval, and if not, why not (Quinquennial Report, n. 4)?" Father Gambari, an official of the Sacred Congregation of Religions, was recently asked the same question and replied: "Yes, indeed, it is the mind of the Holy See that the diocesan communities which have the conditions required become pontifical. Diocesdn character is only a stage of preparation for the pontifical character . The mind of the Church is that diocesan communities become papal, so they must be connected with the Holy See directly rather than to the Holy See through different bishops (1957 Sisters' Institute of Spirituality, 155)." What do we get out of becoming pontifical? This question or objection is now being proposed quite frequently. My conjecture is that the objection has its source in the unwillingness to abandon the false opinion that diocesan status is permanent and definitive, whereas it is only initial,' temporary, and probationary. The objection is founded on the profit motive, which has its legitimate place but not against the expressed will of the Ho!y See. The intrinsic arguments for pontifical approval were also given in the article cited in the preceding question, from which I quote the following: "The intrinsic arguments for seeking papal approval emphasized by the authors cited above are: (1) the government and the constitutions of the institute 303 QUESTIONS AND ANSWERS Review for Religious receive a greater authority; (2) the central and internal government becomes stronger; (3) the unity ~f'government, spirit, and ministries of the institute is preserved; (4) the institute is endowed with a greater stability and is thus better able to preserve its original nature and accomplish its original 'purpose; (5) the life and government of the institute become more ,autonomous; (6) the institute has a greater liberty of diffusion and thus of increase. To these can be added: (7) the more autonomous character of the institute naturally begets, a greater internal initiative; (8) the immediate subjection to the Head of all Christendom and the wider diffusion of the institute are more apt to engender the universal viewpoint of the Holy See; (9) the constitutions approved by the Holy See and examined and corrected by specialists will very likely possess a greater excellence and utility." (REVIEW FOR RELIGIOUS, 9 {1950], 68) Are more American diocesan congregations becoming pontifical? The answer is slowly and cautiously in the affirmative. As will appear from the figures given below, 1957 was a more optimistic year. These figures are taken from the unofficial publication, L'Attivit~ della Santa Sede. They are evidently incomplete. This publication gives the names of the institutes that were approved. The ages of the twelve American congregations that received their first pontifical approval are very interesting. Their foundation dates, as given in popular manuals, put them in two distinct classes, the very old, and the rest; but not all of the latter are very young (18"33, 1842, 1854, 1858, 1858, 1859, 1859, 1864 and 1902, 1916, 1918, 1929). The average age of the former group is 106 years. We have given the conditions necessary for pontifical approval at least twice in the past and we quote them again. " . . . a diocesan congregation should not delay its petition for pontifical ap-proval until it has the size that admits or demands a division into provinces. Unless special difficulties exist against this petition, and such difficulties must be explained to the Sacred Congregation, the diocesan institute should request papal approbation as soon as the necessary conditions are verified. These are: a) the congregation by a sufficient test of time should have given proof of stability, religious observance, piety, and spiritual profit of its works; b) it is sufficient that the con-gregation number one hundred and fifty members. It is not required that the congregation have houses in more than one diocese." (REVIEW FOR RELIGIOUS, 11 [1952], 14; 12 [1953], 253), These conditions demand merely that the diocesan congregation have grown to a vigorous youth. Pontifical approval is not to be requested in the weakness of infancy nor in the uncertainties of childhood, but we are not to conceive pontifical approval as a refuge for the aged nor as a geriatric stimulant. 304 September, 1959 QUESTIONS AND ANSWERS Decree of Praise Total United States Definitive Approbation Total United States 1943 9 0 -- -- 1948' 5 0 5 0 1950 7 0 14 1 1951 9 2 -- -- 1953 8 1 3 0 1954 3 1 3 1 1955 1 0 2 0 1956 6 2 3 1 1957 24 6 18 2 72 12 48 5 Something strange, at least in my opinion, occurs at times in relation to our local and provincial chapters. A local superior will preside at the election of the delegate and substitutes in his house; and yet, because his term of office has expired, he himself will not be a member of the provincial chapter. The same thing happens to a provincial when his term expires after the provincial but before the general chapter. Am I right in thinking these occurrences strange? If so, how can they be avoided? An ex officio member of a chapter loses his membership if he no longer holds the same position at the beginning of a chapter; for example, a brother provincial who has ceased to. hold that office, even if only after the provincial chapter, is evidently not an ex officio member of the general chapter. The new brother provincial is, since he holds the office to which the ex officio membership is attached. This is also ob-viously true of a local superior when an ex officio membership is attached to this office. It is not contradictory but at least somewhat incongruous that an elected delegate from a house would ente.r a general or provincial chapter as a delegate of a house after he had been transferred from it. The same thing is true of a delegate of a territorial group. It would be almost equally incongruous to transfer religious, from houses or territories of groups after the convocation of a general or provincial chapter and before the completion of the house or group election of delegates. Such transfers would make it more difficult for the religious to know thos,e qualified as delegate~. All transfers of superiors or subjects of this nature could also expose the higher superior to the suspicion of self-interest or intrigue. ~here is no law of the code nor any general practice of the Holy See on this matter. The following minimum legislation would be necessary in the constitutions to avoid the situations described above. (a) From the date of the convocation of the general chapter until its completion, 305 QUESTIONS AND ANSWERS Review [or Religious no provincial may be changed from his cffi~e. If his term expires during this interval, it is extended automatically by the law of the constitutions until after the general chapter. (b) The same law is to be enacted for local superiors when ex officio membership is attached to this office and if there are no provinces; if there are provinces, the law extends only to the completion of the provincial chapter. (c) .Elected delegates and substitutes are not to be transferred after their election from the house or territory of the group. This extends also to a removal of local superiors elected as either delegates or substitutes in other groupings. (d) After the convocation of the general chapter and until the local chapters are completed, religious are not to be transferred, except for an urgent reason, from one house to another or, when territorial groups are in use, from one territory to another. Such legislation is contained in the constitutions of some lay insti-tutes. Usually it goes beyond the minimum norms and forbids the change of any superior or religious from the date of convocation until the close of the general chapter, either absolutely or outside of necessary and urgent cases, for example: "From the date of convocation of the chapter, the transferring of religious or superiors from one house to another is p.ermitted only for grave reasons, approved as such by the general council. The same holds for the deposition of superiors." Such norms may also be contained in the customs; and, if they exist neither in the constitutions nor customs, at least the minimum norms given above should be followed as principles of prudent government. The avoidance of such situations is a sufficient reason for the competent higher superior to prolong the term of a provincial or local superior, since the Holy See itself admits the sufficiency of this reason in approving constitutions. In our pontifical institute of simple vows, all the religious pro-fessed of perpetual vows are members of the general chapter. In the reply to our quinquennial report, the Holy See told us to institute a system of delegates. We do not want delegates; we wish to retain our' vote. What are we to do? There can be no objective obscurity or confusion as to what you are to do when the Holy See has told you what to do~ As stated before in the REVIEW FOR RELIGIOUS, there are published corrections of constitutions which show that the Holy See was demanding a system of delegates at least as far back as 1887. The purpose of a system of delegates is to secure competent membership from the entire institute but to confine~ the chapter within a workable and efficient number of members. A system of delegates is also necessary now for the general and regional chapters of nuns. The necessity of delegates was explained and em-phasized in the REVIEW FOR RELIGIOUS, 10 (1951), 187-90. 306 September, 1959 QOESTIONS AND ANSWERS Our pontifical congregation is not divided into provinces, but we are considering such h division. How many members would each provinc'e send to the general chapter? If we decide rather to include a division into'regions~ in our constitutions, how many members would each region send to the general chapter? In institutes divided into provinces, the provincial is a member of the general chapter in virtue of his office. This is true also of the superiors of vice-provinces, quasi-provinces, regions, and vicariates. The elected delegates from a province to the general chapter are almost universally two, most rarely three or four; and they are practically always elected in a provincial chapter. The Holy See has approved, even recently, variations of this norm, for example: "one or two delegates according as the province has less or more than a hundred members"; "one delegate for each province but two delegates for any province that exceeds three hundred." The practice on delegates from vice-provinces, quasi-provinces, regions, and vicariates varies. In some constitutions, they are given no delegates; in others all are granted one or two; and in some institutes one or two according to the number of professed religious in the territory, for example, one delegate if there are less than forty religious, two if forty or more. At summer school this year, a religious was complaining of the fact that a very large house sent only the same number of delegates to the general chapter, e.g., a house of twelve would have the same representation as a house of seventy-five. I brought out the fact that, according to our constitutions, a house sends one delegate for every twelve professed members. Why don't all institutes have this fair norm? Both of the institutes in question h

Issue 1.5 of the Review for Religious, 1942. ; RI::::VII:::W FOR RI::LIGIOUS ' VOLUME I ~SEPTEMBER 15, 1942 NUMBER 5 CONTENTS OUR FRIENDS. THE ANGEl~S---Clement Andlauer. S.J . 290 PAMPIa.~.~ET. NOTICES . " . 300 PATR~:-I~:~'~BEDIENCE IN TIME OF WAR John C. Ford, S.J. . 301 BOOKS . ; -,, AL . 305 THE SUPERNATURAL LIFE--G.Augustine Ellard. S.J . 306 SUPPLYIN.G DAYS OF ABSENCE FROM THE NOVITIATEm Adam C. Ellis. S.J . 322 IMPORTANT ANNOUNCEMENTS---The Editors . 326 THE "NEW COMMANDMENT" OF LOVEmMatthew Germing, S.J. 3~7 THE APOSTOLATE TOASSIST DYING NON-CATHOLICS-- Gerald Kelly, S.J . 338 COMMUNICATIONS (On Spiritual Direction) . 34 BOOK REVIEWS-- OUR MODELS IN RELIGION. By Brother Jean-Baptiste. F.M.S. 350 THE SOLUTION Is EASY. By the Reverend Mark Schmid. O.S.B. 350 THE DIALOG MASS. By the Reverend Gerald Ellard. S.J. 35 ! . THIS ROSARY. By the Reverend Anthony N. Fuerst . 353 BOOKS RECEIVED . . . 353 QUESTIONS AND ANSWERS-- 28. Visting Relatives . 29. Non-acceptance of a dispensation from Vows . " . . . 354 30. Occupation of Novice during Canonical Year . 35.5 31. Scapular Medal worn by Religious . 356 32. Absence from the Postulancy . 356 33. Re-admission of an ex-Religious . 357 34. Local Superior's power to grant Permissions . 357 35. Dismissal of Postulant without giving Reason . " . . ~357 ,THE LETTERS OF SAINT BONIFACE . 358 DECISIONS OF THE HOLY SEE OF INTEREST TO RELIGIOUS 359 REVIEW FOR RELIGIOUS, September, 1942. Vol. I, No. 5. Published bi-monthly: January, March. May, duly. September. and November, at The College Press. 606 Harrison Street, Topeka, KanSas. by St. Mary's College, St. Matys. Kan-sas, with ecclesiastical approbation. Entered as se~ond class matter January 15, 1942, at the Post Office. "Topeka. Kansas. under the act of March 3. 1879. Editorial Board: Adam C. Ellis. S. J., G. Augustine Ellard, S.J., Gerald Kelly, S.J. Copyright. 1942, by Adam C. Ellis. Permission is hereby granted for quotations of reasonable length, provided due credit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S. A. Our Friends, The Angels Clement Andlauer, S.3. A MATERIALISTIC age such as ours is embarrassed when confronted with the attitude of. St. Francis of Assisi toward nature. To hide their discomfort, moderns often accuse him of exaggerated sentimentality ~t0ward creatures. To St. Francis every creature; ~vhether animate or inanimate, was a brother o~ sister. No object was so low that it did not merit his love and p~otection, his reverence and praise. Tide world around him was one huge family of which he wa~s a member, and in that family circle he rejoiced to recognize his kin, no matter how infe-rior or even repulsive they might be in themselves. The thing that made St. Francis feel at home with the world around him was the consciousness of'a common Father in heaven. All things come from God, and in them all is reflected the perfection of~od. Why, then, should anyone be ashamed to acknowledge kinship Gith tbe wdrks of God's hands? How could. St. Francis help calling the' birds and beasts his brothers and sisters? This is not the exaggerated sentimentality which raises an animal to the status of a human being. It is an intensely human applica-tion of principles of cold logic; the principle that God is the first beginning and last end of all things, the principle that the Divine Essence is th~ model of every created thing. And whether or not we apply these principles in our own lives, the conclusion follows that together with the world around us we form one family. Among the members of our great created family are the angels. Despite the great difference beti~'een their nature and ours, they are our brothers in a higher and truer sense ~han the rest of creation. Even though .their splendor is so 290 - great that they havebeen mistaken by men for God Him-self, still they are creatures. St. John tills us in his Apoc-alypse that an angel spoki~ to him,, "And I fell down before his~ feet to adore him, And he said to me: 'See you do it no~. I am thy fellow-servant, i~nd of thy brethren, w.ho have the testimony of 3~sus. Adore God.'. " Here we have it on,~the word of one of the noblest spirits in heaven that he is our brother. Angels come from the same hand that made us: they are patterned after the same Divine Essence: alone of all other creatures they share with us an intellect and will. If this is not enough to/hake them our brothers, there remains the fact that angels and men are the adopted children of God. Supernatural union with God is our common end; God's grace raises us both to a state above our natures, and God is our mutual Father ifi a .very special and .sublime sense of the word. Our Elder Brothers The angels are our, elder brothers, the more illustrious members of our family. Save for the fact that the Son of God paid us the honor of taking to ,Himself a human; not an angelic, nature, these brothers of ours are far superior, to us. In man is reflected .the existence, the life, the activity of G~d; but all'of these perfections are intimately dependent on matter. Only in the angels do we find these attribufes of God mirrored independently of matter,'~, as they are in God, Because angels exist and act. without the slighest neces-sary connection with matter we call them pure spirits. Our souls are indeed spirits; that is, they are stibstances which have no component parts into which they can be ~separated. They can exist aside from matter, and in their highest operations they depend on matter only as a necessary con-dition. But our souls are brought ifto beihg brily on the 291 CLEMENT ,~NDLAUER condition that matter is rightly disposed. BY their vgry nature they are destined to be united to a material body without which they are incomplete. In their intellectual acts, our souls lean so heavily for support on our bodies that if our sense channels are blockaded by disease or acci-. dent, our mental life is nil or at the best extremely meager. Even a departed soul retains an aptitude for the body it once inhabited. It was~ destined for intimate .union with that body for all eternity, and only when the body rejoins the soul at the resurrection will the complete substance.man exist again. But with the angels it is otherwise. They were never intended to be joined tO matter, or to be depend-ent on it in any way for their life and activity: hence we call them pure spirits. Not only do th~ angels surpass us in the more perfect way in which they show forth God's existenc.e~and activity, but they participate in His power more completely than men. What a struggle'Our poor intellects have in acquiring truth. How faulty is our cognition of many things when we do acquir~ some knowledge of them. Unless an object can be reached by our senses we cannot know it directly but only by analogy. But for an angel it is no Struggle, no matter of syllogizing to attain truth. His cognition is not a mere scratching of the surface to find a similarity. His keen intellect goes to the very essence of things at once and sees ramifications that the wisest men miss after the study of a lifetime. For an angel an examination would not be the painful, ordeal it often-is for us, but just another pleas-ant occupation. These spirits also surpass us .in what we ordinarily call power. It would be a great mistake to imagine that because they have no bodies fhey. have no .powe'r over material objects. Man has become adept in imposing his will on the world .around him by the clever use of the laws of nature, 292 OUR FRIElqI~, THE ANGELS but he must always make use of material instrumentssuch as machines or chemicals. An angel do,es not need a crowbar to move a huge;rock. Indeed, he couldn't use one, since he has no hands. But by his deep insight into the physical laws and by the~ power inherent in his nature, an angel could move that rock more quickly, than we could for all our crowbars. A Valuable Relationship So we see that these brothers .of ours are very. wonder-ful creatures. They are relatives whom we need not be ashamed to acknowledge before the most distinguished meh of ~his earth. It is ratl~er flattering to us to have such hon-orable family connections, but most of us desire, something more substantial than the vicarious limelight of important relatives. If our brotherhood with the angels does nothing more than tickle our Vanity, then it is an interesting but not very.useful doctrine. Therefore~ it is natural for us to ask what, if any', i~ the value of such a relationship with the .angels. Things rarely have any value in themselves; their importance usually comes from their relation to other things. Diamonds would not be valuable if all the rocks in the world were diamonds. But when we look at the world as a whole and see the position that~tha~"pecul.i._ar rock, the diamond, has in the mineral world we under-stand why diamonds are worth money while a piece of sandstone of the same size is worthless. If, then, we look at the position of angels and men in tile plan that God has established in this universe', we begin to understand the very practical use of our brotherhood with the angels. We know that God did not create this world without any purpose in mind. 'On the contrary, reason and faith teach us that God engaged in the work 6f creation to share 293 CLEMENT ANDLAUER His own ,divine goodness with other beirigs as far .as that was possible. Intimately connected "with this end' is the happiness of man, a happindss which in the present order means union with God in the Beatific Vision. Now, while we cannot ~frustrate the first purpose of God, since, by our very existence we share in the perfections of God; unfor- ~tunately for us we can, by the wrong use of our free wills, very effectively prevent God's second and conditional inten-tion from being iealized. Indeed, without special, help from God, it would be extremely difficult-for us not to frustrate this end and thus lose our ~eternal happiness. However, it is hardly_ becoming God's dignity and man's liberty that God should constantly step in to keep us on the right path. A wise employer does not try to handle every department of his business himself. He uses foremen~ and intermediaries. He keeps a watchful eye on the work as. a. whole to see that things go as ithey should, but he leaves his men to work together 'to accomplish the task undertaken. This is what God has done. He designs the whole operation and then allows His creatures to work together, the lower helping the higher, and the higher directing, and watching' over the lower. As St. Thomas ~puts it, "G6d directs lower creatures by the higher;, not because of any defect in His power, but out of the abun-dance of His goodness, that He :might:also give tO creatures some of'the dignity He enjoys as the cause of all things~" Ndw we begin to see the value of our connection with ,the angels. Looking at God's providence 'in its complete-ness we should be surprised if He did not use the :angels to assist us in reaching our last end. If God has communi-cated so,~ much of His infinite perfection to our elder brothersl is it no~t'reasonable .that He should also allow them to assist Him as the cause of' all things? Is it not just what we should expec~ of God's goodness that He would 2§4 OUR FRI~IqD~, THE ANGELS arrange for the ,more perfect members of His family to guard and help the less perfect members? fit Consoling Doctrine -If we have any doubt about the matter, we need but examine Scripture and the teaching of the Church. In the Psalms we read, "For He hath given His angels charge over thee: to keep thee in all thy ways." And again, "The angel of the Lord shall encamp, round about them that fea.r Him; and shall deliver them." It was for this reason that Christ warned the Jews not to despise the little children, those seemingly unimportant mites. "See .that you despise not these little ones, for I say to you that their angels in heaven .always see the face of my Father Who is in heaven." Fathers and theologians have so .insisted on the doctrine that every man has a guardian angel that we cannot doubt this fact without the greatest rashness. The Catechism of the Council of Trent also illustrates this truth in a homely way. It reads, "For as parents, if their children have occa-sion to travel a dangerous way, infested by robbers, appoint persons to guard and assist them in case of attack, so does our Heavenly Father place over each of us, in our journey toward our heavenly home, angels to protect us by their aid and v;ratchfulness, that we may escape the snares secretly laid for us by our enemies, repel their ,horrible attacks on us, and proceed on our journey along the road that leads directly to our end. By their guidance we are saved from the devious wanderings into which our treach-erous foe might betray us, to, lead us aside from the way that leads to,Heaven." Could anything be more consoling than this do(trin~ at thosetimes when we feel so keenly our own weakness? It teaches us not only to hope for but to expect help from creatures that are more like to God. than we are. Obviously, 295 (~LEMENT ANDLAUER r~ we should not look for. such visible and extraordinary ix~tervention in our problems as Tobias had. Our angels will not appear as young men in shining armor tol strike down our enemies as did the angel when Heliodorus attempted to rob the temple of Jerusalem of its-treasures. But we can expect the kind of protection that the valiant Judith received. Inspired by God she went with one maid-servant into the camp of the Assyrians who were besieging Bethulia. For four daysshe dwelt there in the midstlof the dangers of camp life until God delivered Holofernes, the leader of the Assyrians, into her hands and she cut ,off his head. On her return to ]3ethulia unharmed and undefiled she told her countrymen, "Bu~ as the Lord liveth, His angel hath been my keeper, both going hence, and abiding there, and returning from thence hither." No matter how dangerous or difficult our duty may be, the Lord's~ahgel is our keeper and we need have no fear. i ~ Every day our guardian angels protect us from physi-cal dangers, but more important still they ward° off spir-itual dangers. We go through life constantly assaiied by. the spirits of evil who lead us .into sin. ' Against the~se evil ¯ spirits, who have lost none of their great intelligence and power,' we poor Weak men have'to struggle. With~God's grace we can put them to flight; but what a relief i~ is to "have a spirit equally~ powerful or even more powerful fighting¯ on our side. What a consolation in. the hour of death, when our faculties are.weakened and the evil spirits redouble their' efforts fo~. a. last desPerate attack, to have one. who will carry- on. the battle for us.~ This.~isth~ time when our ,guardian angels are most needed, and iri .thi~ hour ~heir whole power is devoted to our protection, i Another officeof our angels is that of counselor. It was an angel that advised Joseph in a dream to take M~ary as ¯ his spouse, to take the Child and fly into Egypt, tol bring 296 OUR FRIENEE, THE ANGELS the Child back again. This is not the way the-angels usually speak to us, but they do speak to us just as truly as if we exchanged "words with them. Frequently they suggest good thoughts to us in such a way that we quite naturally take them for our own thoughts. They urge us to do good works, and we do not realize that we are being~ led by the inspiration of. our guardian angels. In our afflictions they are close .to us to teach us patience and resig-nation, to fill us with faith, to .whisper words ofohope in the good with which God wil~l crown our sufferings. In our joys they rejoice with us, they cause in us thoughts of gratitud~ to God and encourage us to serv~ Him more faith-fully~ There is hardly a Catholic who in some perplexing situation has not had recourse to his angel and received from him the advice he sought. It isa frequent experience with all of us, but because our minds are so easily capti-vated by material objects our counselors sometimes meet stiff opposition in their work. Scripture calls our attention to another duty of the angels: the offering .of our prayers to God--increasing the value of our cold petitions by uniting to them their own ardent supplications. The angel Raphael told the older Tobias, "When thou didst p.ray with tears I offered.thy prayers to the Igord.". And in the Apocalypse St. ~lohn tells us that he saw an angel who mingled much incense with the prayers of the saints and offered them to God. Prayer, decently offered, is always listened to b~ God, but praye~ fervently offered is more acceptable. Our angels a.re so closely united to us that our needs become.as it were their needs, and our petitions become their petitions; and who can say how often the ardent and undistracted prayer of our angels has obtained for us an.answer to our prayers? And so it g6es all through life. From our births to our deaths these untiring guardians stand ready to protect and 297 ,guide us. The task that began with our entrance into this ¯ life ends only when our souls depart from our bodies. As we prepare to enter the door of eternity the Church prays, "Come forth to meet him, ye angels of the Lord, receive his soul and preser.ve itin the sight of the Most High." As the body is carried to its last resting ,place it is accompanied the words, "May the angels escort thee to Paradise. At. thy c.oming may the martyrs welcome thee, and conduct thee, to the Holy City ~lerusalem. May a choir of angels receive thee, and with Lazarus, once poor, mayest thou have rest everlasting." After Death ". Strictly speaking, after the last great battle on our behalf against the powers of darkness the mini,~trations of our guardian angels cease. Now we are beyond the power to be helped by them or to be harmed by the evil spirits. Our course, is run, and all that remains is the decision of the ,ludge. But though their work as guardians is. completed. we can hardly imagine that those who have been so close to us for so many years and who have had such an interest in us will cease to .care for us. To the Throne of God they lead th~ souls of their charges. There they step ~side while the ,Iudge pronounces sentence. If the sentence be Purgatory, once more the angels take up the souls and bear them to that sad prison. Here the souls must remain until their debts .are paid; but it is not unlikely that from time to time they are consoled and encouraged by the visits of their angels. When at last the purified" souls come forth, it is to meet their angels who will lead them to .the company of the Queen of angels and her-Divine Son. What 10ve and hap-piness the soul and its angel will experience°in each Other's company is easy to imagine, for they are now doubIy dear to one another, and together through eternity they will look OUR FRIENDS, THE ANGELS upon the Face of God and marvel at His wisdom that ,united them so intimately. Such then is the way that our Father in heaven has ¯ ordained that our illustrious brothers the angels should assist us in our journey through life. Modern critics call it a pious remnant of pagan superstition, but to anyone who understands the teaching of the Church about the angels it is clear that the Catholic doctrine has no connection with¯ the pagan attempt to explain the mysteries of nature by the workings of capricious; invisible beings. Neither is this teaching a fairy story to delight¯children. As we grow older, life loses many of the pleasant aspects that enter-tained us as Children. We get knocked about and learn hard lessons. But no matter how old or how wise we may become, there always remains the beautiful doctrine of the guardian angels that. thrilled us at seven and consoles usat seventy. How about our side of the picture? How are we to. repay these guardians of ours? To speak of repaying our angels would be to insult them, f6r they act solely because of love, and we, don't repay an act of love with baser cur-rency. But we do have obligations of love, gratitude, and reverence that we cannot dismiss. St. Bernard dwelt upon these duties of ours in one of his sermons; and we can do no .better than to leavethis study of the angels.with his words" in our ears: "What respect this do~trine of the guardian angels should arouse in you, what devotion it should pro-duce, what confidence it should inspire. Respect for their presence, devotionto their unselfish love, confidence in their watchfulness. Wherever you may lodge, or in whatever retired place you may be, respect your angel. Will you dare to do in his presence what you would not dare do before me~ Do you doubt that he whom you do not see is present? Then let us be faithful, let us be grateful to such guardians. 299 CLEMENT ANDLAU'ER They never fail us, they are wise, they are powerful; what' shall we fear? And so, brethren, in God let us love His angels affectionately as our co-heirsin the future and as our protectors and teachers, placed over us by our Father, in this life." PAMPHLET NOTICES In Novena to Our L~dd~ of Victor~ , the Reverend Raymond A. Panda has ar-ranged a number of very appropriate prayers and hymns for congregational 'use. The pamphlet bears the Imprimatur of the Archbishop of Milwaukee: is published by Lawrence N. Daleiden and Co., 218 West Madison St., Chicago, I11. NO price given on our review copy. The Ser~,ant of God. Brother Meinrad Euester O.$.B. is the simple story of the lif~ of a Benedictine Lay Brother whose cause for beatification has been inaugu-rated. 32 pages. For further ir~formation, write tothe Grail, St. Meinrad. Indiana. The Militant~ Christian Vir',des by the very Reverend Ignatius Smith. O.P. is a reprint of an article that appeared in the s~:holarly Dominican Quarterly, The Thomist. Father Smith gives~a compact synthesis of the teaching of St. Thomas Aquinas on the stern Christian virtues, particularly of.vindictive justice, just anger, righteous indignation, and virtuous contempt 0f crime. These things, contends the author, demand~study now and practic~ both now and in'the peace that is to follow this war. The pamphlet contains~,a brief discussion outlin.¢, and a large number of references tothe works of St. Thomas. 32 pages: sells for 5 cents a single copy, 50 copies for $2.25, 100 copies for $4,00, postage extra in each case. Write to the National Catholic Welfare Conference,, 1312 Massachusetts Avenue, N. W., Washington. D. C. 300 Pa :rio :ic Obedience, in Time o1: War John C. Ford, S.J. IN .THE Catholic scheme .of things all lawful authority comes ultimateiy frdm God. The civil rulers of peoples, whether they be kings or premiers of presidents, whether the~, believe in God or not, and whether they keep His law or'not, are nevertheless His ministers when they act within the bound~ of their a~uthority. St. Paul is not speaking of believers, but of the pagan rulers of his day when he exhorts Christians thus: "Let everyone be subject to the higher authority, for there exists no authority except from God, and those who exist have been appointed by God" (Romans 13, 1). And St. Peter likewise: "Be subject to every human creature for God's sake, whether to the king .as supreme, or to governors as sent through him for vengeance on evil-doers and for the praise of the good. For such is the will of God that by doing go6d you should 13ut to silence the ignorance of foolish men. Live as freemen, yet not using your freedom as a cloak of malice but as servants of God. Honor all men; love the brotherhood: fear God; h6nor the king" (I Peter 2, 13-17). And Our Lord Himself upheld the authority of the Scribes and Pharisees even while He rebuked them, saying: '~The Scribes and the Pharisees have sat on the chair of Moses. All things, therefore, that they .1Father Ford originally wrote this article at the request of the editors of the Boston. Traoeler. It first appeare~d in that publication under date of May 26, 1942. It was later reprinted in the Congressional Record, May 28, 1942, page A 2139. We . reprint it here with the permission, of the publishers. We asked permission to reprint it because, though not written specifically for religious, yet its clear statement of the Christian duties of Obedience and Patr,otism will undoubtedly be Of use to our readers whether for personal meditation or in their apostolic miaistriea.~ED. 301 JOHN C. FOP.D command you, 6bserve and do. But do not act according to their works. " (Matthew 23, 2-3). Citizens, especially in a-democracy, have th~ right and the duty to inquire into the government's policy, to criticize it, to make efforts under.the laws and the Constitution to change it if they disapprove ot~ it. But if they want to prac-tice the Christian virtue of civil Obedience they cannot do any of these things in.a rebellious spirit. They cannot be . so disposed that they intend to disobey when they disap-prove. The obedience of a reasonable man is not blind. No virtue can ignore truth. If I know that something is black I cannot say it is white. But obedience does not depend on speculative approval of commands or the poli-cies behind them. Mu~h less does it depend on approval of the tiersonal characters of those in authority. Obedience sees the authority of God in the ruler. It is the first prin-ciple of united action under lawful authority/. During war time united action is absolutely indispen-sable. And it can be h~d only at the price of sacrifices and h~ardships which will increase rather than decrease as the war goes on. The practice of obedience, then, becomes more difficult just when it becomes most imperative. And if dutiful submission to the cold claims of obedience were our only principle we might easily fail to live up to its ¯ requirements. But there ii another virtue which God has placed in our hearts, the virtue of patriotiim. ~A-new book has juit been published in Boston by the Stratford Company: National Patriotism in Papal Teaching, by Father John Wright. It is an intensely interesting and ,timely work. -The moral pronouncements of the modern Popes on the virtue of patriotism have steered a middle course. That. excessive patriotism which degenerates into nationalism or racism ,is condemned. But condemned likewise is~ the 302 PATRIOTIC OBEDIENCE IN TIME OF opposite error, that a preferential love of one's own country is incompatible ~ith international peace. True patriotism is a well-ordered love of one's fatherland. We are bound, says Benedict XV, to love with asp, ecial attachment thosd with whom we share a commonfatherland. Instinct itself tells us to turn to the fatherland as ~the source of those 'rich cuItural blessings which we have received precisdy because " we are Americans and not of any other nation. True patriotism is part of'the virtue of charity and like religion itself, says Leo XIII, is one Of the ~"two duties of the firit order from which no man in this life can exempt himself," --the love of God and the love of c6untry. Cardinal O'Connell echoed this Papal teaching in his~ Easter message this year when he said: "What America offers and gives and maintains for her citizens is a treasure so pr~ious that it is Sacred. The preservation of that heritage is to every American a sacred trust, and with the possession of that trust goes the sacred obligation to pre-serve, defend, and perpetuate it. That is the meaning, of true patriotism. The defense of our altars and our homes is an bblig'ation which rests upon "e3rery citizen." It is not hard°to obey when,we love what is com-manded. When the motive of sincere love of country.~s added to "the motive of obedience, burdens that otherwise would seem unsuppbr~able become easy to bear. Love con-quers all things. It is a duty theref0re~ to foster this true love of our own United States of America, so that the natural instinct that attaches us to her will become a delib-erate reasonable love of preference permeating all our civic obligations and changing cold obedience to deycoted service. Tru~ patriotism does not mean flag waving. It does not include hatred of other' nations, whether enemies or allies. Nor does it necessarily include love of the admin~s- ¯ 303 JOH~ C. FO~ tration. Administrations come and go. The fatherland endures. But patriotism does e~njoin respect for the execu-tives whom we have chosen to ~atch over our native land. Above all patriotism does not go about shouting: My country, right or wrong! Like obedience it is not a blind but a reasonable virtue. It faces whatever facts there are, and admits the unpleasant ones when they are really facts. But when the love of country ' and fellow countrymen is true and deep, it is. strong enough to stand the strain that. may be put upon it .by governmental policies, or what appear to us t.o be official mistakes. And so in time of war especially there should be a mini-mum of captious criticism of officialdom." We are now fighting for our life. The. heritage of America is at stake. Only united action will preserve it. For we are fighting enemies who are powerful and skilled and "who are also the enemies of all international law and .justice'"- (Cardinal O'Connell). I have often heard the objection made that some of our allies are also the enemies of all international law and jus-tice. Russia is meant. This is undoubtedly a fact and an. ¯ unpleasant one. Russia is not fighting in order to preserve the American way of life.She is fighting, naturally enough, to preserve her own, way of life, which at the moment is the way of totalitarian dictatorship. Com-munistic Russia. is anti-democratic, anti-Christian, and anti-God. " Her principles, therefore, are the very opposite of all that we.mean by American democracy. It would be dangerous folly to close our eyes to this truth. But true patriotism does not have to close its eyes. Those who love their country with true devotion will face the facts realisti-cally, and will not love her any the less because of the cruel n~cessity that has forded her to make such an ally. The American who really loves his country will recognize that 3O4 P&TRIOTIC OBEDIENCE IN TIME OF nedessit.y, will work with all his heart for our own Ameri-" can way of life, and guard it ceaselessly against the insidious infiltration of principles that would destroy it. It is obvious that in a nation as great and diversified as ours, and in a war like this one, absolute harmony of views cannot be expected. There are bound to be differences of opinion as to methods and aims. And so our hope of. united action must be based on something higher, stronger, and more universal than our'individual opinions. I find that higher principle in the obligatory character of the Christian virtues of obedience and patriotism: They teach us to recognize the authority of God Himself in our rulerS, and to respond to an.instinct that God has placed in our hearts by loving with a special 10re the land that gave us birth. When motivated by these virtues even war-like efforts. can be directed too.Almighty God. And indeed if we are to master the unhappy fact of war, rather than allow it to -master us; if we are to keep' it from dehumanizing and brutahzmg us,. as it easily could, we must find something spiritual and Christianizing~in it. The practice of patriotic obedience .out of supernatural motives is the Christian answer to the challenge of war. BOOKS ON TRIAL !~oohs or~ Trial is a review of book-reviews, published periodically by The Thomas More Book Shop. 22 West Monroe Street, Chicago, I11. It promises to be an immense; help to librarians who are desirous of getting "clean, wholesome, and meritorious books." Such is the object of the publishers. A genuine Catholic Action project, it deserves cooperation¯ For further information write to the publishers. 305 The SupernaEural Lit:e G. Augustine Ellard, S.3. THE supernatural life may be defined as a participation~ in the intimate life of God and 'eventually in that form of beatitude which is peculiar to the Blessed Trinity. Every Christian knows that. there are communications of life within God. The Father begets the Son intellec-tuallyo and gives Him the whole of the divine life. In turn the Father and the Son produce the Holy Spirit and give Him also the whole'of the divine life. There the communi-cations of the divine life might have ceased. But, most graciously and generously, the Divine Persons decided that they wouldgrant a sl~are in that life to angels and men After Adam and Eve had received it and lost it again for themselves and their posterity, the Incarnation of the Son was devised as the gland means of.restoring it to men. Thus to the Incarnation of God there corresponds a certain deifi-cation or divinization of men. It is this deification of men which we hope to explain somewhat in this article. Life in general may be described as the power of self-motion. The acts that characterize life begin from within. Where no such activity can be discerned, it is concluded that no life is present. Thus, if a man were noticed not to initiate any movement whatsoever, not even a l~eart-.bea~t or a respiration, he would be pronounced dead. Besides beginning from within, vital activity, at least if it be nor-mal, generally produces .an effect within the agent also, and indeed for the better. Every heart-beat or respiration leaves one a little better than one would be without it. Hence, life may also be said to consist in the power of self-perfection. Only living things can make. themselves more perfect. This d~finition is not quite suitable for God. He 306 THE SUPERNATUK~L does not change, nor can He become more perfect. Div.ine life is that excellence in God whereby, in accordance with His nature, He acts, and by this activity is perfect. In everything that lives, we can distinguish the sub-stance or nature, which is fundamental; thevital powers or faculties by which it acts or moves and perfects itself;-and lastly, vital activity itself. To illustrate: when a man is sound asleep the whole of his substance or nature--body plus soul--is there, resting; his power to see, for example, is suspended; when he awakens again, he will actually see. Degrees of Natural Life Of life that is natural, that is, proportionate to the nature of the being in which, it is found, we know of five grades or degrees; They are: vegetative, animal, human: 'angelic, and divine life. All members of the vegetative kingdom show their powers of Self-motion by nourishing themselves, by growing, and by reproducing their kind. 'Besides having these three functions, animals can also move about freely, and especially they have the life of knowledge that comes through the five senses, and the ~corre.~ponding life of the sense:appetites. In the light of that knowledge they. experi-erice various emotions and desires, and regulate their move.- merits. Men have all the vital functions of plants andanimals. and in addition they have the life of reason and of the will. This is their characteristic mark and that which raises them incomparably above mere animals. Thus far the ~radation is clear and neat. In the purely spiritual realm we find two natural forms of life, the angelic anal the divine. Purely spiritual life has only two great functions, intelligence and volition. In contrast to men, who are said to be. rational, because they come to most of G.AUGUSTINE ELLARD their knowledge by reasoning, that is, by proceedii~g from premises to conclusions, the angels have intuition, that is, a - simple, direct, view of things, even of spiritual realities and truths. Whereas,we can have only an indirect knowledge of spirits and spiritual things, the angels see them as easity and immediately as men perceive one another. Immeasurably above angelic life is the fifth and final grade of natural life, that of God Himself. Being purely spiritual, it also consists in understanding and Willing. But whereas that of angels is limited, the intelligence and will of God are irifinite. They must have corresponding and pro-portionate objects which they alone can reach. As a matter of fact, these too are infinite. Thus the divine intellect has an infinite :intuition or view of all truth, infinite and finite. This is followed immediately by a similar infinite love of all goodness, and by a like fruition of all. beaaty. These three great acts, vision; love, and fruition, of the Infinite, and of all that is finite, constitute the inner life and beati-tude of God. If God had chosen not to create a world, they would make we 'learn that the up'the whole life inner life of God Infinite vision of infinite truth in infinite word or mental expression the Son. Infinite love of the infinite of God. By revelation is not quite so simple. the Father begets an of that truth, that is, goodness in the Father and Son produce the Holy Spirit, the term of that love. Thus, in spite 6f the absolute simplicity of God, there is in the one divine nature a trinity of persons, and though God ~s. umque and w,thout equal,, there is a~certain companion-ship in the oneIDeity. What we may call the external life of God consisti in creating a.nd governing the world, and it culminates in sanctifying and beatifying angels and men. These are all the natural forms of life. We might 'sus-pect that none other is possible. But by faith we come to know of asixth form, which, however, is not nataral, but 308 THE SUVERI~ATURKL L11:~_ su15ernatural. It does not come, from within, .but is super- . added from above; it is s uperhuma, n ,an d even superangelic. Supernatural Life Men can, to some .extent and in~, an external way, "elevate" lower forms of life. By skilful cultivation.or by using special artificial means, they can enable plants to bring, forth more beautiful flowers or bettei fruits than those ,plants left to themselves could produce. In this con-nection the processes of grafting are particularly note-worthy; by them new and very excellent kinds of fruit can be obtained. In grafting there is a real composition of diverse forms of life.' Domestic animals are advanced in various ways by human aid. As things are now, milady's little poodle lives in a.warm dry apartment, without effort on his part receives at regular intervals just the right quality and quantity of scientifically manufactured dog-food, and sleeps,in a comfortable little bed of his own; and if he should be injured or fall sick, he would be taken off to the dog-hospital and enjoy the refinements of modern veteri-nary medicine and surgery. In a porely natural state he would have no protection from the elements, he would eat what he could catch, if he could catch it, and, when he could catch.it; and if anything serious happened to him, he w.ould have to linger in his pain until death released him, coming perhaps 'in the form of a stronger animal to devour him: Among men, a king may m~arry a commoner and raise her to royal rank and dignity. A wealthy man may adopt as his son and heir a penniless orphan. The learned can share their learning and intellectual satisfactions with the, unlearned. In all these cases there is a certain, elevation of one's plane of life, and a participation in the life of~those who have been living on a higher plane. What men cannot do to lower forms of life is to elevate them internally, that is, to give them a new. kind of intrinsic'vital power. 309 AUGUSTINE ~-LLARD If a mere.plant could be made, for example, to see, like. a dog, that vision would be supernatural in the plant, though it is natural in a dog. If a dog could be made to reason, like a man, that reasoning would .be supernatural in the dog, as it is natural in a ',man. If a man should be enabled to perceive spirits as angels do, that perception would be supernatural in the man, .as. it would be natural in an angel. Now then, if a man could by some special dispensation be given the power to do-something that is characteristic of the Divine Persons and peculiar to them-- for instance, to have an intuition of the divine essence--that again would be supernatural in the man, as it would. be natural ,in the Trinity. Such an intuition would be supernatural in an angel also. Participation in a vital perfecti~on belonging to a higher creatable nature, for example, for a man to hold converse with an angel, as was granted to St. Francis of Rome, is said to be supernatural in the relative sense. Participation in a perfection belonging only to the. uncreated and ~divine, nature, for example, immediate vision of the Divinity~ is called supernatural in the absolute sense, This is the meaning which we shall attach to '!supernatural" hereafter in this article, Now it should not' be difficult to see what ismeant by the supernatural life. It consists simply in this, that by a peculiar exercise of omnipotence and of divine munificence, God enables men and angels to share in those three great vital functions which are natural only in the~Divine Per-sons. Men are made to participate in that kin.d of life~ and eventually in that kind of beatitude, which are naturally characteristic only of God himself. They are empowered to have a direct view~ of Infinite Truth itself; a corresponding love of the Infinite Goodness, and a similar fruition of the Infinite Beauty,~ Thus they' have a share.in the life and beatitude of the Blessed Trinity. That they :do so, is very. 310 THE SUPEI~NATURAIL LIFE clear at least for the Blessed~iia heaven. They possess the supernatural life in its :full development, in its maturity. Only in the light of this s~age of it; can it be well under-stood. One could more easily judge, of trees from their seeds or animals from their embryos than understand the supernatural life by studying it merely in its first and lowes~ form. Beatitude If we compare the supernatural life in its beatific stage with .God's own life, we Shall note certain likenesses and certain differences. In general, the objects are the same. It is the same Infinite Truth which is seen and contemplated by God and the Blessed. The same Infinite Goodness is loved by God and the Blessed. It is the same.Infinite Beauty that enraptures both God and the Blessed. But in God the vision itself is infinite and comprehensive or exhaustive, whereas in the Blessed their act of vision is finite and not exhaustive. Similarly', in God love and fruition are unlimited, but in the Blessed these acts are limited and pro-portionate to their vision. In the Father, Son, and Holy Spirit there is the plenitude of the divine life and beatitude: in the beatified, a participation of that life ;,rid beatitude. They have the same thing, but not in its fulness. "Their participation may be compared to the share tha~ the First Lady of the Land has in the dignity of the President, or to the part that a son has in the wealth and station of his father, or to the sharing of pupils in their teacher's learning. In God there is the original, so to speak, of the divine life: in those in heaven with Him, a copy, li~teness, or assimila-tion to that original. In God, vision, enjoyment, and love are natural and all substantially identified with the divine essence; in men or angels these acts are graciously super-added to their natures, and they are not substantial. What 311 G, AUGUSTINE ELL/~D ~God has of Himself and by nature, the beatified have by favor and grace. Man becomes an adoptive son of God, but not a natural Son, like the Word. Deiform beatitude is incomparab!y superior to natural angelic beatitude. The angels who are in heaven now do, as a matter of fact, enjoy supernatural bliss. They have it because they were gratuitously raised to the supernatural order, like men, with the .gift of sanctifying grace. If they had not received it and if in their period of probation they had remained good, they would now be in a state of natural angelic beatitude. In that condition their knowledge, love, and enjoyment of the Supreme Tr~th, Goodness, and Beauty would be mediate, that is through a medium (their "own essences); and though it would be an inexpressibly happy state, there would be nothing in it of the imme-diate vision of God which they now have and which makes them immensely more blessed. Of course their love also would be of another kind, and so would their enjoyment of the divine beauty. The greatest angel that God in all His ¯ omnipotence could create, endowed with all possible gifts and privileges except grace, and .given the highest possible measure of the beatitude that would be natural to an angel, would indeed be inconceivably happy, but immeasurably below any creature enjoying the minimum of God's own special kind of bliss and glory. Likewise, if men had not. been elevated to the super-natural order and destiny, and if throughout their proba-tion they had remained morally good, after death they would be admitted to a state of natural human beatitude, that is,¯ happiness proportionate to the capacities and merits of human nature. They would be united to God. through knowledge, love, and fruition. But this knowledge, being in accordance with the nature of the human, spirit, would be rational, abstractive, discursive. They would 312 THE SUPERNATURAL LIFE know the Creator, not', directly and immediately or from Himself, but from His works and effe,cts. Given such~ and such artistry, the Artist who made it all must be as perfect and lovely and admirable, and even more so. And of course their love of God arid their enjoyment of His beauty could not go beyond the limits and character of their knowledge. The relations of man to God would be different from what they are now:~ he would not be a son, nor a~friend, nor a spouse of God. But natural bumanbeatitude would still be beatitude, and it is well to try tO suspect to'some incipient extent what that means. Even-naturally the human mind and soui have certain capacities and needs and longings for the Infinite; that is why no quantity and no quality of cre-ated goods, however great, can satisfy the human heart. any form of beatitude all aspirations and desires would have to be satiated, and completely so. O~ie would kn~w everything that one would like to know--think of how much that would be, and what an intense thrill it would bring! and one would have everything that his heart could desire. Any kind ofbeatitude would involve perfect satisfaction, and that forever. Since in this mad world we can never have anything even remotely like. a beatific experience, the onIy way in which we can attempt to gain some slight inkling of what it would feel like to be enjoying beatitude, is to gather together in thought all the pleasures and joyful experi-ences that we have ever had, to add to them all the possible delights that we can imagine, and then say, "After all, beatitude is something incomparably grehter and grander' and more glorious than all that!" To possess angelic beatitude would be something marvelously greater still! What then must it be to share in the inconceivable divine beatitude of the most Blessed Trin;ty! "What eye hath 313 G, AUGUSTINE ELLARD not ~seen, nor ear bath heard--what hath. not entered into the heart of man--all these things hath God prepared for them that love him" (I.Corinthians 2:9). Grace, the Seed o: Glor'~t The supernatural life, or the process of deification, exists in two stages of evolution. The fully developed or mature stage is found in the Blessed in heaven; the other, still imperfectly, developed and still immature, is found the Just, that is,. in those who are adorned with sanctifying grace in this world. Fundamentally it is the same life that animates both, even though the observable ~differences may lead one to think the contrary. "Behold what manner of love the Father hath given us, that we should be called children-of God; and. such we are . Beloved, now we are ~hildren of God, and it.hath not yet been manifested what we shall be. We know that if he be manifested, we shall be like him, because we shall see him even as he is" (I John 3:1, 2). "Grace is the seed of glory." That one and the same life can present very diverse appearances, is easily shown from biology. Compare, say, an orange seed germinating in the ground and the beautiful blossoming orange tree that it will be in due time; or the ugly caterpillar crawling in the dusl~ and the lovely butter-fly flitting, about later; or the tadpole and the frog; or, the .case that pleased St. Theresa .so much; the repulsive silk-worm and the delightful little white moth. Do little birds that are. just breaking out of their tiny eggs have that kind of life that is characterized by flight? There is sometl~ing analogous in every human life. Is there reason, in a little child or infant? Evidently in some sense there is. Other-wise, he would not be a little rational animal nor possess human dignity .nor have rights nor be the term of obliga-tions on the part of others. One may go further and point out that there is identity of life in a perfect man and in the microscopic little embryo in his mother's womb that once was he. When the child grows up, he will still be the same being, the same person: and, though his life will b~ different enough, it will not, be another life. Reason is there, but it is latent, undeveloped, not yet full-grown. Ttiough he cannot reason now, before long he will; and notice that every normal act by which his development° is p~omoted contributes to bringing about his full-fledged life of intelligence. So a man with sanctifying.grace in this life cannot see God now, but with every act that increases that grace, his power 'to behold and to enjoy God in eternity is enhanced. In the life Of the Blessed in heaven and ~he life of the ~lust on earth, the fundamental principle from which all activity issues is the same, namely, sanctifying grace. The infused virtues, thequasi-faculties by which that activity is exer-cised, are the same, except that ih the case of the Blessed,~ in place of faith and hope, there is the "light of glory." This is the highest and last grace to be received, and upon its rece~ion beatific life at once begins. The "light of glory" is a participation in tlie intellectuality of God, immediately ~enabling one to contemplate the Infinite. It is often com-pared to a telescope or microscope. The activities of the Bleised and of the 3ust are of course different, but inti-mately related. Even here, in faith there is a certain pa~r~ ticipation in the divine knowledge that no creature could attain by any natural effort; acquaintance with the mystery of the Trinity is an instance of it. Corresponding to actual possession of God in heaven there ~is here, in the virtue of hope, a right 'to that possession and a happy anticipatiofi of it: neither of these could be natural in any creature. The same.charity persists'throughout both stages of thd super-natural life. Between the beatific acts of those in heaven 315 G. AUGUSTINE ELLARD and the supernatural acts of the 2ust there is a certain com-munityor propor~tion, an identity in being or, so to speak, in material, invirtue ofwhich every ~ supernatural act per-formed here is a preparation for beatific activity or, an increase of it. Every meritorious act nbw means more of the vision: of God ineternity. It is to establish this com-munity or proportion in super-nature between super, natural acts here and divinely beatific activity there; that supernatural grace is absolutely necessary for every salutary act. "Without me you can do nothing" (John-15:5). Difference between Natural and Supernatural Suppose that ~ man and a horse are looking at the same thing: the physiological processes of vision, in eyes,, nerves, ' and br~iin, will be about the same in both. In the horse there will not be more than the sensation of vision, but the man the vision will be immediately: and naturally fol- Idwed up by a spiritual idea, immensely different in being and'character from the horse's or even the man's phantasm. In some similar way, in the natural man, not elevated by grace, there will not be more than his natural acts, whereas in the supernaturalized man acts which appear to.be the same or nearly the same will be followed up eventually and, , as it were, naturally, by beatific acts like those which con-stitute no l~ss than the beatitude of God. Grace really gives men a new and fourth kind of life, and to the~ angels a sec-ond kind': a deified life. A fervent supernatural man may wonder why, if thus there be divinity in his acts,, why in fact, if he be, so to speak,, full of divinity, he.does not feel conscious of it. If he did, his life of faith would be quite different. He has to take it on faith, like the real presence of Christ in the Eucharist, that his supernatural acts are immensely different from his natural acts. All human knowledge',comes through ~the 316 THE SUPERNATURAL! LIFE senses; we have no di'rectapprehension of spiritual realities. Even the spirituality of the human soul is not perceived, but proved by reasoning from thechara~t~r of its acts! It still more impossible to experience spiritual realities that are supernatural~ and just because they are supernatural. Cer-tain mystics, namely those who. are in the state termed technically~'"the mystical marriage," are said to experience habitually the fact that their, supernatural activity is a par-ticipation in the life and activity of God. Unconsciousness of a gift is no sign that'it does not exist or is not present. ~A baby boy born to the Queen of England wofild have royal dignit~r of the first magnitude ~ind immense imperial rights, and at the same time know nothing of them. Some years' ago the Dionne quintuplets possessed an absolutely unique distinction, to say nothing bf much money, and they were the cynosure of world-wide attention. but it all mhde slight, difference in their little consciousnesses. Wherever there is a distinct sort of life, there must also be a differencd of underlying structure. If the activities or functions, that is, the physiology, be different, there must also be an anatomical difference. Elephants and mice can-not have the .same joys and sorrows. Neither can rabbits and eagles, nor alligators and kangaroos. N0~ Can men with rational souls and animal~ without them. -Men with the experiences of the supernatural life and men without them cannot be just the same in structure. Elernents of Supernatural Organism Theologians generally consider that there are fifteen elements in the permanent organism or mechanism of the, supernatural life. Among these sanctifying grace is first and fundamental. Sanctifying grace is best conc~:,ved as a participation in the divine nature, that 'is, in what we dis- 317 G. AUGUSTINE ELLARD tinguisff as the fundamental principle of vital activity~ God. .It is to the supernatural life approximately human nature (body plus soul) is to our naturalhfiman life. It is the Substratum or basis or root, out of which everything in the supernatural life somehow "comes. It often compared to the soul: as the soul is the principle human life, so sanctifying grace is~ the primary internal principle of the supernatural life. One who has it will also have everything else. Every living nature must have vital power~ or facul-, ties also. For example, dogs have the power to see, hear, and so on, even when they are not exercising those powers ¯ because, say, they are asleep. Men have power to think and will, even when they are not using those faculties. The faculties of. the supernatural life are the infused virtues. They give one the permanent power to act supernaturally, in a way that is ¯somehow divine. They are not, like natural virtues, dispositions acquired by practice, to act with readiness and facility. They are really new powers do something quite different and superigr. Commonly seven infused virtues are enumerated, three theological and ~four moral. Activity of the theological virtues unites one directly with God. Faith is the intellectual theological virtue, ,faculty of. knowing supernaturally. It gives one ~ participa-tion in knowledge that is peculiar to God and naturally not accessible. In the light of it, the supernatural life is intel- ,ligently, consciously, and freely lived. Hope makes it pos-sible to desire and to seek the Supreme Good in a way that is supernatural. It gives one a sort of anticipated .possession of God and the beatific life. "Whoso hath this hope on him, halloweth himself, even as he is hallowed" (I John 3:3). Charity enables one to love the Infinite Goodness supern~aturally; and is a participation in God's own mode 318 THE SUPERNATURAL LIFE of loving. Without, it one could still love God, but naturally, not supernaturally. The infused moral vir-tues-- prudence, justice, temperance, and fortitude--give one the power to use creatures rightly and in a way that is positively conducive to the beatific vision of God. The gifts of the Holy Spirit~wisdom, understanding, knowledge, counsel, piety, fortitude, and fear of the Lord --are so many more permanent super-faculties. They dis-pose one to follow the i~stinct and motion of the Holy Spirit, as the infused moral virtues dispose one to follow the dictates of reason enlightened and elevated by faith'. The gifts are more passive than.the virtues, and their opera-tion as contrasted with that of the virtues is often likened to that of wind upon the sails of a ship, whereas exercising the virtues would be like rowing. The effect of the gifts, at least when highly developed, may be compared to the incommunicable skill of a genius in music: he can teach the technique---corresponding to the.virtues---~but that super-ior, indefinable, something that comes with genius he can- -not impart tb another. In the more advanced degrees of sanctity and contemplat.ion the gifts are especially active and important. ¯ Actual grace, is the counterl~art to activity in the natural life. It puts a certain divinity into one's activity. Unlike the forms of grace hitherto considered, it is not a habit, not something permanent. Like any particular form of activity, it comes and goes. Hence it cannot be found in a sleeping person, for example, nor in a baptized-infant, nor in the mentally deranged. As sound stimulates one's ears to hear, prevenient actual grace comes, when the oc-casion i~ apt to stimulate one's natural and supernatural faculties into action. !t arouses, or consists in, such ideas in the mind and indeliberate impulses in the will as are conducive to one's spiritual advancement. In this sense G. AUGUSTINE ELLARD actual grace enters into consciousness, whereas none of the other kirids of grace do. Where there is no. thinking or willing that makes for salvation, there is no actual grace at work. If then one respbnd to the stimulation, consent of the will 'and execution of the decision are made with the help of c~oncomitant actual grace. Since consent is from the will, it is vital, free, and human; since it is also from grace, it is divinized. Grace makes one think and will, like God. An example may .help to illustrate the functioning of grace. Suppose that Doctors A and B, while driving in the coun.try, happen to come upon a man who has just been seriously wounded in an accident.and is lying in great dis-tress beside the highway. This is the apt occasion. Dr. A is an agnostic, but a kindly man, whereas Dr. B is a devout Catholic and in the state of grace. It is proper that the doctors should do what they can for the injured man, whether they will be paid for it or not. Such is the fact: so God judges and wills. In this simple case, naturally and without grace, any kind-hearted man could make the same judgment and-feel inclined to give his aid. Dr. A responds to the occasion generously; and his. act is one of natural nobility. It may even be said that he judges and wills as God does. But it is all in the natural order, there is no divine entity in it, and he cannot expect as a result an increase of the beatific vision. Dr. B joinsDr. A in helping the man. Presumably his acts, apparently similar to Dr. A's, will be supernaturalized by grace. If his motive be supernatural, they certainly will. Then grace will enter into the acts of mind and will by which he sees the need of giving aid and feels inclined to give° it, Thus far prevenient grace in some sense will be at work. ~ Then he would &lib-erately decide to help the injured man, and this decision would be made with concomitant grace. The appropriate infused virtues or gifts, in this case at least charity.and pru- 32O THE SUPERNATURAL LIFE dence, would be operative, andthe whole process would be sustained and dignified by sanctifying grace. Dr. B's acts of judgment and will would be like' God's, not only in their character as judgments or volitions, but also in the very entity which constitutes them and places them in the order of being of the beatific vision. The contrast between a super-natural actand a natural act may becompared,to the differ-ence between a consecrated host and one that is not conse-crated. Though there may be little or no observable dif- "ference, the real, interior difference is very great indeed and is known, not ~by experience, but by faith. Conclusion Thus far little or nothing has been said about what we might call the properties of the supernatural life: the dig-. nity that belongs to an adopted child of God, the plane of intimacy with God on which such a ~child is entitled,~to live, membership in the Mystica! Body of Christ, and so forth. Nor have we given a complete idea of the workings.of ac-tual grace. For the adequate portrayal of the supernatfiral life in all its pha~es, a treatment of these subjects v~ould be necessary: but this treatment Would take Us far bey.ond.the limits set for the present article. However, one practical and valuable conclusion may well be mentioned here. Granted that the supernatural life is a real participation in the life and activity proper to God, it is easy to see what its supreme law must be: to imitate G6d, as far as possible; to think and judge ~nd will as He thinks and,judges and wills; and to ~ooperate with Him,in carrying out, as far as depends on us, His most magnificent cosmic plan, for His eternal glory and for the deiform beati-tude of His rational creatures. 321 Supplying Days of Absence I:rorn t:he Novifiat:e Adam C. Ellis, S.2. THE CI-IURCH is very solicitous about the proper training of novices in the religious life. Hence she demands of all religious institutes that they devote at least'one entire year to the spiritual formation of candidates before the profession of vows, and this canonical ~tear of novitiate is a requisite for the validity of the first profession of temporary vows (cf. canons 555 and 572). An absence of more than thirty darts interrupts the canonical year, and the novitiate must ,be started over, even though the novice remained outside the novitiate house with the permission of superiors and for grave reasons (cf. canon 556, § 1). When the days of absence do not exceed thirty it is desirable, and in some cases necessary, that they be supplied before the profession of first, vows. Here is the text of the Code regardihg such da~s of absence: "If the novice, with the permission of superiors or constrained by force, has p~ssed more than fifteen days but not more than thirty days even interruptedly outside the precincts of the house under the obedience of the superior, it is necessary and sufficient for the vdidlty of the novitiate t~at he supp|y the number of days so passed outside; if for a period not exceedincj fifteen days, the supplementing for this period can be pr~escribed by superiors, but it is not necessary for validity."~ How are darts "of absen~ ~ountecl? Canon 32, n. 1 tells us that a day consists of 2"4 hours counting contin.uously from midnight, to .midnight. Hence parts of days are not counted as canonical days. If a novice goes toa hospital on Monday motrting, and returns to the novitiate on Saturday afternoon of the same week, he has been absent for four days'only. Monday and Saturday are not counted since 322 ^~SENC~ FRO~ Novm^~ ¯the absenceon those days did not amount to a period of 24 hours counting from midnight to midnight. When must the days of absence be supplied? When they.exceed fifteen, but are not over thirty. Hence if a novice has been absent 'exactly fifteen days, it is not required for the validity of the subsequent profession, that' these days be supplied. However, it is well to note h~re that. all days of absence, whether continuous or not, must be counted. Every period of absence ~from midriight to mid- ~ night counts as a day of absence, even though these periods of absence be separated by months. How many days of absence must be Supplied? If the novice has been absent more than fifteen days; all the days of absence must be supplied. Thus, if a novite had been absent twenty days, it would not suffice to make up five days. The total number of days of absenceS'must be sup~ plied before the novice can make a valid profession. Are there am.! exceptions? No, there are not. Even though the novice is absent with the permission of his superior or constrained by force, the days of absence must be counted. Thus,' if the novices have a villh in which they spend some days during the~ summei together with the master ot~ novices, these days are counted as days o.f absence, since a villa is not a novitiate house. On the other hand'a distinction must be made between the novitiate house" arid the novitiate proper, or that part of the house which is destined for the exclusive use of the novices. The canon says that days spent outside the novitate house, must be supplied; it does not say that days spent outside th~ pre-cincts of the novitiate must be supplied, if the novice. remains in the house in which the novitiate is located., For, example, if a novice who is seriously ill is transferred from the novitiate quarters to the community infirmary which is located in another part of the house, the days spent in the 323 ADAM C. ELLIS ° ¯ infirmary outside the novitiate quarters would not be counted as days of absence, since he remains in the house in which the novitiate is located. While it is truethat canon 556, § 4 states that the novi-tiate is not interrupted by the transfer of a novice from one novitiate house to another,of the same institute, it is equally true,~ that the days spent on the journey from one novitiate house to another must be counted as days of absence"(cf. Code Commission, July 13, 1930). There. is no contradiction here. It is or~e thing to say that a,novice who has begun his novitiate in one novitiate house of the institute may~ continue that novitiate in another novitiat~ house of the same institute, for instance, in that~ of another province. It is quite a distinct thing to say that.the days spentin traveling from one novitiate house to another mu~st be counted as days of absence from the novitiate. As a matter of fact the novice is,absent from the n6vitiate house while he is making the journey to the second novitiate house,-, hence these days. must be counted, as days of absence. The,, contrary opinion which was held by some authors is no 'longer tenable after the decision of the Code Commission mentioned above. Absence of fifteen days or less. If the numbe~ of days of absence does not exceed fifteen, it is not necessary for the validity of the .subsequent profession~that they be supplied. However, the Code permits the superior to~ prescribe that these days of absence be made up; but not under pain of invalidity of the subsequent profession. The superior not obliged to require the supplying of these days of absence. Thus hemay allow a"novice who has: been absent fourteen days because of illness or for some other just reasoffto take his, vows together with his class a't.the end 6f the canonical year. ¯ " ,' Absence during second ~lear of novitiate. The legisla-,' 324 A~ENCE FROM ~OVITIATJ~ tion of the Code.applies to the first or canbnical year only. It is left to the constitutions of each institute to regulate_' absences.during the second0y(ar of novitiate; The Instruc-tion on the Second Year of Novitiate, issued by the Sacred Congregation of Religious on November 3, ~921, permits the novice to leave the novitiate house-for, training in the wokks of the institute and for the.testing of his capabilities. This permiision is granted, however, only on condition that-the constitutions allow ~the novice to be thus trained and tested in another house of the institute. Furthermore, the Instruction prescribes tha~ the novice must be recalled to the novitiate house at least two months b~fore the day of profession in order that bemay prepare himself properly and strengthen himself in the spirit of his vocation. Conclusion: In this commentary on canon 556, n. 2, wehave stated the requirements of the law regarding the supplying of days of absence~ from the n6.vitiate~ We.,have seen ufider what conditions such~ days of absence must be made up in order that tl~e subsequent profession be valid. In other cases such?days ,,of absence need not be supplied unless superiors so prescribe. Only complete days of 24 bouts, counting from midnight to midnight, are counted as canonical days. V This does not mean that superiors should disregard the spirit of the law which demands that the novices spend the entire ,time of the canonical year in the " novitiate,~. . , ands. undergo the ,strict .tr~aining prescribed in other canons of the Code. To~ allow a novice to spend hours of the day or night outside the novitiate house in the perfbrmance of the works of the institute, or 'in attending classes, is contrary to the' spirit of this legislation, even though these 16eriods of .~absence "do not amount tofull canonical' days, and co~sequdntly are not to be counted i~s days of absence which must be supplied. Such conduct, would be detrimental not qnly to the spiritual wellbeing 325 ¯ ADAMC. ELLIS of the individual novice, but more so to the morale of the institute as a whole0 since the spirit of the institute will be no better than that Of-its individual members. Superiors can promote the welfare of their institute in no better way than by carrying out. the prescriptions' of the Church regarding the novitiate, keeping in mind the spirit of the law, "for the letter kills, but the spirit gives life" (2 Corin-thians 3 : 6). IMPORTANT ANNOUNCEMENTS (Even if gou don't ordinaril~/ read "'Important Announcements, please read. these;) Subscription-Renewals Our~ next issue (November 15, 1942) will be the last number of Volume I Of the.REVIEW. For the majority of our readers, that will mean the expiration 6f their.subscriptions. If your subscriptign will expire with that number and you intend to renew it, you can do us an immense service bg renewing now. By renewing now,-instead of waiting, you will "help us to take care of the renewals more efficiently and to make 'more accurate cal-culations for the printing of Volume II. Just send your check or a morley order, together with your name and address. Thank gout¯ Back Numbers We can no longer supply a complete set.of back numbers of the REVIEW. The January. ~nd March numbers are entirely out, and .there are only. a few remaining copies of, the othei numbers. Many of our recent subscribers want the back numbers. Perhaps you can help them. If you do not intend to save or bind your, back numbers, you may be willin.g.to give them to these new ~ubscribers. If you wish to do this, you may send the back numbers to us, and we will transfer, them gratis to the new subscribers who have requested them. THE EDITORS. 326 The "New Commandment:" ot: Love Matthew, Germing, S,J. ~'~'HE gospel written by "the disciple whom Jesu~ loved" i| has been styled a spiritual gospel It was so desig-nated already in the time of Clement of Alexandria (i50-220 A.D.). Several reasons may be assigned for thee design.ation,.but the one that is pertinent to this drticle is the fact that St. dohn tells us so.much of the.loveof God,and t14i~ neighbor, and doits so in the very words of our Savior. "A new commandment I give you, that you love one another: that as I have loved you, you also love one another. By. this will all men know that you are my disciples, if you havelove for one another" (,lohn 13: 34, 35). Out'Lord did not me~n that the precept of loving one another had not existed in th~ Old .Law, but that He was giving His disciples a new standard and a new motive in observing it. They were to love. one another as Hehad loved them, that is, with' the same kind of love, thotigh they would not be able to love in tl4d same degree.~ And 'this lo~e was to be a test of their ~a~herence.and loyalty to k Him. Again, "As the Father has loved md[ I also ha're loved you. Abide in my love. If ygu keep my command-ments you will abide in my love, as I also have kept my Father's commandment and abide in his love " This is my commandment that you love one another as. I have loved y6u. Greater love,than this no one has, that one lay down his life for his friends. You are my frieiadsif yoti do the things I command you" (J01~n 15:9, 10,,12-~15). And in his" Epistles the beloved disciple again and again recurs to the subject of 10re love of God and of the breth-ren. "This is the message you have h~ard from the begin-ning, that we sh6uld love one another. He who do~s not 327 MATTHEW GERMING love abides in death. M~r dear children, let us not love in word, neither with the tongue, but in deed and in truth. And this is hi~ commandment, that we. should believe in the name of his Son 'jesus Christ, and love one another, even as 'he gave us commandment. And he who keeps his commandments abides in God, a'nd God in him" (! 'jOhn 3:11, 15, 18, 23, 24). "Beloved, let us love~ofie another, for love is from God . He Who does not love does not know God; for God is love. In this is the lo~;e,~not that we have loved God, but that he has fi'rst lovedus and sent his Sdn a propitiation for bur sins. Beloved, if Godhas so ¯ loved us, we alsoought to love one another" (I ,John 4:7, 8,~10. 11). "Special Import t:or Relioibus There is no mistaking the import and force of these words. Love of one an~other is hot a counsel, of per~fe¢- tion: it is a c0mmandmentin the strict sense of she"word, a commandment which our Savior emphasized by frequent r~petition justas a teacher is wont to emphasize an impor-tant point in a lesson. There is, probably, no. gospel pre-. cept which He incul~ated With ~more frequent and loving insistence than the commandmen~ of love.- This alone"qs clear evidence of its j,.~upreme importance, in the Christian life. For persons, consecratedto God, devoted to H~°~pe-cial~ service and leading a common life,, the importanceof mutual love can hardly be exaggerated.~ It may be said without~ hesitation that th~ ~happiness of"a religi0us~'com-mui4ity depends largely on the practice" of.this-virtue. Brotherly_love in a hotis~means that its members think and speak well ~)f 6ne anothei?, are"kinci and cc~ns{derate and patient in tiae[r relations with or/e another, ever ready to Serve and acc6~fiamodate whenever there is ~eed or .occasion. Where-this ~piritreigns, there reigns the ~ace of Christ~ the peace which the angels announced at His birth ahd 328 which He Himself bequeathed ~to his Apostles when He said: "Peace I leave with you, my peace I give to you. When the members of a community live in charity, they possess this peace of Chiist and experience the. truth of the saying of Holy~ Scripture: "How good and pleasant a thing it is for brethren to dwell together in unity" (Ps. 132). Then they do their best work for the cause of Christ, for their own perfection, for one another and. for the common good. ~ :. I do not mean to say~ that peace and charity remove-all the0hard things'from their path in life. They do not. Hard-ships remain, and difficulties may remain. The religious life is not an easy life for the natural man. This we ought to realize from the start. Of its very." nature the life of the vows involves restrictions that are irksome :at times to flesh and blood, that try a person's good will and,. the strength of that will. Duties and observances, some of which are naturally distasteful, do not disappear ~from a community in which charity prevails, but they 'become easier to comply with. Duties are performed with good will and joy of heart; °difficulties are borne ~as part of the day's work for the love of God by re.~son of the charity of Christ that reigns within and all around the individual members of such a community. On the other hand, when there is not charity in a group~ of religious, large or small', then there is aloofness, suspicion, misunderstanding, carping and faultfinding, each looking out for self. Arid selfishness spells the death 0f brotherly love. Highly important and salutary as mutual love is for our home life in our relations with one another, it is equally so in our dealings with, people of the world. Worldly~ interests as such are a matter of indifference to us religious, but there is one big interest to which none of ~us can be indifferent__the interest~ or interests of Christ and His 329 "MATTHEW GERMING Church~ The expression'is comprehensive'and'apparently vague, but there is nothing vague about its real meaning. It means the spread of the knowled~ge and love of Our Lord 2esus Christ in the minds and hearts of all men. It means the endeavor to do men and women some spiritual good, to make them think and provide for their immortal souls. And ~s men are so constituted' that they are unable~to think of their souls v~hile their bodies are ill or starving, it is our duty sometimes to interest ourselves in their bo, dily wel-fare also. These are the things to which the religious of all active orders in the Church have once fo~ all dedicated their lives, their every effort of soul and body. When duty car-ries us into a vast variety of work, much of which of itself is purely secular in character, we must not become confused in our aims and lose our perspective. Our ultimate purpose in all .things is spiritual. ~'This spiritual purpose ought to ¯ be the~very soul of all our external activity. It need not and cannot alw~iys be present in our thoughts, but'it should never be far removed from them. Now charity, in the sense of kindness of speech and manner and whole conduct, is a powerful means of doing spiritual good to people of every class and condition. It is a means that lies within the reachof every religious, even of the infirm members of a community. They can do much by their gentleness and patience in the way of spreading the good odor of Christ. L~irger opportunities fall to those who are in positions of active duty, whether their work brings them in contact with outsiders or is limited to serv-ices within .the cl6ister, where they meet'only their fellow religious. All can be kind and gracious in speech and man-ner, first of all, to their own--and this is of great impor-tancemand then to everyone else. Externs who know little ofreligious but now and then have occasion to' observe their conduct are decidedly edified 330 THE "NEW COMMANDMENT~' and drawn closer to Christ when they find by actual experi-ence that these men and women in strange garb are invari-ably kind and considerate, speak well of-one another and of other peop.l~e, are patient and forbearing even in trying circumstances, never petty or selfish, peevish or irascible. It is well for religious to remember that persons of the world when coming to a convent or other religious house are all eyes and ears. Some of them are on, the alert co catch a glimpse of the manner in which religious treat one another. They make it a point to observe closely, and they comment freely among themselves and others on what they have observed. Favorable impressions received ¯ add to the esteem in which they hold the religious life and are not seldom the cause or occasion of spiritual good in a variety of,~ways which we,never thought of. They clear awayanti-Catholic prejudice, possibly d~evelop a latent voc~ation to the religious life or the priesthood, bring a heft- ~ tating soul into the true fold, or a negligent Catholic back to the sacraments. Good example in th.e matter of kind-ness rarely fails to produce some beneficial sp!ritual result though this result may never' become known. The foufiders of religious orders were not unmindful of this. Everyone Who has read the life of St. Francis knows that he regarded good example as a Silent sermon. St. Igna- , tius went fully as far as the Poverello of Assisi when in the constitutions of his order he reminded his followers that they ought to accomplish even more good by their example than by their preaching. And St. ,John Baptist de la Salle set dowi~ good example as one of the three principal means by which the religious educator was to exercise his zeal in dealing with his pupils. Don Quite extraordinary for the spiritual influence he exerted over others by his kind ways was St. John Bosco, 331 educator, and founder of two religious congregations in the nineteenth century. He often used kindness as a first ,approach ~to boys and young men whom he wanted to draw to better ways of life. One day. the Cardinal Archbishop of Turin, ' interested dn 3oh~ Bosco's educational ~work, asked him about his methodS. The saint's answer was to ~the effect that it-was necessary, first of all, to interest one-self in the boys and~ their doings. One must be good and kind to them, and thus gain their confidence. "'Gain their c~nfidence, °' muse~l the Cardinal. "How do you get near them?" he inquired. The two were riding in the~Cardi-hal's ~arriage through' the city of Turin. "Is there any place in this0neighborhood," asked 3ohn Bosco, "in'which there is a group of boys? . Plenty of them in the Piazza del. popolo," .replied the Cardinal. And with that he directed th~ driver to go to the square mentioned. Yes; there were the boys playing a game. As soon as the ~:ar-riage stopped,-Don° Bosco stepped out, the Cardinal remaining inside to watch proceedings~. o When" they saw Don Bosc~ appr~oaching, the lads scampered a~ay. Their visitor had foreseen tha~t they would do this, but he was able to hail a few loiteiers, spoke kindly to them, and ~heir favorable reaction soon brought back the whole group. Then he distributed little presents to the urchins, put in a few questions about their game, their fathers and mothers, and so forth, and said abrupt!y: "Com~, boys, cohtinue your game, and let me loin in." Tucking up his cassock he played with them some fifteen minutes. As a seminarian he had been at pains to become an expert playe~ at many ghmes for no other reason than to be ready for .just such occasions as the present one. The boys asked him to stay longer, but he must not keep the Cardinal waiting. Before leaving his Youthful compan-ions, cautiously and in his usual agreeable, manner he spoke 332 THE "NEW COMMANDMENT" to .them about going to church' and to confession, saying their prayers, and so forth. As the boys saw him turn to depart, they quickly formed a double line an~d escorted their guest back to the carriage, which soon drove away amid the cheers of these lusty young ItaliansI. Not all men can do what St: 3ohn Bosco did, but all can learn from him the lesson that in.order to benefit young "people in a spiritual way it is necessary to approach them with a sympathetic attitude, interest oneself in them and tfieir innocent pursuits, and in this way build up confi-dence. ~' Love is in the Will In considering our own charity, we should not think of love as a sentiment, in whatever sense wemay under2 stand this word. In reality true love resides essentially in the will. It may exist with-out any sensible emotion; it may also be highly emotional. This is true of both natural and supernatural love. And the emotion, whether super-natural or natural, may by present but not manifest itself in the sense faculties. Love, I said, resides essentially in the soul. It con-sists therefore in cherishing the person loved, appreciating and esteeming him, wishigg him well and consequently thinking and speaking well of him, .doing him good, .as far as lies in one's power. When we do this for a purely nat-ural reason, our love is of the natural type. If, for exampl.e, we love a fellow religious because ofhis or her gifts of mind or disposition--twit and humor, ability of entertaining and amusing others---our love and esteem of such a one is nat-ural. This means, in the first place, that ,it may merit, no heavenly reward. In order that an action may certainly deserve a reward in heaven, the motive itself of the act, even IAuffra~', Blessed John Bosco, c. 14. , 33'3 MATTHEW GERMING one that is naturally good, must be supernatural. The thought contained in our Blessed Lord's words, "As long as you did it to one of the least of these my brethren, you did it to me," furnishes us such a motive. Secondly, in the case of religious living in community, purely natural 10ve may lead to uncharitableness: For if we associate with those only who are most congenial and entertaining, we shall instinctively avoid others who are less congenial and com-panionable, and this is selfish and may. easily be unchari-table. Brotherly love requires that everyone be agreeable to others to the best of his or her ability. Were Christ our Lord in our midst at recreation time, He would seek out the most lonesome soul in the room, and would comfort and encourage such a one. Our Savior regarded the natural motives one may have for loving others quite insu~cient for His followers. In the Sermon on the Mount we read: "I say to you, love your enemies . that you may be the children'of your Father 'in heaven, who makes l~is sun to rise on the good and the evil, and sends rain on the just and the unjust. For if you love those who love you, what reward shall-you have? Do not even the publicans do that?" (Matthew 5:44-46). All men are the children of God, adopted brothers and sisters of our Lord ,lesus Christ, destined for eternal happiness. As St. Paul writes in his first epistle to Timothy (2:4), God "wishes all rne"n to be. saved and tO come to the knowledge of the truth" not only Catholics, but non- Catholics too and non-Christians, pagans and infidels all o~¢er the~world. Not all are in actual possessio.n of sancti-fying grace, or faith, hope and charity, or the Other virtues, arid of the wonderful gifts of the Holy Ghost. But the souls of all of them bear the stamp--so to say---of an immortal and supernatural destiny. We may not exclude them from our love. Nor must we think that 'they are 334 THE"NEW COMMANDMENT" incapable of doing good works, or that the good works they do are worthless, do not bring .upon them grace and blessing from their beneficent Father in heaven. That would be against the teaching and example of our Divine Lord. The story of the good Samaritan illustrates this. admirably. All know the incident as told by Christ Him-self. Com'mentatorson the gospel are of the opinion that it is based on facts. This good Samaritan, who took pity On the man lying by the wayside, wounded and robbed,. was not a Jew, had not th~ Jewish religion. In our man-ner of speaking, he was a heretic and schismatic. But our Savior commended his conduct because of his compassion and charity. There are many good Samaritans at the present day, men and women who, in ,spite of their handicap in not having the true faith, devote time and effort and worldly means to, the relief of the poor and suffering children of men, who are also the children of our Father in heaven: We should not shrug ,our shoulders in depreciation of what they do. Anyone who does that may expect~to hear from Christ the words He spoke to the self-sufficient hwyer: "Go, and do thou also in like manner." We ought rather to praise charitable works no matter who does them, and glove the doers of them credit for a good ,motive. Who knows.that they have not a good in~ention, even a super-natural one? And even if they are acting from purely nat-ural principles, still natural virtue is better than no virtue at all. R~lieving distress is a virtue, at least a,natural one. It is a benefit done to others, and God will reward it in some way. The unselfishness of these charitable people may, dispose their souls for the reception of the. true faith. The Cornmunit~ is a Famitg Every community, of religious is rightly called a reli-gious family. Its members bear to each other a~ relation- 335 MATTHEW GERMING . ship analogous to that which obtains between, the indi-viduals of a family consisting of father, mother, and chil-dr. en. The bond of union between members of the same reli-gious family is a moral and supernatural one. Not 9nly are the.y united~as are all the faithful~by the bond Of divine charity through which they are incorpgrated.in the mysti-cal body of Christ, but they are closely bound together by their common consecration to God and by their~observance of one and the same rule of life. In such a family we expect kindness and charity to abound. And they will abound as,~long as its members are ~true to their-consecration, and are faithful in observing their rules and regulations and the orders of their superiors, all of which have been wisely ordained for their spiritual and temporalwell-being. This in. general. But I will add a point which is definite and particular. Religious must be unselfish, unselfish in their thoughts~ in their words, and in their dealings with one another. One founder of a religious order wants his fol-lowers to be so unselfish as "in all things to yield to others thee better part, esteeming all in their hearts superior to themselves, striving to see in everyone the' image of our Lord 3esus Christ." ¯ ¯ ,, As for the last recommendation, religious will be much helped in this striving if, in their every~'day lives, they make a Serious endeavor to fix their attention not on What "is faulty or less worthy in thdir fellow religious, but on what is commendable and worthy of imitation.:~ This practide of seeing in others what is good and praiseworthy is not only commendable in itself, but is at "the same time an effective means of counteracting the common tendency to think and judge ill' of others. In the Book of Exodus (32:22), Aaron speaking of the 3ews, says to Moses: "Thou know-est this people, that they are prone to evil." If we restrict the meaning of the statement to speaking and judging 336 THE'°~EW COMMANDMENT" adversely of other~, we may say that it is true of well-nigh all men. We find its parallel even in the intellectual order. "The ready belief in ,falsehood, and the slow acceptance of truth, is among the most observed traits of human nature.''z We muit beware of, the propensity,, to think and judge unfavorably of others. We must never ~unnecessaiily and deliberately entertain discreditable thoughts either of our fellow religious or of other persons; most of all, must we never express them in words. This:would be criticism and criticism is. out of place in .a religious community. We must not criticise our equals. Our Lord forbids it. "Do not juc~g, He says; "and you shall, not be judged; do not condemn, and you shall not be condemned" (Luke 6:37). We must not criticise superiors; the reason is the same: Cl~rist forbids it. This is the supernatural reason and is all-su~cient. But there are natural reasons also for.not criticising the decisions or actions and policies of superiors. They have knowledge and information concerning,things to be done which.we have not. Moreover, they take int6 consideration, as they are bound to do, every angle of an event or situation, and the welfare of the whole commun-ity, whereas weare often satisfied to view the case from the particular aspect that affects us. Superiors bear heavy bur-dens for our sakes; we owe them support and cooperation, which we can give them 'by our ready and willing obedi-ence. Let us ~heed.the words of St. Paul:. "I therefore exhort you that you walk worthy of the vocation in Which you are called, with all~ humility and meekness, with patience, 'supporting one another in charity" (Ephesians 4:2)" And these of St. Peter: "Before all things have a constant mutual charity among yourselves; for charity covers a multitude of sins" (I Peter 4:8). ~Frands-'Thompson, Saint 19natius Logola, c.° 12, p. 283. ~ 33~ to Assist Dying Non-Catholics Gerald Kelly, S.J. ACCORDING to the doctors, it was certain that the patient would not l~ave the hospital alive: Accord-ing to the hospital register, it was equally cert~iin that the man was not a Catholic. In fact, as Sister Mary later ~liscovered, he knew little about God, less about religion in general, and-nothing about the Catholic Church. But his disposition, was excellent. In the. subsequent weeks of his lingering illness he showed eagerness and a great capacity foi instruction. He expressed an earnest desire to enter the Catholic Church, was baptized, received Extreme.Unction and.the Holy Euchi~rist, and died a truly pious death. Thus goes the story of the ideal way of providing for dying non-Catholics: to bring them to open profession of the Catholic Faith and to confer upon them the Sacraments that they need and are capable of receiving. It is the ideal; at times it is realizable, often'enough it is impossible. Some people are outside the Church through ill-will; all that we can do for them is pray that they will cooperate with the grace of God. Others are outside the fold through an ignorance which will respond to "treatment"~as in the example alleged above. And many are non-Catholics by reason of an ignorance which cannot be removed: either they are convinced that their own religion is all right, or at least they are convinced that the Catholic Church is all wrong. / People can belong .to this third class witl~out having any real ill-will. They are non-Catholics "in good faith," as, we say. They belong "to the soul of the Church," as some explain it; or, as others say, they are "invisible mere- 338 APOS'~OLATE TO ASSIST DYING NON,CATHOLICS bers of the visible Church." Call it what you will, these people can save their souls, even without explicit profession of the Catholic Faith, lorouided theft fulfill certain mini-mum essentials for saloation. What are these minimum essentials of salvation? Prac-tically speaking,~ they may be summed up in four acts that involve the free cooperation of a human being with the grace of God, namely, acts of Faith, Hope, Charity, and .Contri-tion. They must be supernatural acts, that is, made. with the help of grace, and rooted in a free acceptance of Divine Revelation. Thus, the basic act in this~series is supernatural Faith, not a vague sentimental thing that many people call faith, not the mere Work of human reason, but the accept-ance by man of truths revealed by God and because they are revealed by God. It is not necessary to make an explicit act of faith in all the dogmas of the Catholic Faith, but to be sure of salvation one must believe at least in these four revealed truths: the existence of God, the fact that God re-wards the good and punishes the wicked, the mystery of the Blessed Trinity, the mystery~of the Incarnation. " Anyone with a truly .apostolic spirit will Want to help non-Cath01ics (o make these necessary acts. It cannot be left to chance, because God does not work by chance; He works thrpugh ordinary human instruments. The true apostle, therefore, will try to devise a means of providing the dying non-Catholic with this opportunity. But in this apostolic endeavor he will find himself con-fronted with two serious difficulties; the first being to ob-tain a brief, yet apt formulatidn of the necessary prayers', the second consisting in gaining an approach to the non- Catholic without provoking antagonism. Several years ago, Monsignor Raphael 3. Markham, of the Archdiocese of Cincinnati, then professor of Pastoral Theology at Mount St. Mary Seminary, Norwood, Ohio, 339 GERALD KELLY worked ,out- a splendid solution to both.these,, problems. First he compiled a formula of the necessary prayers which is:admirable for its brevity, adequateness, and simple beauty~ Next he had these prayers printed on cards which, though attractive to the .eye, contain no reference to Catholicism that might je0paridze the.good cause in the case of a non- Catholic whom long years of misrepresentation had made suspicious of the Catholic Church. These cards can be p!aced near the bedside, sent through a friend--there are innumerable ways of getting them into the hands of non- Catholics without wakening suspicious prejudice~ ~. Monsignor .Markham's venture was first launched on a very smal! scale. He distributed the cards to his own class and explained the method of using .them. Later, someone drew the attention of Archbishop McNicholas to the novel apostolic plan, and he insisted that it get wider recognition. In the subsequent years, the mo:vement has grown 'im-mensely, and the results have been most gratifying. We presume that all religious, p~rticularly those w15o have o'.casion to minister to the sick and the dying, will.be deeply interested in this trdly apostolic, venture. Anyone who wishes more information can obtain an explanatory brochure an~l a few sample cards by writing to one of the addresses given be!ow. The cards themselves, whether plain or hand-tinted, sell at a very moderate price--merely ehough to cover expenses. At present Monsignor Markham and his associates are particularly interested in distributing a small, convenient card designed espe~cially for the use of men in our armed forces. For brochure and cards write to:., ,(a) Rt: Reu. R. d. Markham, S.T.D., Compton Road, Hartwell, Cincinnati, Ohio. (b) Sisters of the Poor of St. Francis, St. Clare Convent, Harttoell, Cin-cinnati, Ohio. (c) Sister M. Carmelita, R.S.M., Convent of Mercy, 1409 Freeman Avenue, Cincinnati, Ohio. 340 -. Commun ca!: ons [EDITOR'S NOTE: In our July number (p. 218) we outlined one practical di~culty concerning the spiritual direction of religious and asked for constructive comment and suggestions. We have received many communications on the subject. ,We cannot publish alldn this number, but we are printing as many as space permits. The remainder will be used in the next number. Further comments, either on the o~iginal editorial ~r ~on the communications printed in the~ present number, will be welcomed. Most of the letters concern the direction of Sisters. Considering their number and the fact that their spiritual direction must be limited almost exclusively to the confessional, this was to be expected. However.' the readers" attention is called to the excellent communication from a Brother Novice Master that appears in this number. More such letters would be ~helpful; we have a large number of Brothers among our subscribers. The editors assume no responsibility for the opinions expressed in these com-munications. ,Judge them on their own merits.] From Priesf~ - Rdverend Fathers: Du~ing ofir semifiary, days we used to" say that allconfessors (like all Gaiil) could be~divided into thre~ classes: confessors who simply " said "For your penance say--"; confessors ~ho said "Tomorrow's feast reminds us that ", and good confessors. Several years'°~experience in hearing confessions may have led us to r~vise that rattier hasty generahzatlon. As secular priests we seldom have the duty of hearing the confessions of religious women at the time Of theft retreat. But upon us as secular priests falls the obligation of being', in most. cases, the ordinary confessors of religious-women. That'0~e has never been assigned to me, but upon various bccasions and for various reason~s sisters have come to confession to me, and from this slight experience together with a great deaf'more thoughl~ I have come to conclusions which may answer, in part at l~st. the. questions ~aised by the editorial Spiritual Direction by the Ordiriar~/Con[essor in the 3uly 15 issue of REVIEW FOR RELIGIOUS. That some sort of spiritual direction should be given by the .ordinary confessor of religious women can, I think, be considered a pr, oved fact. By their vows°and their~eager desire to be faithful in all things to those vows religious are ~laced high in the ranks of the Church. Consequently, they are exposed to, greater satanic attacks and need greater assistance. Weekly spiritual di.rection of some sort is an essential form of tha~ assisfance. But what form shofild i.t take? My simple suggestion is that 34.1 it is not. wise for the ordinary confessor to make a general :rule Of commenting on the faults confessed. Unless there is something out-standing among them riley had' better be passed over in silence; as too much emphasis placed on them may result in scrupulosity. Rather, the ordinary-confessor should giye posit!re direction, centering his words and ideas, on Our Divine Saviour, "especially as His Divine and Human Natures' are manifested to us b~/ the liturgical year. Such direction counteracts the natural tendency of many reli-gious people, perhaps, more especially of religious women, to become self-centered in their spiritual life. The confessor can exemplify and elaborate this simple, advice, but it seems to me that it contains the germ of sound and fruitful dilection which can be given by the ordinary confessor of religious. Signed, etc . Reverend Fathers: I am a religious, ordained more than twenty-five years, during which time I have never been without the charge of one. sometimes two. religious communities, as ordinary and extraordinary confessor, Besides. I have given nearly a hundred retreats,~most of'which have been to religious women. The heart of your editorial is in the sentence, "The ~¢onfessor does not know how to make the approach: the community does not make it for him." o , ~ I think it is the duty of tl~ confessor to make the-approach. Personally I have not given thematter of direction so much attention, but very early in the exercise of the ministry, I realized how impor-tant it is to help religious to receive the Sacramefit of Penance as fruitfully as possible, as an effective means of spiritual progress. 1 ) For many years I made it a point to.give each penitent a few ¯ words of encouragemen~t or advice, based on the season of the y~car, or some pract~ic¢ connected with some approaching feast. (The same for all.) 2) T~ese little talks were later varied dnd aimed at helping the penitent ,correct some fault or no,quire some virtue. This I consider the first step in making the Sacrament of Penance a very fruitful means of advancing. 3) I frequently make it a point to emphasize that they should endeavor to correct themselves of one fault ev~erytime they go to con-fession. Sorrow and the purpose of amendment should be centered 342 COMMUNICATIONS on one f~ult. I frequently ask them what one fault they are going to try to overcome for next' week. 4) I ~fideavor to impress upon them the benefit of investigating the roots of sins and of confessing ~tendencies rather than individual acts, specially never to confess sins for which they are ~ot sorry. If a confessob proves hims~elf zealous, willing to listen, kind, and above all invariably patient and tactful, practically all religious will correspond and the results will be very gratifying. Most reli-gious fear to be, a burden to the confessor by what they may refer to as their petty troubles. If the confessor makes each one feel that he has all the time in the world for them, and that he is interested in each soul's advancement, confidence will be given and a great deal will be " accomplished in directing them. These three books have helped me in solving this problem in past years: The Confessional by Rt. Reverend Aloysius Roeggl, trans-lated from °the German and" adapted by the Reverend Augustine Wirth, O.S.B., published by the translator, at Elizabeth, ,N. 2. (1882.) Sacdrdotal Meditations, by Father Chaignon. Meditations 70 to 75 are'on the.duties and qualifications of a confessor. I make them' dvery year. at least during my retreat. Published by Benziger. Confession as a Means of Spiritual Progrdss, by Scharsch-Marks. Herder, 1935. Signed. etc . [NOTE:~ We mi~gh~ also recommend The Spiritual Direction of Sisters, by Ebl-Kirsch. : Benziger Bros., 1931.ED.] Reverend Fathers: Acting on th'~ assurance in the July REVIEW that you will wel-come constructive comment as to how Father A might be.of greater help to his penitents, may I proffer a suggestion or two? Let the perplexed confessor evince his willingness to give more than mire absolution by some such approach: "Is there any comment I can malie on any of these faults?" or "Can I behelpful to you in any of these problems?" or "Is there anything that is a source of anxiety to you?" etc. etc. Numbers of individuals have found such an invitation to share their burden with a willing counselor all that was needed to open the way to eventual peace of soul. If Father A "heard about twenty confessons in twenty-fi~,e min-utes" could it be that some of his penitents listened in vain for the Dorninus sit in cordo tuo. . . Misereatur . . . lndulgentiam . . . 343 COMMUNICATIONS Passio D. N. d. C . ? When a confessor habitually reduces his administration of the Sacrament of Penance tO the minimum in effort;. it isn't strange that those who kneel before, him follow .suit. I should like to amplify bpth these points and stress still another one or two, but you wisely~suggest brevity. Signed, etc . Reverend Fathers: " The confessor should be thoroughly and personally interested in his charges. If he be so interested, he should find no difficulty in~ formulating a question or two that will bring out their degree of religious'observance or fervor, upon which he can then build a helpful and constructive bit of spiritual guidance. Signed, etc . Reverend Fathers: The experience I am relating here concerns a retreat-director, not an ordinary confessor: but it may prove helpful to the general subject of spiritual direction by the confessor. The experience concerns a prominent priest who in his early retreats was s;iid to give "'marvelous instructions" but was scarcely mediocre as a confessor. He was told of this and set about to over-come his difficulty, which seems to have been about the same as that of Father A in your editorial. To overcome the hesitancy of the sisters, he asked some question such as this: How's the spiritual life? your meditation? your particular examen? .your obedience? In most cases he found that this was iufficient to open the floodgates: the nuns were bursting to say something, btlt they didn't know how. It was a case of 50-50, the penitent as backwardas the confessor. The opening ~lUeStibn was what.might be described as "breaking the ice." Next on the program was to have a brief, practical, attrac-tive remedy for the trouble that might be manifested, e. g. "Mddita-tion is terrible." The priest worked these points out: and he. has found the method very helpful and successful.~ Signed, etc . From Brothers Reverend Fathers: ' The problem raised in REVIEW FOR RELIGIOL~S, Volume I. No. 4, with regard to spiritual dii'ection by the ordinary confessoi, has been 344 COI~UNICATIONS ~our ;'own problem for quite a long time. The solution we have evolved in our house of formation is given as follows: First of all, we are indebted to the understanding heart of our chaplain for a perfect collaboration between him and the Brother Superior of the' community. This is a matter of prime importance. At the beginning each month the Brother Superior proposes to the community the practice of a particular virtue', ~hosen ordinarily ~from among those which are recommended to'us by our Rules, 'or of which a more urgent n~d is .f~lt." He explains this virtue, deriving his inspiration, as concerns practical 'applications, from the Constitu-tions, the Custom Book, and the letters of Major Superiors. Then eachvirtue'is divided so that in four successive weeks it may be prac-ticed with increasing perfecton. Here are three examples: " PO3il~RTY: First Weeh, to avoid superfluities; Second Weeh, avoid attaEhment to what is permitted: Third Weeh, to avoid the useful, the comfortable, the new: Fourth Weeh, t~ deprive oneself at times of necessities, without of course jeopardizing health. HUMILITY: First Weeh, to speak well of the absent:, Sec~ond Weeh, to cultivate an interior contempt of self; Third Weeh~ to take joy in contempt; Fourth Weeh, to attribute to God the credit for our CHARITY: First Weeh, to render services at the cost of one's own convenience; Second Weeh, ro"return good for good: Third Weeh, to return good for nothing; Fourth Weeh, to return good for evil. " The program thus prepared is given over to the chaplain, who, except in rare instances, draws therefrom material for the weekly ~xh6rtation he addresses v t0 l~is penitents. The latter thereupon ~nform the confessor of their fidelity to the ~dvice received at ~the time of the preceding confession. The habit of renderifi'g to the confessor a spontaneous account of one's fidelity in. following advice ~hould be thoroughly inculcated and de~,elope~l :from the.beginning of the novitiate. There is a corre- Sponding ~>l~ligation on the part of the confessor to ,khort'; to en~ourage, to direct ;. and it is for this purpose thak we supply him with matter each' month. It should be evident that our entire undertaking has but one aim: "to-afford the confessor and his charge an opportimit~l for mutual understanding, so as to place the confessor before an open door, so to 345 COMMUNICATIONS speak, or at least a door which is on the point of opening. The rest must be left to the good will of the director and of those who are to be directed, and to the grace of God. At this _stage discretion demands that the Superior withdraw to the background. A former colleague of mine, to whom goes the entire credit for the solution of our problem and its .application in practice, has this to say about it: "The labor of cooperation, based on an understanding between the chaplain and the superior, has been pursued for more than three years at one of our houses and for 24 months at another. It is the characteristic feature of the Eucharistic method (of Abb~ Poppe), ¯ of St. Ignatius and his entireschool. I can attest that it is effective and psychologically sound. The ~theological. and moral virtues, th~ practice of the Rules--all can be subjected to this progressivd and methodic labor. It has the advantage of compellii~g, in a certain manner, the confessor to make himself als0 a director. This solution haso proved satisfactory to our confessor and to those whom he directs: it is conformable, at any rate so. I believe, to the ~pirit of the Church. You can weigh it for yourself. If you find it too flimsy . whoosh! .to the wastebasket. A Novice Master From Sisters Reverend Fathers: Your editorial on Spiritual Direction in the July issue of the REVIEW is most timely and thought-provoking. We have discussed the article in question, and here are some of our The directors chosen are not always the best suited for religious. Some are timid, impatient, have a frigid air. A few hit on a happy phrase and use it week after week: for~ example,~ "Keep up the good work and say three Hail Marys." Many show no zeal for perfection. "We cannot give what we haven't got." The director as Teacher, Father, Judge should tak.e thee initiative. Any question regarding a fault confessed will serve as an opening; ~or "Sister, I am here to help you. Have you ,,any questions to ask?" We would tell Father A of your article: "The next time you have a chance to direct religious, go forth and bea spark among the reeds and set the world on fire with the love of Jesus Christ. The ashe~ of the reeds will beeternally grateful to you." 346 COMMUNICATIONS As to the religious themselves, ther~ is no end of excuses. Lack of courage--what will others say?shyness--fear of the conse-quences-- don't know how o~ where to'beginPnot encouraged to seek direction in confession. Some simply like the shady side of easy street. To both confessor and penitent could be" said, "Ask. seek . . . knock." It will mean more peace, more joy, more of God here and hereafter. A Religious Community Reverend Fathers: Enclosed are some thofights I've had for quite a few years on the subject of direction in the confessions of nuns. I am grateful that this matter has been brought° up and trust the responses you receive will be enlightening and helpful to all of us. SOME REASONS WHY DIRECTION OF NUNS IN CONFESSION FAILS: I. On the part of Communitg: The ever present pressure of work that straifis time. Fifty or sixty nuns, sometirdes more, waiting to go to confession and-- one confessor. If half the fiuns took all the time they wanted, the other half wo'uld of necessity be restless--maybe i~rital~le--waiting. The time dement in consideration of the waiting of others is to my mind a big factor. I saw this solved in one Of our larger communi-ties when the Rector" of a nearby monastery sent three confessors at the same time. It served a three-fold purpose: (a) the nuns had a choice of confessor; (b) none minded how long she stayed because she felt no one had to wait because of'her: (c) the confessors all fin-ished within an hour or so and not one felt overburdened. 2. On the part o~ the indit~idual nun:- (a) Because of long years without direction, she has long ago abandoned the idea of ever having that help, and so her.confessions become mere-recitals of weekly J imperfections-and~ venial sins. (b) Because she has been frightened at sometime or another, or disillusioned to some extent, she is too timid to ask the help she Craves. (c) Because sec~lar priests many times do not seem to under.- stand religious life and the serious obligation a religious has of striving constantly, for perfection, the nun after some futile attempts to get direction regarding her retreat election, her monthly examen. 347 COMMUNICATIONS etC., abandons the ~ttempt seeing the priest embarrasked, or indefinite in his guidance. . ,~ ° (d) Because she needs guidance ~so badly'and doesn't know where to begin, or how td ask, she is silent,~ hoping always the con-fessdr will make an opening. Or she has real problems, but fear, or a natural reticence, or tl~e thought," :'This is too simple to bother a confessor about," hinders her from seeking guidance. ¯ 3. On the part of the confe~or: (a) If~he is a religious ~priest, "he will Usually give a prepared instruction, or will sdlect some sin mentioned and give advice, but unless asked, he will not usually attempt guidance that is consecu-tively followed.~ Why? , (b) If he is .a secular priest, he sometimes belittles°confessions that include "breaking of silence," "time wasted." etc,, saying, as has been done too frequently: "That is silly,;~ tell your.sins,-" or "Sister. you don't have to mention imperfections." (Is a dun supposed to have venial sins all the time to confess?) (c) If the confessor is in a hurry andgiv.es evidence of this by closing the slide before the nuns finish their ac~ of contrition, or by asking, "Sister; are there many nuns to go?" the news soon gets around the community that Father X is al~ways in such a hurry that none wants to hinder his fligh!! (d) If unfortunately he has ever said to even one nun. " I don't like tohear nun£ confessions," it is sufficient to prevent many from seeking him as a director. (e) If the'confessor is indefinite, ciicling generalities, using too philosophical terms, most nuns are more confused and give up. thinking "What's the use?. I~ never do get any. real help when I ask." Solutions: I. In~ large communities two confeisors (or more) coming on the same or on consecutive days, will .solve the problemof time and the fear on the nun's part of keeping large groups waiting. II. The nuns on their part should ask simply for continued guidance stating frankly their desire of acquiring such and such a virtue; .their constant difficulty regarding particular examen; ~their lack of progress in the spiritual life and'the r~asons they thinl~ respon-sible for it: their difficulty with their superiors, or others, and;what in themselves causes it. These cases stated clearly, ,,frankly, humbly, 348 COMMUNICATIONS will at once help the confessor to analyze and guide the soul seeking help. III. The confessor .by evidencing his real interest, his wish to help regardless of the time taken, his "follow up" from a confession, would win confidence an'd would win,o souls starving for spiritual aid. Such questions as: "Sister, are youin the habit of speaking against authority? . Sister, do you ever think how much good you can do by giving the example of perfect silence?" or simply, "Sister, cain I help you in any way ?"--would be the seSami~ of opened and awakened souls. To give one instance: after a confession hurriedly made in. which evdr~rthing ~was generalized, a confessor asked, "Sister, are you accustomed to making confessions like this fre-quently?" This simple question broke down a nun's reserve and resulted in several years of fruitful guidan&. The nun felt the priest really cared. Is this the secret? A Mother S~perior Re~,erend Fathers: I ~m especially grateful for the challenge thrown out in the article on $1~iritual Direction b~/ the Ordinar~l Confessor. I sincerely .hope that the forthcoming communic.ations will do much to stimulate priests in their great responsiblity in guiding souls to a higher perfec-tions. Here are my suggestons: Give the admonition on the confession made. "Poor Pussy" types of admonitlon~are not appreciated: nor are "canned" admoni-tions. Oc~asi0nally ask WHY a certain fault was committed; als0 WHAT is being done to overcome a repeated accusation. Another question that creates¯ thought is, "What is your particular exarfien?" And the added remark, "Report on this each month," gives much material for guidance. Sometimes the question, "What do you mean when you accuse yourself of .thus and s0?" may cause a startling revelation to the confessor. ¯ A varying penanc.e also helps to draw attention to the individual confessio.n, A Mother Superior [Addr¢ss further communications on this subject directly to the' Editors, St. ,Mary's Co11¢g¢. St. Marys, Kansas.] Book Reviews OUR MODELS IN RELIGION. By Brother Jean-Bapfiste, F.M.S. Pp. 520. Marls÷ Brothers, St. Ann's Herm;tacje, Poughkeepsie, N. Y. $1.50. Thd subtitle of this book indicates its contents: "Biographies of some early Marist Brothers who were outstanding by their vir-tues and love for their vocatidn." Written originally in French by Brother 3ean-Baptiste, it was translated intoEnglish on the occasion of the 120th anniversary of the foundation of, the Institute. "Fhe purpose of the work was evidently to inspire the Marist Brothers by the virtuous example of their predecessors. Merely as biography, Our Models in Religion wouldoprobably be of interest to Marist Brothers but would hardly merit the attention of others. However, "biography" may be said to be a secondary theme of the work. The biographical sketches are rather pegs on which to hang various bits of good advice and instructio~a. There is much good instruction, much good conference material, in the book. Spiritual directors,of religious can find in it many worthwhile points for conferences, as well as an abundance of material for ~developing the topics. The book was printed by Desclle. Paper, printing, and binding are all of high quality. G. KELLY, S.,J, ".THE SOLUTION IS EASY. By the Reverend Mark Schmid. O.S.B., Ph.D. Pp. xii ÷ 181. Frederick Pustet, Inc., New York, 1942. $2.00. ~This book forms a neat, popular introduction to the Scholastic answers to the fundamental questions of philosophy. It will prove useful especially to those who have not the opportunity of making thorough study of Sct~olasticism but who, nevertheless, would lit::to become acquainted with its broad outlines. The work bears the imprint of one who.has,had many years of experience in teaching science and philosophy: the subject matter is presented in a way that makes it easily grasped and the author is careful to avoid even the appearance of being dogmatic. He does not enter upon ground con-troverted by the scholastics themselves, but confines himself to those points wherein all are agreed. Especially prominent is the frequent 350 BOOK REVIEWS discussion of popular scientific problems that have a close connection with philosophical principles. The book begins With a Jthumb-nail sketch (twe.nty-three pages) of the history of Scholasticism from its earliest period to the twenti-eth century. The second, and chief, part of the book consists of brief chapters setting forth the. Neo-Scholastic view of the major problems of philosophy. The first four chapters pertain to cosmology and discuss the problems of the nature and origin of the physical world. Then come.~ ~sychology with such questions as the origin of life, knowledge, free will', immortality.~ Following this are such metaphysical questions as First Principles, the problem of evil, causality, design or purpose, and the Creator. The problem of social origins forms the concluding chapter of the book. After each chapter is appended a convenient bibliography of readings and references. The author has chosen for this purpose those books which are writ-ten- in English and which should be easily procurable from an ordi-nary Catholic library. Fr. Schmid omits dry discussions from his book, eliminates the formalism of scholastic text-books, and enlivens his work through-out with apt illustrations and homely analogies. The ideas are quite clear, the language is simple and, for the most part, concrete. Tech-nical words are defined and. described. Synonyms, parenthetical expressions, and quotation marks are employed quite frequently, for the benefit of the uninitiated. At the the end of the book there is a glossary making a handy dictionary of terms found in this and other books on.philosophy.--A. J. BENEDETTO, S.J. THE DIALOG MASS. By the Reverend Gerald Elhrd, S.J. Pp. xvl -~ 223. Loncjmans,'Green & Company, New YorE, 1942. $2.75. "It is well within the expectations of probability that another decade will have witnessed the gradual transition to Dialog Mass as the normal form of low Mass worship everywhere in the United States." It is Archbishop Michael J. Curley, speaking, in his preface to Father Ellard's book, Who from his vantage point, as Archbishop of Baltimore and Washington gives us this measured judgment of,the future of Dialog Mass in this country. For all of us this practically means that in the opinion of Archbishop Curley, when attending low Mass ten years from now we shall either have to form a part of 351 Boo~ R~vm~s deliSerately cut ourselves off from fellowship with our fellow, Chris-tians by remaining s~lent. This makes the Dialog Mass and our acceptance or rejection of it a burni.ng ques~tion right now. " The more so is this true, as the Dialog Mass is the resul~ of the efforts of many zealous prelates and priests throughout the world to bring into actuality the active participation of the laity in the most holy mysteries and in the public and solemn prayers of the Church/of which the authoritative voice of Plus X says, "It is the foremost and indispensable font for acquiring the true Christian sp, irit" (Motu P'roprio, On Sacred Music). It will be a surprise to many a one who has been apathetic to the Dialog Mass "because it is an innovation," to find that it is one 'of those innova~tions that are in absolute accord with the old theologi-cal adage, Nil ~'nno{petur nisi quod traditum est (Let there be no inno-vation except such as comes down to us by tradition). The Dialog Mass is not a bringing in of something new that never was. but bringing back of what has been. Father. Ellard, after studying the historical evidence, feels justified in making the statement: "In the sixteenth century the custom still survived at Rome and elsewhere that the congregatioh made the Mass responses with the serv~er. When the custom disappeardd is not known." Father Ellard's book is important because of its studied~y accu-rate presentation of facts regarding the spread of the Dialog Mass and his documented story of the attitude of the Holy See on the subject. At the end of Chapter Five, in which the author shows that the Did-log Mass is encircling the globe, he presents the following' results of a questionnaire-survey among Sodalists throughout the United_ States and of official surveys of the Diocese of LaCrosse and of the Arch-diocese of Chicago: Dioceses in which Dialog Mass is approved. 100: Dioceses in which Dialog Mass is not allowed. 4: Dioceses on which information is not available, 11. Thi~ l~ind of information is of supreme importance for ever~ one of us by reason of another theological adage, Securus judicat orbis terraru~, the sense of w, hich is that the Catholic world judges surely about the Catholicity or ,non-Catholiciy of any religious practice. Teachers will be especially grateful to Father Ellard for his helpful suggestions about Dialog Mass for children.'hnd hhw to corn-~ bine it with music, and thus buil

Special Advent Issue of Volume 63 of the Review for Religious, 2004. ; .Sp~rttuality.Revtew, a supplcmcnt.of Rewew for Religious, is looki~g~i~6 facilita , , a~iitib aG oodg,. u:deia.loo~,e. within ~.,~ou"r s"elv aes~; d)ialo~e wi~th i~n:e anotbeg.~ s POpe.Paul~n Said, our ~ay, of beingchurcb # to~y the way qdialo~e. Spirituality Review, a supplement of Review for Religious, is published at Saint Louis University by the Jesuits of the Missouri Province twice a year during the Lent/Easter and Advent/Christmas seasons. Please send all correspondence to: Review for Religious; Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-977-7363 ¯ Fax: 314-977-7362 See inside back cover for information on subscription rates to Review for Religious. Spirituality Review, a supplement of Review for Religious, is an interactive journal. We ask you, our readers, to give us your reactions and your suggestions. Please write to our address given above or fax: 314-977-7362 email us at: review@slu.edu * Web site: www.reviewforreligious.org ©2004 Review for Religious Permission is herewith granted to copy any material contained in this supplement issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribution, adver-tising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. S pi ituality eview Review .for Religious Supplement Editor David L. Fleming SJ Associate Editor Philip C. Fischer SJ Canonical Counsel Elizabeth McDonough OP Scripture Scope Eugene Hensell OSB Editorial Staff Mary Ann Foppe TracT Gramm Judy Sharp Webmaster Clare Boehmer ASC ~amer SM '-Iughes RSCJ Larkin OCarm .amgela Menard ry Steib SVD L~keritis CSJ ADVENT CHRISTMAS 2004 contents tracings reaching out Saint It! D.M. Flynn offers an overview of saints throughout history that challenges us to recognize the saints around us and to model saintliness for others. Reflection 13 expecting in hope l~ Imaging Isaiah David L. Fleming SJ suggests we meet the prophet Isaiah for his guidance through Advent. Prayer and Reflection Questions 17 remembering ~ Dismas's Dying Moments: Reflections on "Palpable Grace" Robert P. Maloney CM employs a type of lectio divina on the Lucan story of the "good thief" in order to offer some reflections on palpable grace. Prayer 23 expanding our world My Associates Robert North SJ enlarges our prayer by his suggestion of including "my associates," and he further explains the extent of this term. Prayer and Reflection Question SpiHt~ality Review ~.~,o mcmaea as a bonus A Spirituality fo: . orary Life:The Jesuit Heritage TodaCyo)n .t.e.m. p_ Prisms for a Christ-Life .@. .$1 Notes on the Spiritual Exercises @ God has imprinted upon all created things his traces, trail, or footsteps, so that the knowledge we have of his divine Majesty through created things seems nothing other than the sight of the feet of God. St. Francis de Sales Asking for help does not come easy for many adults. They mistakenly think that all mature persons (like themselves!) have all the resources they need. At the other extreme, there are peo-ple who are quick to condemn anyone who does not ask for help: "They are trying to be like a god, self-sufficient and not needing others." Yet our Christian understanding is that God, incarnate in Jesus, is one who asks for our help. In the New Testament, we see that Jesus sought out apostles and disciples and shared his mis-sion about the reign of God with them. Jesus was acting in continuity with God working with the Hebrew patriarchs Abraham and Moses and the kings David and Solomon and the prophets Isaiah and Jeremiah. God is always reaching out and asking for our human help. This familiar thought expresses a deep truth: "God has no tracings Advent/Christntas 2004 Tracings hands but our hands, no other feet but our feet." That is the ordinary way that God reaches out to help others. The Christian belief in the communion of saints is based on our faith that God works with and through us to bring about the reign of God. We all are meant to help one another--those of us living now and those who have preceded us--and that is why we are the "commu-nion of saints." In our daily way of praying, we ask our brothers and sisters--canonized saints (especially our favorite ones) and family members, friends, teachers, and counselors (most of whom will never be officially rec-ognized as saints but helpful to us all the same)--for their support and intercessory aid as we travel our own life pilgrimage. Every Eucharist we celebrate brings home to us how we live as a faith community of sisters and brothers willing to ask for help, to provide help, and to receive the help that is offered. Asking for help is how we grow into being the body of Christ. Asking for help is how we grow in being like God. As editor, I want to thank our readers for helping us to improve this journal, Review for Religious. This Spirituality Review is the last regular supplement issue because it has served its purpose of getting feedback from you, our readers, through postcards and emails, about format and interactive-style changes that we will be including in Review for Religious. In the first issue of 2005, you will notice these adaptations. Spirituality Review facilitated the making of prudent changes in a revered and respected international journal sixty-plus years old. We are grateful for your help, and we hope that you will continue to find the pages of Review for Religious personally and apostolically enriching. David L. Fleming SJ Spirituality Review D.M. FLYNN Saint It! Every family has them. There are stories about the relative dubbed Daddy Fix-It. Without for-mal training he could repair anything from the children's toys to the family washing machine. Anecdotes about Nana are hardly lacking either. A European immigrant, she never mastered the complexities of English, but her family feasts surpassed the efforts of every gourmet chef in town. Then there are the tales of the frugal aunt and uncle who raised ten children. They sold their empty nest to buy an RV (recreational vehi-cle), then spent their wisdom years traveling around the country visiting family and friends. Yes, every family has them: the heroes who have gone on before us while their legends live on. Family members spend many enjoyable hours poring over photo albums and recalling such tales. These stories inspire us and help to shape our family heritage. In our increasingly D.M. Flynn, who wrote about Gregorian chant for us in 1999, may be addressed at 119 Royal Gardens Way; Brockport, New York 14420. reaching out ddvent/Cbristmas 2004 Flynn ¯ Saint I!! mobile society, they not only influence our identities, they impart a sense of unity. Perhaps that explains the popularity of genealogy in recent years. As our kinfolk uproot and transplant themselves, we feel the need to maintain our family tree. We seek roots in every sense of the word. Our Catholic family also has its heroes and their leg-ends: we call them saints. Their stories inspire us and shape our Catholic heritage. These tales testify to the kinds of lives that are appropriate for God's holy peo-ple. Our lineage spans thousands of years, making it impossible to trace all of it--not here, not ever. But the following pages give us a glimpse of our Judeo-Christian family album. Saints: Set Apart To the average Catholic, the word saint refers to deceased persons whom the church has officially canon-ized for their lives of service to God and their neigh-bors. But the canon--or list--of saints could not possibly include everyone who lived a life of virtue. Moreover, the definition of saint has evolved over the centuries. The word translated as saint from both Hebrew and Greek originally referred to gods, beings "set apart." The ancient Israelites viewed God as transcending his creation and therefore worthy of worship. They believed that God alone was "holy, sanctus," set apart ("sanctuar-ied"), distinct, unique. "Holiness" set God apart from the profane, the ordinary: "Holy, holy, holy is the Lord of hosts" (Is 6:3). When God entered into a covenant with the Israelites, they were set apart from the other nations. "You are a people sacred to the Lord, your God; he has chosen you from all the nations on the face of the earth to be a people peculiarly his own" (Dt 7:6). With this Spirituality Review privilege comes a responsibility: "Be holy, for I, the Lord, your God, am holy" (Lv 19:2). Now the Israelites are God's chosen ones, a "holy people," or "saints," who are called to imitate the divine attributes. In the New Testament, the apostle Paul refers to the early Christians as saints because, as a community, they were set apart from their nonbelieving neighbors. The Christians were now God's own people, "the holy ones in Christ Jesus" (Ph 1:1). They, too, bear the task of emulating the Divine: "Put on the new self, created in God's way in Can we Use saint , to refer toChristians who lived exemplary lives ' of irtue and simplicity? righteousness and holiness of truth" (Ep 4:24). Eventually the term saint referred to Christians who lived exem-plary lives of virtue and simplicity, whose lifestyles served to inspire others. Christians at the Catacombs A cross-stitch sampler reads, "When someone you love becomes a memory, that memory becomes a trea-sure." As we peruse our family albums, we inevitably find the last photo taken of loved ones whose earthly lives are now memories. By visiting their graves and decorating the gravesites, we show that we treasure those memories. The ancient Israelites regarded death as the passage from life to Sheol (she-OHL), a dark place of confine-ment, but not one of punishment. In Sheol one was estranged from God: "Who among the dead remembers you? Who praises you in Sheol?" (Ps 6:6). From the moment of death, there were displays of grief, shown in clothing and in loud laments, wailing, and weeping. Advent/Christmas 2004 Flynn ¯ Saintlt.t Proper burial was required. To leave a body "for the birds of the air and the beasts of the field" (1 S 14:44) was an insult to God's creation. Poor people were buried in common graveyards. The wealthy had vaults dug into the hillsides. The entryway was closed with a circular stone slab. Families might have several interconnected rooms. Bodies were laid on shelves carved out for that purpose. The Jewish Christians also, of course, honored the memory of their loved ones. At first they simply con-tinued their Jewish practices, burying their dead amid laments and dirges. The resurrection of Jesus, however, changed their mourning into joy: "We do not want you to be unaware about those who have fallen asleep, so that you may not grieve like the rest, who have no hope" (1 Th 4:13). These new Christians, then, regarded the graves of their loved ones as a temporary resting place, not a final one. The word cemetery comes from a Greek word meaning dormitory, sleeping room. Christian burial customs continued to reflect the Jewish emphasis c~f respect for the body as God's cre-ation. To this end, Christians choose modest ground burial in common graveyards. During the 2nd and 3rd centuries, Christians made an effort to identify the graves of martyrs. They viewed death as a birthday: birth of a new life with God, as Jesus had promised. They occa-sionally gathered at these sites on the anniversaries of the martyrs' deaths to rejoice and commemorate their lives. In the 3rd century, Christians were buried in the cat-acombs, which were probably extensions of the hillside vaults of the wealthy. The catacombs were not used as a refuge for Christians during times of persecution. In the 4th cen .tury, however, they too were the site of memorial services. Here they celebrated the Eucharist "in memory Spirituality Review of those athletes who have gone before, and to train and make ready those who are to come hereafter."' Local Calendars and Canonization As we turn the pages in our family album, we come upon photographs of those who sacrificed their lives in the service of others--a widower uncle who refused to place his handicapped child in an institution despite pres-sure from doctors and family; an aunt who renounced marriage and children in order to care for her aging par-ents. They may not have died for their cause, but they laid down their lives nonetheless. To the Jewish community, a martyr was someone who was deeply devoted to God and lived life of exemplary piety and holiness. The martyr, or "witness," testi-fied to the manner of life appropriate for God's cho-sen people. To the new Christians a martyr was one who endured, not for the faith, but because of it. Faith allowed one to be "strengthened with every power, in accord with Mat does it'.mean .to'say a ,matyrr : one who endured; ,not for, the fai h, but ecause:ff it? [God's] glorious might, for all endurance and patience, with joy giving thanks to the Father, who has made you fit to share in the inheritance of the holy ones in light" (Col 1:11-12). The Book of Revelation refers to martyrs as those who gave their life for Jesus Christ. In later cen-turies martyrs came to mean those who willingly died for their beliefs. Christians faced persecutions until the peace of Constantine in the early 4th century. Recalling the acts of the martyrs served to inspire the .community in the Advent/Christmas 2004 Flynn ¯ Saint lt.t face of opposition. Each church had its own list of local heroes or saints. As intolerance subsided, martyrdom became uncommon. Christians now looked for new heroes to emulate. People who led extremely virtuous lives, especially those who lived in voluntary poverty, were included in the local calendar of saints. There were no formal criteria for sainthood: the devotion of the community was the sole requirement to set them apart. Over the centuries the lists of saints swelled and abuses occurred. Family legends often become exagger-ated as time passes; the sagas of the saints suffered the same fate. Consequently, the bishops began to set norms for calling people saints within their dioceses. In 1234 Pope Gregory IX declared that the sole route to official sainthood was papal canonization. Formal canonization has seen many changes since then. The most recent revi-sion came in 1983, but the devotion of the community is still an essential element. The lengthy and complex pro-cess begins when one or more persons submit a request to the bishop to examine the life of a deceased hero. All the Saints Sometimes, as we look through our family pho-tographs, we are surprised to discover an uneven repre-sentation of our relatives. Some people appear in almost every picture while others appear only rarely. Vghatever the reason for this, as families grow it becomes increas-ingly difficult to photograph the entire clan. Similarly, as our family of saints grew larger in num-ber than the days in a year, it became impossible to assign a specific day to honor each saint. The obvious solution was to select a day to honor all the saints, known and unknown, who did not have a personal feast day. Various places chose different days for this. November 1, the first day of Celtic winter, was the feast of all the saints in Spirituality Review Ireland. It was not until the 9th century that November 1 became the feast of All Saints for the entire church. While we celebrate the memory of all saints, we adore God alone. We pray to the saints to intercede with God for us. We venerate saints; we worship God alone. The distinction may be subtle, but it is significant. As Lawrence Cunningham observed, the saints "give us the encouragement to be more self-giving, more loving, less inclined to hate, more compelled to love. They invite us, in short, to transcend ourselves.''2 The Solemnity of All Saints is a day to honor those saints whom the Church formally recognizes for their lives of service to God and their neighbors. It is also a day when we can remember our loved ones who have gone before us and left memories to inspire us. It is a day when we can notice the goodness of people still among us, living relatives and friends who challenge us to be the person God calls us to be. At baptism each one of us was set apart for God. We became members of "'a chosen race, a royal priesthood, a holy nation, a people of his own, so that you may announce the praises' of him who called you out of dark-ness into his wonderful light" (1 P 2:9). Through baptism God lays claim to us, enabling us to become divine instru-ments. Whatever our situation in life, we are to imitate the divine attributes, to live virtuous lives, and to bear wit-ness to the way of life appropriate for God's holy people. The following stanza rarely appears in our hymnals despite its powerful imagery: For martyrs, who with rapture-kindled eye saw the bright crown descending from the sky and, seeing, grasped it, Thee we glorify.3 We, too, must grasp the crown, not necessarily by dying for our faith, but rather by persevering as witnesses who, through faith, live as God's image and likeness. Now it is /ldvent/Cbristmas 2004 Flynn ¯ Saintlt! our turn to be heroes and heroines for others, to "saint it," to act like saints. Our lives will then inspire a future gen-eration of saints and help to shape their Catholic heritage. Notes i From "The Martyrdom of Polycarp," 2rid century. 2 Lawrence S. Cunningham, The Meaning of the Saints (San Francisco: Harper and Row, 1980), p. 162. 3 Marilyn Kay Stulken and Catherine Salika, Hymnal Companion to VVorsbip, 3rd ed. (Chicago: GIA Publications, 1998), p. 416. Reflection Reflect on/share your 'experience of the homespun sampler that says: "When someone you love becomes a memory, the memory becomes a treasure." Spirituality Review DAVID L. FLEMING Imaging Isaiah Readings from the book of the prophet Isaiah are used for more than half of all the Advent Masses. The Liturgy of the Hours for this liturgical season, too, depends frequently on a first reading from Isaiah. Who is this man Isaiah? Why has the church chosen him to lead us through Advent? I believe that if we will make use of an imaginative way of praying we will be graced by God to have a richer appreciation of our Christian Advent. Let us ask, then, for an encounter with this prophet of God, one specially chosen to help us "wait." We are on a country road, and Isaiah is walking towards us. He seems to have a face that people say is "typical"-- that is, a typical Judean face. He, an eighth-century man of Judah, appears to be a man of experience--average height and build, seemingly in good health, with the lines of aging already visible around his eyes and across his David L. Fleming SJ is editor of this journal. He may be addressed at 3601 Lindell Boulevard; St, Louis, Missouri 63108. expecting in hope Advent/Christmas 2004 Fleming ¯ Imaging Isaiah forehead. At the same time, his eyes, bright and steady in their gaze, seem younger than his face and body; they are dark and serious,-strong, and unflinching. He has a studious air about him, like a longtime, somewhat rumpled, university professor we can feel at home with. He speaks quietly, but with authority. There is a certain cadence in his speech, a bit like listening to a poet give a dramatic reading of his own poetry. And so he begins to share some of his own story with us. We listen. I am a typical Jewish man, married, with a family. But I know that I am not typical in the way that I experience how God works in my life. Let me say straightway that God is God, there is no Other, and God is the God of my whole life. I am now working with my fourth king here in Judah; kings have come and gone in my forty~year experience, but God always remains. He stays with me, with us, his people. From my very first extraord!nary experience of God reaching into my life, God for me has always been the "Holy One of Israel." Sure, I have felt the warm reality of God's love, the intimacy of his call, that first time almost sounding like a plea, "Whom shall I send?" With the boldness of my youthful faith, I had no hesitation in speaking up and saying, "Here I am, Lord, send me." But, above all, my experience of God is that God is awe-ful, God is holy--really "other" than us. We humans are not very good in letting God be God in our lives. We do not like the awe-ful, the totally Other, the mysterious One. We still prefer making God like ourselves, and we find it very hard to allow God to make us like him. That pretty well sums up what I have had to say to my people and to kings for forty years. I see human pridebour self-indulgence and even our indifference to those in need--writ large in our nation of Judah. Yet Judah is "my people" and Jerusalem is the holy city. So it is hard for me to cry out and condemn, but what Spirituality Review can I do? The words are not mine, but God's word. God could raise up an ass to do as much as I do. Some people call me that anyway, and on my good days I take it as a compliment. You see, God is God, and from a weak and insignificant remnant of a people God will raise up a king from David's line just as he promised. We are called to trust. The Lord is the faithful One--faithful to his promises--and where else but from the Lord will we find a rule of peace and justice and a real family of humankind? I have seen quite a few kings--my hope lies not in them. My hope is always in my God, working with us now and moving with us always to a future that is in his hands. In our good times and in our busy moments, we forget or ignore God. In our hard times, we complain against our God, and we say that we cannot trust him. With all our ups and downs as a people, our moments of pride and then our times of discouragement and destitution, I feel that I must say two things at once. God wants to use me to console, not to punish. Our faith needs to feel strengthened, and not face further trial or reprimand. We need to grow in our trust of God. God says that through me; God also acts this out--for me and for my people, his people. The kingdom of God is at hand, and the poor and the lowly-- just how we feel now--are the very ones who find their home within it. So I image God's word like a two-edged sword. It cuts into our pride, our vanity, and our callous injustice to the poor; but it also heals with its searing blade, and it provides strength and protection. Advent/Christnlas 2004 Fleming ¯ Imaging Isaiah This is my experience of being God's prophet. This is the way that I live my call from God, listening to his word. I am trying to live this vocation faithfully. As I continue to respond to God's word, I feel myself always being challenged to grow in my trust of the Lord. Maybe being God's prophet is really not so extraordinary an experience. We all have to be faithful to our vocations, don't we? And that requires a continuing interplay of listening and responding. Of course, this way of living demands an ever greater trust in God for all .:of us, Living with God is such an advent experience-- always awaiting God's coming, in a spirit of trust. Prayer To continue the conversation with Isaiah and with God, we might open our Bible to Isaiah, chapter 43. Perhaps this passage will call forth in us our own encounter with Isaiah and/or God. Perhaps there will be little conversation, and instead just being with each other and thinking similar thoughts. And then we might remain with whatever phrase or sentence captures our heart, like the refrain of a song that keeps coming backer is it us coming back to it? Who is waiting for whom? Reflection Questions How have we experienced Isaiah providing a doorway for us into our Advent season? Does our listening and responding to God increase out trust in God leading us on in our vocation? Spirituality Review ROBERT P. MALONEY Dismas's Dying Moments: Reflections on "Palpable Grace" All four Gospels paint the same stark picture of Jesus' death: he dies crucified between two criminals, one on his right and one on his left. But, whereas Mark, Matthew, and John say almost nothing about the two criminals, Luke gives them speaking roles in a dramatic episode. In fact, this scene is the longest and most important Lucan difference in the crucifixion story. We usually refer to its main character as "the good thief," though Luke calls him neither "good" nor a "thief." While Mark and Matthew describe both men crucified with Jesus as "bandits," Luke simply refers to them as "wrongdoers," perhaps because, as the evangelist who most emphasizes gentleness, he wants to avoid placing Jesus in violent company at his death. Robert P. Maloney CM, superior general emeritus of the Congregation of the Mission, continues to write from Via dei Capasso, 30; 00164 Roma; Italy. remembering Advent/Christmas 2004 Maloney ¯ Dismas's Dying Moments Later tradition gave various names to both wrongdoers 0oathas and Maggatras, Zoatham and Camma, Titus and Dumachus, Dismas and Gestas), Most of these names are forgotten today, but some readers may still recall the good thief as Dismas. Under that name the Roman liturgical calendar assigned him a feast day, 25 March, once regarded as the day of Jesus' crucifixion, but now celebrated as the feast of his incarnation. A charming legend found in an apocryphal gospel relates that, when the Holy Family went down into Egypt, two robbers set upon them. One, however, halted immediately when he saw the tears that welled up in Mary's eyes. It was these same robbers (now caught plying their trade in Jerusalem)--so the story goes--who were crucified with Jesus. The one moved by Mary's tears was the good thief at Jesus' right. But the Gospels are silent about the wrongdoers' past history and personal lives. At first reading, the dialogue in Luke seems simple and direct, but in fact it is filled with subtle undertones. One of the wrongdoers, the evangelist states, joins his voice with those blaspheming Jesus: "Aren't you the Messiah? Then save yourself and us." But the "other wrongdoer" (Luke never calls him anything else) rebukes his companion: "Have you no fear of God, seeing that you are under the same sentence? We deserve it, after all. We are only paying the price for what we have done, but this man has done nothing wrong." Notice that in this Lucan scene the good thief is the witness to Jesus' innocence. Later a second witness, the centurion, will confirm the good thief's judgment, testifying "Surely this was an innocent man" (Lk 23:47). Now the drama heightens as the good thief speaks directly to the crucified Lord: "Jesus, remember me when you come into your kingdom." "Jesus"! This form of address is stunning in its intimacy. Nowhere else in Spirituality Review the four Gospels does anyone address Jesus simply by his given name without any reverential qualification. Luke's artistic touch conveys the genuineness of the wrongdoer's request. But note the irony too. For Luke, the first person with the confidence to speak so familiarly with the Lord is a convicted criminal--and he is also the last person to speak with him. He phrases his plea as remembrance, a favorite Lucan idea that is also found on ancient Jewish gravestones: "Remember me." Against all ordinary probability, this wrongdoer, hearing Jesus mocked as "king of the Jews" and sensing that an injustice is being done, believes that Jesus really will rule over a kingdom and humbly asks to be remembered. Jesus responds with an "amen saying," the only use of this solemn form in Luke's passion narrative and also its sixth and final use in his Gospel. Here the solemn formula bestows the gift of God's forgiveness. Jesus' assurance goes beyond anything that the wrongdoer (or the reader) might have anticipated: "Amen, I say to you, this day you shall be with me in paradise." Much more is granted than was asked. The response includes not just forgiveness but intimacy: you shall be with me. The good thief will, in Jesus' company, enjoy the fullness of happiness with God. Let me offer two brief reflections on this wonderful Lucan story. 1. We believe that grace is a pure gift. God bestows it freely and abundantly. We do not earn it; we only respond to it. On the deepest level, grace is God's presence, God's offer of personal love and self-communication. The gift is the giver. God touches our hearts and stirs up, even creates, a response within us. But it is important to note that this gift is not merely an unseen reality; it also comes in palpable forms. The Gospels remind us of this again and again. For the good Advent/Christmas 2004 Maloney ¯ Dismas's Dying Moments How understand "Jesus" grace, thief in Luke's story, Jesus is grace. One can almost imagine this "other wrongdoer" studying Jesus and slowly arriving at the conclusion that the man beside him is not only innocent of a capital crime but genuinely good, In fact--this little detail often goes unnoticed-- Luke gives the good thief more time to observe Jesus than any of the other evangelists, for in his Gospel (different from Mark, Matthew, and John) the two wrongdoers walk the entire way of the cross with Jesus before dying with him (Lk 23:32). The goodness he sees in the person of Jesus touches the good thief's heart and evokes a response: "Jesus, remember me." Is that not how grace often works? It enters our lives through the faithful witness of others (like our parents, or a self-giving servant of the poor, or a sick person who bears illness with courageous faith) or through a saint's life or a martyr's death that we read about. The signs of God's love--what we call "grace"--are visible all around us. What is remarkable in the good thief is that he does not turn in on himself in the desperately grim moments when his life was draining away. Instead of sinking into depression or despair, he sees goodness itself in the person of Jesus and utters a hopeful plea: "Jesus, remember me." He sees grace personified and responds. 2. There is something remarkably humble in this "other wrongdoer." Unlike his companion, he recognizes the truth of his own situation. His sober analysis was, I suspect, shocking both for the first wrongdoer and for the bystanders: "We have been condemned jusdy. We are only paying the price for what we have done, but this man has done nothing wrong." Spirituality Review Thomas Merton once wrote, "We make ourselves real by telling the truth." Truth lies at the core of our being, straining to emerge. When we express the truth, we begin to build our true self. So it was for the good thief. Drawn by the innocence and goodness of the Lord, he recognized his own emptiness and, precisely in doing so, was able to see, hear, receive, and be filled. There is a humble and at the same time affectionate ring in the good thief's plea, "Jesus, remember me when you come into your kingdom." And Jesus' warm response is another Lucan testimony that the humble are exalted: "Amen, I say to you, today you will be with me in paradise." As Jesus often 'reminded his followers, to the humble all good can come, whereas the proud always remain empty. In a time when there is so much war, so much terrorism, so much hunger, so much disease, and so much senseless death, Luke's account encourages us to see, along with the good thief, the abundant signs of God's gracious love, even in the midst of suffering. Luke urges us to stand before the Lord and before each other with great trut-hfulness and humility. Humility will enable us to see our companions on the journey as grace in our lives, visible signs of God's presence and love. As he approached the place of crucifixion, the good thief must surely have felt that this was his darkest hour. But light shone for him in that darkness because, with the Lord, "darkness itself is not dark anti night shines as the day" (Ps 139:12). Prayer We might enter into Dismas's experience by listening to Advent/Christmas 2004 Maloney ¯ Dismas's Dying Moments the Taiz~ hymn "Jesus remember me," with its repeated refrain: "Jesus, remember me, when you come into your kingdom. Jesus, remember me, when you come into your kingdom." O dying souls, behold your living spring: O dazzled eyes, behold your son of grace; Dull ears, attend what word this word doth bring: Up heavy hearts: with joy your joy embrace. From death, from dark, from deafness, from despairs: This life, this light, this word, this joy repairs: Gift better than himself God doth not know: Gift better than his God, no man can see: This gift doth here the giver given bestow: Gift to this gift let each receiver be. God is my gift, himself he freely gave me: God's gift am I, and none but God shall have me. --St. Robert So.uthwell Spirituality Review ROBERT NORTH My Associates Spirituality guides propose that to fill blanks or weariness in our prayer we readily have "recourse to familiar ejaculations like "Lord, have mercy on me a sinner," "Speak, Lord, for your servant is listening," or "Lord, to whom shall we go? You have the words of eternal life." These help us to make our prayer legitir~ate!y.~e!.(Tce!3.t~-ed, aiming to make us more Christlike. But a dif-ferent legitimate focus of prayer aims at God's creative and caring concerns more directly than our own. We propose here an ejaculation less simple and familiar but more suited to this focus: "Son of God, help me to do my part in fulfilling your creation plan for myself, my associates, and the whole universe." The invocation "Lord" may mean either God or Jesus, but the equivalent "Son of God" evokes Robert North SJ writes us an article for the first time since 1944, when he wrote "Scripture in the Christmas Liturgy" during this journal's infancy--and only a year after Divino afflante Spiritu. His address is Jesuit Community; 10100 West Bluemound Road; Wauwatosa, Wisconsin 53226. expanding our world Advent/Christmas 2004 North * My Associates our chief doctrines, the Trinity and the incarnation, as the basis of our faith and prayer. But another key term follows: "my associates." It evokes the vastness of God's creative concerns in their relation to me. "My associates"--whether used in silent prayer or expressed publicly--doubtless usually suggests my fam-ily and friends, my business associates, and members of my community or parish or neighborhood. The term "associates" is also likely to include religious authori-ties- the pope, the bishop, other bishops worldwide, the world's Catholics--with the faintest hint of omitting or forgetting other Christians or people of no belief in any God at all. Such a hint is hopefully gradually vanishing in our ecumenical age, as we take cautious steps to share the aim of several world-renowned prayer sessions of Pope John Paul II with other believers in a God even with a different name or attributes. Our progress along these lines is strengthened rather than diminished by the pope's per-sistent promotion of this project in spite of vocal and well-publicized opposition from some top Vatican prelates. God's Own Religious Associatesmand Ours Our church does indeed admit and even sometimes pronounce emphatically that our creating and caring God "willed" (can this mean less than "intended"?) the salvation of all humans, "them" no less than "us." This has been often or generally taken to mean that God wishes all humans to be members of his one church, thus giving a strong urge to missionary activity. In the early years of a developing Bible-based theol-ogy, the church became the official religion of the Roman Empire, then dominating virtually the whole world. Thus there seemed nothing quixotic in hoping and making efforts toward "conversion" of those scarcely known or Spirituality Review suspected fringe tribes outside the Mediterranean world. But the world we know today, still incompletely and pro-gressively, is of course a vastly different story. A great many of today's conversions by the received methods are in the parts of Africa or Asia whose exis-tence had never even been suspected in the Roman world. But other regions, especially those incorporated into Islam, raise a great outcry against "proselytizing," and even forbid it by law as a political maneuver. Partly to escape such laws, but more because of their own growing ecumenical con-victions, some--far from all--of the well-estab-lished Catholic "missions" proclaim firmly that their goal is not conversion but "mutual understandingF."rom Catholic theology and traditions their effort is to recognize with sympathy how the creating and caring God has enabled all peoples to get some inadequate notions of him under different names and attributes oi" even with distressing notions of (human) sacrifice or other religious obligations. Not only Catholics but also prosperous Evangelical missions hope that a dialogue will thus develop, so that each side will see some merit in the other or some lim-ited revelation of himself by God in inscrutable ways he has chosen. From such open-minded dialogue, some few or many may freely and honestly choose Christianity. This hope may be unduly optimistic, especially in view of how Christian success has historically been imposed by warlords, though not to the grim and now soft-pedaled extent of moderate Islam. But frankly proselytizing efforts like "Bibles for (communist) Russia" or "Jews for Advent/Cbrispmas 2004 North * My Associates Jesus" inevitably arouse a self-defeating hostility. Religion must adapt to culture patterns. Slavery is now con-demned, and what was called "usury" is now widespread under various names. Today's goal is ecumenism. God's Associatesmand Oursm in Starving Africa and Asia Prominent among one's associates are those whom one must feed. Not only nursing mothers but also wage earners of large families quite naturally feel a special responsibility to their children and aged relatives who depend entirely on them for keeping alive. Some few of these for various reasons may not even be relatives, though usually they are already "associates." But many of the world's people have only their creat-ing and caring God to save them from starvation, despite the help they may receive from charitable organizations whose members may well regard them as "associates." If in our prayers we think it right to focus on God's interests as equal or even prior to our own, we should include among our own "associates" these starvelings who depend on us (the overaffluent rest of the world). But wait! There is a danger that we may feel that in praying for these "associates" we have discharged our obligation toward them, like the New Testament person who virtuously says to a beggar, "Go in peace; be warmed and filled" (Jm 2:16). We may be reassured that our prayer is not an empty or hypocritical gesture if we also make a regular contribution. But the real-world situa-tion is far more complex. The clamorous problem is that a small percent of the world's population owns most of its resources. They are needlessly rich, while the others are too poor--living below what statisticians of even the richest nations cal-culate and publish as "poverty level." And of course we Spirituality Review all know, even perhaps a bit complacently or thankfully to God, that our own too rich standard of living is at or near the highest in the world. "On the average," we must add, for the thousands of our citizens who must sleep on the cold streets or survive on handouts and soup kitchens make our disproportion even worse. We are not asking whose fault this is. No one's, really. A combination of circumstances over centuries: vast national and individual landholdings, brave pioneers who transformed the untilled territories of aboriginal nomad tribes into richly yielding farms, and "democracy," which with all its merits gets lawmakers to give a higher prior-ity to contenting their constituencies ("pork-barrel" deals, lobbies, sometimes actual graft, and so forth) than to world justice. A sensible redistribution (even if far from equality) would demand that legislators and voters rec-ognize that, for one pan of the scale to go down, the other must be more or less empty. Even our meritorious farm-ers and expensively trained pharmaceutical biochemists must not only tolerate but demand that their excesses be cut to help (even if only slightly) the truly intolerable position of most of the world. This is not to suggest that there be another (rash and counterproductive) political lobby, but rather a reasoning dialogue among holders of power. Something like this should be the object of our prayers for poverty-stricken associates. Such prayers can be honest and effective, not hypocritical (as pilloried in the letter of James), even though we do not consider the situation appropriate or ourselves competent to warrant "meddling in politics." Our "Planet Earth" Associates Though "the whole universe" is a separate focus of God's creative concern,, there is an aspect of it involving AdventlChristntas 2004 North ¯ My Associates "my associates." The Earth is truly "ours," though only a planet of a galaxy so small that it is scarcely noticeable in the vast sky maps shown in the latest telescopes. Yet our own material bodies are constituted of infinitesimal particles whizzing in and out from the farthest star. Of St. Ignatius Loyola a poet wrote, "His vigil was with the stars; his eyes were bright with radiance of them." Long before him Christians and others had gazed at the How do wefeel about the convictions.ofan Earth-centered universe:? stars with a mystic fas-cination, sometimes as the very "heaven" in which God was believed to dwell. Yet through all those centuries the star-studded sky was known only about as much as could be seen on the ceiling of a planetarium, and the Earth was thought to be the center which gave function to all the rest. Ignatius wrote in the "Foundation" of his Exercises that everything that exists is for me. This is not just lib-erality but a challenge and a test: to be used only as things help to the goal of my creation. Technology and inven-tions provide now a far greater and more tempting range of options, and the universe known to science today is vastly greater. Some devout science-minded Christians find this to confirm rather than lessen their faith: "More is better! If the immensity of reality known to antiquity showed forth the greatness and generosity of its Creator, this is now proved a trillion times more firmly." But others feel that Isaiah 45:18 must now be under-stood in an entirely new way: "the creator of the uni-verse., who formed the earth and made it. did not create a chaos, but formed it to be inhabited." Why should God have chosen to produce the sterile varieties Spirituality Review known to astronomy if his real goal was the tiny pin-point of it fit for human habitation? We cannot claim to intuit or know God's intentions: "my ways are not your ways" (Is 55:8). But surely all progress of science and theology too has been due to people reflecting on vari-ous possible intentions of the mysterious data of experi-ence. We can pray that we may do our part in the fulfillment of God's creation plan. Though the conviction of an Earth-centered uni-verse is today derided, we should not sell the idea short. Even the most demythologizing astrophysicists agree that our own Earth is unique in its formation through billions of years by explosions and floods implausible for their gradual releasing, from various locations in the whole universe as much as four million years ago, gaseous and solid elements indispensable for the human life which appeared shortly after. Of course, scientists still earnestly searching may yet find evidence that other stellar bodies by quite different explosions are in process of forming a surface capable of supporting human or humanlike life. But they and the general public are much more arrested by the question of whether human or any true "life" actually exists on another planet. Even before the recent exciting com-munications from Mars, the Vatican Jesuit astronomer Guy Consolmagno wrote that materials from Mars, though not life itself, were microbe combinations of the kind which on our earth eventually hooked up with car-bon to form primitive life-forms. Later he wrote the arti-cle "Could I baptize a Martian?" Our church has in fact been open and keen on whether there could be humanlike life on other planets. With sci-ence she recognizes that evidence for this is at most a remote possibility, but not altogether excluded. These merely possible beings would fall into the class of "asso- Advent/Christmas 2004 North ¯ My Associates ciates" for whom we should pray as objects of God's own creative concern. If indeed they were (evolutively) cre-ated, then they form part of God's desire and intention that they should share in salvation, even if they have not (yet) been baptized members of the Christian church. Union Replacing Divisiveness This widening of the concept of "my associates" has been developed in accord with modern scientific revi-sions of geography, economics, and astronomy. But its true merit for our prayer lies in recognizing the spiritual value of seeking a greater union among the peoples amid whom we live. "No peace among nations without peace among religions," it has been said. Hope of real peace and union among all humans may be realistically unlikely and nevertheless a valid goal--God's own creative caring goal--toward which our prayer may be directed. A Prayer When I think of you, Lord, I cannot say whether I find you more in this place or that place--whether I am contemplating you or whether I am suffering--whether I rue my faults or find union-- whether it is you I love or the whole sum of others. Every affection, every desire, every possession, every light, every depth, every harmony, and every ardor glitters with equal brilliance, at one and the same time, in the inexpressible relationship that is being set up between me and you: Jesus! Pierre Teilhard de Chardin "The Mystical Milieu" Writings in Time of War Reflection Question What has been my experience of praying for others? Spirituality Review The Best of the Review - 3 WIN 9x/ME/NT/2000/XP-- This program will run automatically or run"START.EXE" MAC 8/9/10/Chssic -- Double Click on the Start.icon As a special bonus, the book A Spirituality for Contemporary Life: The Jesuit Heritage Today is included on this CD-ROM. The Christian Ministry of Spiritual Direction edited by David L. Fleming Sy This best-selling book, about the theology and psychology of spiritual direction in the Christian tradition, has been of service to many. It is now republished on a readable CD-ROM. $I 0 plus $2 postage and handling I. Spiritual Direction: Needed--a Spiritual Context II. Spiritual Direction: Identity--a Christian Ministry 1II. Spiritual Direction: Its Interaction with Psychology IV. Spiritual Direction: Its Beginnings V. Spiritual Direction: a Process A. God and Our Experience B. Prayer and Examen C.Will of God and Discernment D. Dialogue VI. Spiritual Direction: Special Concerns To order this CD-ROM, please see order form on the back. phone: (314) 977-7363 fax: (314) 977-7362 email: review@slu.edu Please make payment to: Review for Religious ¯ 3601 Lindell Boulevard St. Louis, MO 63108 foview r religious We accept Master or Visa card, or checks in US funds on a US bank. 3601 Lindell Blvd.- St. Louis, Missouri 63108- USA order form subscription rates [] ONE-YEAR SUBSCRIPTION Within the United States .u.s$24 [] Outside the United States (Surface Mail) .US$28 [] [] TWO-YEAR SUBSCRIPTION Within the United States .u.s$40 [] Outside the United States (Surface Mail) .us$48 [] (Air Mail) us$43 [] (Air Mail) US$84 [] Please note that mailing costs are included with subscription rates. [] a new subscription [] a restart of a lapsed subscription [] a renewal [] a missionary gift subscription SUBTOT~IL book list N%TMBER OF COPIES TOTAL The Christian Ministry of Spiritual Direction CD-ROM @ $10 (as a bonus the book A Spirituality for Contemporary Life: The Jesuit Heritage Today ir inluded on this CD-ROM) __ Prisms for a Christ-Life @ $12 __ Notes on the Spiritual Exercises of St. Ignatius of Loyola @ $10.95 __ Paths of Renewal for Religious @ $10.95 __ Ignatian Exercises: Contemporary Annotations @ $12.95 __ The Church and Consecrated Life @ $18.95 1942-1994 Topical and Author INDEX @ $8 Above books add $2.50 for one copy, $1 for each additional book, for postage and handling. Special savings - next 3 books - purchased as a set for $25 plus $4 mailing cost __ Life through a P?et's Eyes @ $9.95 __ Praying as a Christian @ $12.95 __ Dwelling in the House of the Lord @ $12.95 POSTAGE TOTAL ENCLOSED Please make payment to Review for Religious in US funds oti a US bank. Prices good through December 2004. NAME ADDRESS CITY STATE/PROVINCE POSTAL CODE COUNTRY Please charge my ~ MasterCard ~ Visa Account CREDIT CARD Nq3MBER EXPIRATION DATE Review for Religious " 3601 Lindell Boulevard " St. Louis, MO 63108 " USA PHONE: 314-977-7363 ¯ FAX: 314-977-7362 Emaih review@slu.edu ¯ Website: www.reviewforreligious.org Review for Religious--A Quarterly Jburnal,~ (All prices include mailinog .c. .s.ts0 : UNqTED STATES AND" ITS TERRITrRIES $24 for one-~,ear sUbscription $4.0 for two-year subscription $3 for one copy of Spirituality Review suppl~_ment MethodsofPayment ' " ~ All checks and money orders should be made ~ut:toRE'~iEW FOR REL~GIOUS and paid in US currency dra~vn on US banks 07 their agents. MasterCard or Visa -accepted. Please send all correspondence to: Review fo~ Religious ¯ 3601 LindeJl ~oulevard . St. Louis, ~O ~63"108-3393 FAX: 314-977-7362 ¯ E-MAIL: re~iew@slu.e~u Web site: www.reviewforreligio_us.org - New subscriptions will begiri'within t~n to t~el~e weeks. Address chagges require 9t least four weeks' notice. Please send' both your new address and your forme"r address. Please include your subscription number for ~renewal~ and changes of-addresS.' Th~ core of each issue of Reviev¢ for.Religious ~ is available on' cassettes.~to the visually impaired ~.~. --free of charge ~Contact: Alfced.E.'C~r~an~ SJ, Director Xavier Socie'ty for the Blind ~ 154 E. 23rd Street°, New-York, N~ . Telephone: 212-]473-78~90 FOR ALL OTHER COUNTRJ.ES (SURFACE;MAI~). . $ 2 8 fQr one-ye~ir subsgripdon $48 for .two-year'subscription FOR ALL OTHER COUNTkIES (~kIR MAIL) $43 for one-y.ear subscription $8~4 t%r twol-year subs~rip~on.

Issue 4.2 of the Review for Religious, 1945. ; ,~Befora wrlt[~9 to ~s~° pl:~'se'co~sult noilce ~a Inside. back ~ove,. VOLUME IV / MARCH"i'5. 1945 ¯ ,, + " " l~ItJMbl~l~,2 , CONTENTS, +, ., , SECOND YEAR OF NOVI:FIA'~E" Adam~C: Ellis, +g.J -. .-. 73,, BOiDKLETS . ? . ° . . .,\. HOLY COMMUNIO~ AND SPIRITUAL .~ROGRES~-- " ~- , Clarence McAuliffe; S.2 . ~. . . .- ,-'OUR CO~qT~IBUTORS + ' ' ' " ILL-HEALTH AND THE APOSTOLIC VOCATION~A Missionary" ~THREE PREVENTI'#ES OF, "EXHAUSTION"~ ' ' BOO~S,~i~CEIVED . . ~. ,, .' ' " ' ' . . ,10, THE FAST BEFORE COMMUNION--Gerald Kelly,~ S.J. .~. . .j :l o# L~+'DECISIONS OF ,THE HOLY SEE o. . 122 BOOKREVIEWS (Edited by Clement DeMnth, S.J.)-- '-+- TJ~e Man NeareSt to ChriSt: ~A Herolne~of the Mission Field:,~niroductio . : ~ in Codicerfi: A Prefad'e to Ne,wman's Theology; War'is My Parish; Secrets , . ' ." 124~"~ of ghe Saints: Our Lad, y of Fauma '. , ,.~,, . COMMUNICATIONS ;' . . ' ; . -+. ; . .'+I~0 QUESTIONS AND' ANSWERS-- " '" Absences froXm the Novitiate: ,General+Pei'missions to Spend Small Sfims:' . +Soliciting Votes at General Chapter: Meaning 6f the Perio,dic "General r +Abso ut on":~ Use'+of Old Albs ahd ~eligious Habits: Plenary 'Indu"lge~ce . ~n articulo morris and thd_He~oic Acf; Plenary Indulgence~for.~Communion of Reparation: Nbvitia~e.+at Ordinary House and NoviCes at Community Recreation: Power to Ex't~ndoTime °of Novitiate;'Per'mission for Reli-gious to Donate Blood: Renewal,of Altar Breads: Banner b~fore Blessed, ~5" S,acrament, during Office: Oinission of Sign 'of Cross during the PassiOn; Right"to Admit Can, didate.s . " . ¯ " . ' " " i~ . ~ 136 SUMMER S~HOOL 'DIRECTORY O" --" " " " ~,~'-- ' '~; " " "" EX'PLANA:FI.ON OF THE MASS . " 14'4 ~'MARYKNOLL MISSION LETTERS . ' .- A 144 REVIEW FOR°REI~IGIOUS, Mar~h. 1945". Vol.°IV, No. 2. Publis~'ed +.+~n°ntb] y ; .~January'o March,. , May, July,. Sel~tember;and November, at"~he College.,,, +press,, '606 H;~rnson Street, T, opeka, Kansas,. by St. Mary s College, St. Marys, Kansas; with ecclesmsttcal, approba~t ¯i o- n , E n t ,e- r e d a s s e c o n d c ,lass matter ,January 15 1942o+ at thePost Of~ce~ Topeka,~Kansasi under'the act of March 3, 1879. ¯ '- ~ 'Editofialfl3oard: Adam C. Ellis, S~. G. Augustine Ellard. S.3. Gel:~ld¢K~ll~,, S.3. Editorial Secretary: Alfred F. SchnetderJ S.J. . C6pyright. 1'945. by Adam C. ,Elli,s. Permission' is hereby granted fo~ quotati~nS '~of reasonable~ length, provided due~ credit be giyen this rewew and .tile ,au'thdr. Subscriptioii pric~: 2 dollars a year. ,~, ' Prifited in'U.- Second- Year of Novi :iat:e Adam C. Ellis, S.J: ,7T H| "EE mFRpEirNe,C aHnd R oet~hoelru p'toil0inti,c 3aol sthepehoir~iems iinni mthiec Aalu tsot rtihaen Church had all but ~estroyed the .religious life in: ~ Europe by the end of the eightdenth century. V.ery many,, monasteries and convents had either been Suppresse'd or were, f6rbidd~n to take novices. As a restilt ¯many" b~n~fi~ent labors~of the religious, in behalf Of the social needs 6f the:J "Church ~ere brought to a standstill. BU~ it was imperative that these spiritual and corporal.~works of mercy should hot'be abandoned altogether. Divine Providence inspired dd~'oted laymen and women to step into the-breach~ ~ to.take.up the task of teaching Christia_n Do~.r.rine ~to chil- ~dren, and of caril~g for the sick, .th~ aged, and the orphans. - Eventual.ly th~se zealousla~borers ,bhnded tbgether into .~,~smallgrout~s in order to work together more efficiently.; then-they began to live toge'ther in community,'and with ¯ the-permission of their local Ordinary they took simple, private vows and wore a common garb. Recognized offi-cially neither by Church nor State, the.y carried on their work valiantly. Eventually the Church rewarded thei~o °o zealous efforts. At first approval was given only 'to" their "constitutionsi but, especially during the second half~ of the nir;eteenth century,,, the Holy See .appro.ved the institutes .themselves as congregations with simple vows. Many of the founders of these modern congregations o realize'd that men.~and women whose vocation it was to-strive for perfection, in the active life needed a longer period " of' ptobation than the single year of novitiate commgnly ~-,,prescribed for cloistered religious. Hence these founders.~ ordained that all c.andidates undergo a second year of novi-. , 73~ ADAM C. ELLIS -.tiate~before the "firs~ Reoieto for R~ligiou.s profession+ of vows.° Furthermore, - some provided in their constitutions that the noviCesshould b~ employed in the external works of the congregatiffn during their second year. "This was done to determine whether they were fitted for this kind of work, and to give them opportunity to adjust their spiritua! life to the dis-tractions and trials+of the actiye apostolate. The Sacred Congregation of Religious consistently-refused to permit novices to be so employed during,the first year of nov.itiate.~ This practice of the S. Congregatt0n passed into the legislation of the NOrrnae of /901. 'After . stating in Art. 73 tfiat novices were n~t to be engaged in the ¯ study of the arts and sciences nor in theeexternal work of the institute, Art. 7"4 continued as follows: "Where there are tyro years of novitiate,the first is to follow all the i~r~- scriptio, ns laid down above for the one (canonical) year. During the second year, howe('er, the novices may engage moderately in studies or in other works of the institute ¯ always under the direction and vigilance of the master; this is to be done in the novitiate house itself, but" not outside of it, unless-grave, reasons advi~e otherwise." - The Code of-Canon Law was promulgated on.Pente-- cost.Sunday, May 27, 1917,, and.began t6 bind on Pen-tecost Sunday,. May 19, 1918. ~ Since the l~gi_slation of the Code sut~'erseded .the old Noi'rnae, upon which most of the cons~titutions of modern congregations were based, it became necessary for all religious institutes ~o revise their constitutions .in order (o bring ~hem into con-" ?;forniity with the Code. Superiors, therefore, were inter-i~ sti~d to find out what theCode had to say in regard t6 the second year of novitiate. They fo'ufid very little. 'Canon 5.55,"§ 2 allo~ed a second year df nowt~ate tf the+constitu-tions prescribed it,- but stated that this second year was not required for the validity of the subseqUent profi~ssi6n of 74 - w.hich were eventually-.sent tothe :Congregation of Reli-,. giou~ fora solution.Since canon 565, § 3-forbade n6vices _to engage in studies or in the. external' Works'of the institut~ "::during the year of novitia'te," did the s~im~ prohibition apply also'to the second year? Again, some congregatidns that employed, novices in external work, as was permitted' .![ b}'~ their, constitutions, preferre,d t6 do this during "the firs.t "~°~' year (as a means-dr trying out th,e:no~rices), and then~ to- ~ devote the Second ~ear exclusively to their spiritual f0rma/ ~ ., tion. Was this permitted under the new Cod~? -Such ";questi0ns,land others similar to-them, ~ind the fact that ~, various .provisions .concerning this rhatter.were found in many constitutions which had been revised according to the Code and submifted to the Itoly See for approval ~ill induced }he Congregation of Rdigious to make a careful 0 study of the subjgct. This study resulted in the "Instruc- [ion on the Second Year of Novitiate'" in .which all~ such 0_. questio~s~ gre. ~nswered and the fundamental :prinCiples-- which governed the pr.acticeof the Church during the.past ninety years are brought to the attention of all superiors of ~instit'utes having, two years of novitiate, . " There are fdur cardinfil points.in the instruction,~ ¯ Let us~consider each one in turn, I,. SpiritaalTormation of the Nboice is thO Principal ~ Purpose of the Second" Year. " -, "It is qui'te right that a i~ovitiate of more than one yearo~ be prescribed in. some institutes, especiz[lly, among those. '~Whose members ~are emp~loyed in external works, since they, distracted by various cares and more exposed ~o the dangers ~For thcr. tegt of "this Instruction see pp. 122-1.23 of this- issue. ~ Mar~b, 1945 " SECOND YEXR OF NOQI'rlAT[~ - ~ 'thereby serve You-in serving them for the mission. I was "~ " d~sconsolate at the thought that I'had"lost my work in the. mission and~had been given none in the province: ai~d al~l, the~while Your loving mercy was gig, ing me a-~hr~e~f01~t work, TO. YOU, IN MY FELLOW RELIGIOUS,. FOR° .~ December 1,Sth. It ~toesn't matter what I do if-I~-do .~ ~. God's will, if I: obey,-if [ love. God w~nts not my:~vork, ~ but. my love. ~o - . December 20.th. There is NO VACATION for ~a.'., " religic~us. Is no work ass{gned'or°allowed? Then must ,~' ¯ ~l.eisure be used to work the ~arder at becoming a saint, oat ~ ~. .- loving God more, at intercedifig and atoning more for souls~ ~ December 29th. -A ciborium full of hosts was conse- -, ~ated at Mass and then ,pushed ,back to the co~ner 6f the :~. /. corporal so 'that.it would not interfere with the l~Ias~s beingsaid. I waiat to be like that ciborium. Even though ; :'~ I am not a~llowed to return to the mission or am not givdn- " " ~" "~ ' work elsewhere, I wa~t to~do God's holy .will quietly and. entirely a'nd unostentatiously like that.citmfium-~-not hin~- derin~g .the great work of lorethat others'are carrying.on, ~- - and yet keeping Jesus all the while in my heait, read,r to ~.7" impart Him~without losing Him~to the souls, whoeve~ and wherever they be,to which "the servants of our Lord, .my'superi°rs, may. take me. . . \ Three Preventives" "' ot: "l xhausfioh" -. G. Augustine Ellard, S:J. ~, ~ ECENTLY it was announced that l~sychiat/isti i~n th~ United. States-ArmY have discovered threeLfactors, which tend to prevent "exhaustion" or "combat: :fatigue,".,that is,~a~bndition of certain soldiers who with~" Out being wounde~lbr, diseased.bave become more: or lels, iinfit to continue fi~hting, They may have fought long and ourageously: :but now, though apparently physicall_y well, they feel incapable of doing more; they are "exhaustedT'. too grdatly_ fat.igued to go on. The three preventives are: ~-edprit de corps, gooffleadership, and~reasons for fighting2 ,, ~Ivappears not unlikely that among- religious there may sometimes be an amilogous condition of "exhaustion," "and that it may be avoided by. the same three means. The first pre~;entive is esprit de corp.s. Amon~ Ameri-can~ service units its character and efficacy, are best illustrated _~.perhaps by the Marines. A Marine ~is taught f~om the beginning to feel that he is in thd greatest fighting group in all the world. ~Hence the~re is every reason why he should have the ti'tmost confidence in all his t~eilow Marines,' and why. he in turn must measure up to their exp,ectations. The ~Mdrines' records ar~ most glorious:, they must not be allowed to be'stained with ~nything that would dim their ~ luster.0 Everybody, atleast everybody in the American ~world, expectsofily what is most excellent~and heroic"from the Marines: he mu~f not disappoint.them. The'importance ~ of esprit.de co.rps is recognized by the Aimy and Nawy to be _so gregt that they are careful to f~reserve the distinctive "ide~nti~y and"historical ;ontinuit.y, with all their ~raditions ~> " - '- G,~ "AuG~-STINE EELAR~ ~ ¯ ; " Reoied) fo~ Relioious," aitd glories, of each s~parat'e u.n.i~ or division.--.The "~ight- -ingoSixty-hinth'' would be another ~xample of a. gtou_p in the American/~rmy that is.noted for its esprit de dorps. - ,.Religious orders and cbngregations also have their own esprif db corps., ' Sometimes it leads 'them intb faults,, for example, corporate pride or envy. But that is n6reason why it should not be cultivated f0r the good th~it is in it." A teligious:naturally and rightly tikes a cett~iin pride "in belonging to his 6rder-=-otherwise why did he-join it?-- an-d if h~ shoul~l 'feel~ deeply' and tritimatelywith regard to it: What is. meant by .noblesse oblige; that ~sense could be powerful aidto, livin_g up.t.o tile ideals andtoattaining t,ile ::purpose~ of the o~der'. 'The.laistok~r.'andtraditions of the institiate can be'a perennial f6untainhead of .inspiration arid courage: Its professed aims are a standing.challenge a~nd stirhulation to renewed or greater,.exertion. The examples of the founder arid of distinguished member~ are a~ constant _ invit~tioh to.emulate them, and'a clear prbof of what mem-bers o{ the organization, can achieve-.:' One feels that it" Would be a sil~me not to give a good account oYoneself in Suchcompany or t9 disappoint their hopes. The laurels

Issue 12.5 of the Review for Religious, 1953. ; A.M.D.G. Review for Religious SEPTEMBER 15, 1953 Pleasure and Ascetical Life . Joseph P. Fisher intergroup Relations " Wiiliam H. Gremley The Religion Teacher . Sls~er M. Acjneslne Practice of the Holy See ¯ Joseph F. Gallen Discipline . c.A. Herbst Questions and Answers Rural Parish Wo~'kers VOLUME XII NUMBER RI VII:::W FOR RI::LI IOUS VOLUME XlI SEPTEMBER, 15, 1953 NUMBER 5 CONTENTS SOME THOUGHTS ON PLEASURE AND THE ASCETICAL LIFE-- Joseph P, Fisher, S.J . 225 OUR CONTRIBUTORS . 230 ABOUT BOOKS . 230 SOME DEVELOPMENTS IN INTERGROUP RELATIONS-- William H. Gremley . . . . . 231 A YEAR WITH THE RURAL PARISH WORKERS . 242 PAGING THE RELIGION "TEACHER--Sister M. Agnesine, S.S.N.D. 248 PRACTICE OF THE HOLY SEE--Joseph F. Gallen, S.J .2.5.2 DISCIPLINE--C. A. Herbst, S.J . 272 QUESTIONS AND ANSWERS-- 25. Second Year of Novitiate . 276 26. Authority of Superior and Novice Master . 278 27. Sleeping Quarters of Novices . 279 28. Fugitive Religious and Dowry . 280 REVIEW FOR RELIGIOUS, September, 1953, Vol. XII, No. 5. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Jerome Breunig, S.J., Augustine G. Ellard, S.J., Adam C. Ellis, S.J., Gerald Kelly, s.,j., Francis N. Korth, S.J. Copyright 1953, by Adam C. Ellis, S.J. Permission is her.eby gra,nted for quota-tions of reasonable length, provided due credit be given this review and the author. Subscription price: 3 dollars a year; 50 cents a copy. Printed in U. S. A. Before wrlt;ncj to us, please consult notice on inside back cover. Some Thought:s on Pleasure and !:he Ascet:ical Life Joseph P. Fisher, S.J. ¯|T IS ALMOST INEVITABLE that a good many young reli- | gious, especially among the more fervent, run into certain difficul-ties in squaring their attitude toward pleasure and their acceptance of it with certain ascetical ideals. Practically all ascetical literature, as in a certain sense it must, enlarges on the danger of pleasure and sometimes almost gives the idea to inexperienced minds that pleasure is evil in itself. Likewise there is the insistence that the harder, the more painful, a thing is, the better. While this is true ~rightly under-stood, . young minds frequently make. no qualifications and hence fall into error. Often enough the lives of the saints seem to confirm their exaggerations. The, attitude of mind engendered by such misunder-standings makes for certain practical difficulties in the conduct of these young religious. They are constantly ill-at-ease when faced with pleasure. They feel their ascetical ideals conflict with the mode of action encouraged by customs, by more experienced religious, friends, or relatives. On certain occasions, for instance, feast days, picnics, visiting, it seems they are expected t~o enjoy food, entertain-ment, comforts of various kinds. But they feel that to do so means they must go back on the truest ascetical principles. Or it may be that they are encouraged to enjoy literature but feel that to do so would be. to lessen their ideals. As a matter of fact in the more. ex-treme cases a young religious may have his or her outlook so shaped by the conviction that pleasure is evil (or at least always very. sus-pect) and pain always good that the whole spiritual life is nothing but a kind of self-torture. As is evident, all religious should know the truth about this mat-ter. In general it may be said that not only is it no sin ~o enjoy moderate pleasure but it can easily be an act of virtue. And the goodness of the act can be indefinitely increased by the inte.ntion of directing it to a higher and nobler end, and even actually and ex-plicitly to our ultimate end. For example, a religious who likes honey may eat it with relish and glorify God by so doing. The religious knows there is no sin in such an action and implicitly understands that the action is in accord with God's designs for human life. As a 225 JOSEPH P. FISHER Reoiew ~or Religious matter of fact, the religious could make this an act of the love of God by quietly considering the Wisdom and Goodness of God manifested in this expe.rience of human life. And so with the various simple pleasures that might conceivably, come into an ordinary day. Thdre is a field of pleasure that may well call for special atten-tion. Nowadays many religious are called upon to teach the fine arts, whose whole purpose is to please. This does not mean of.course that this pleasure may be regarded as man's absolutely last end, but it is a relatively ultimate end. Unlike "practical" arts, the fine arts are not aimed at producing something useful, but something beautiful, which causes pleasure. Now if what w,e said above about the possibility of elevating the goodness of sensible pleasures is true, this possibility is even truer in regard to the pleasures of art. For the pleasure of art is a nobler pleasure than that of eating, for instance. Accordingly, it ought to be easier to sublimate the "good" present in an aesthetic ex-perience. Some may doubt this, recalling what they have heard about the immorality of artists of various kinds a~id the. warnings against being a vapid aesthete. And it must be admitted that for certain temperaments there is a danger. Father Graham, in his book, The Looe of God, puts !t stronglywhen.he says: "Artistic sensibility can and should, when controlled by prudence, lend grace and attractive-ness to the moral life. But it frequently happens that the allure-ments of beauty prove so strong that the response to them tends to degenerate into mere aesthetic indulgence. The lover of beauty is con-cerned above all else with the joyous experience of what is pleasing; when unchecked by other considerations he seeks logically an ecstatic existence of perpetual intoxication, through eye and ear and mind, with beautiful objects." It may be added that if a person is of such a temperament and gives in to it, he will undoubtedly do it to the neglect of duty. Even those who are not especially sensitive to beauty can at times be drawn from stern duty by the siren of pleasure. However, it seems that among Catholics and certainly among religious such aesthetes are rather rare. The difficulty is oftentimes the other way about. Even those whose duty it is to study literature and other works of art try to do so without apprec,iating and enjoying the beauty of them. Such an approach is obviously wrong, for unless literature and the other works of art are enjoyed, they are not correctly comprehended. And one who himself does not comprehend can hardly expect to teach others with any success. So it comes about that some rather fail in 226 September, 1953 PLEASURE AND ASCETICAL LIFE their du~;y by not enjoying what is God's Will that theyshould enjoy than by over-indulgence. For example, if Brother Aquinas is pre-paring to teach English and fears to allow himself aesthetic pleasure in reading Shakespeare's Merchant of Venice, he certainly will fail to a great extent in both his studies and his teaching. Moreover, it would be well for men if the right kind of people created and appreciated beauty. Too often the enjoyment of beauty appears to be the monopoly of sentimental, anti-intellectual, or at least non-intellectual, and irreligious escapists. "All things are yours" (I Cor. 3/33) but they won't be if we fear immod'~rately, unreasonably, the enjoyment of the beautiful. Since there is an intimate relationship between nature ahd art. it will help to see first something about the enjoyment of nature. Ac-cording to St. Paul, "All the creatures of God are good and nothing is to be rejected that is received with thanksgiving . " (I. Tim. 4/4). And "From the foundations of the world men have caught sight of his invisible nature, his eternal power and his divinity, as they are knowri through his creatures" (Romans, 1/20). The beau-ties of nature ought to lead us to God, Who is reflected in nature, the work of His bands. Many misunderstand the place of "creatures" in God'splan for men. They are normally the means by which man rises to a knowledge and love of the Creator. Too many look upon them as "absolutes," things apart from God, things which, if appre-ciated, draw us to themselves and away from God. Such a view is based upon a n.isunderstandlng of. their true nature. Creatures, finite beings, are of their very nature dependent beings, relative beings, not absolutes. They must, if properly understood, be related to the In-finite; they point to the Infinite; their participated qualities are finite reflections of the infinite attributes and should more than remind us of their prototype. For one who understands the truth about the nature of finite beings, they ought to be stepping stones or rather springboards by Which he rises to that full Being Who is the ever-active cause of their ever-dependent existence. "The Contemplation for Obtaining L6ve," which crowns the Exercises of St. Ignatius, tries to impress men with this truth, but many, satisfied with a super-ficial approach, never really understand it. But the saints have understood it. It is a commonplace that St. Francis of Assisi made much of the sacrament of nature. A biographer relates "the following of St. Francis during his last days. "Meanwhile Francis was suffering greatly. Yet amidst his bodily 227 JOSEPH P. FISHEI~ agonies .be continued to find a~ absorbing sweetness in meditating upon the be.auty of God ifiHis creationl All the.crea'tion seemed to sing of the glory of its Creator to his pain-racked senses: and this is the more wonderful when w~ rememb& ho'~ 'pain is 'apt to turn all sensible comfort into bitterness. One day,' when he was suffering more than u~ual in eyes ~ifid head, he had a great desire to hear the viol. One of the brothers attending him, had been a violist in the world. Francis called for him and said: 'Biother, th~ children of th~ world do not understand divine sacraments: and musical instru-ments, which in former times were set apart for. the praise of God, man's wantonness has converted to the mere delight of the ear. Now I would hav~ you go secretly and borrow a vi01 and bring comfort with some honest melody to Brother Body who is so full of pains.' " Now without entering into controversy about the relationship between nature and art, we can certainly transfer 'much 6f what we have said about nature and God to art and God. Whether you say that art copies nature, perfects or .sublimates nature, or helps one ap-preciate nature, in any case, artistic works ~re finite participations of Infinite Beauty an'd, if appreciated as such, can and should aid one to appreciate this Infinite Beauty. In o{her words, art ~can help one use creatures for "contemplation." A man who is impressed by finite beauty can thereby be better prepared to appreciate the Source of all beauty. One may, for instance, never have realized how a cloud re-flects God's beauty Until he has read and appreciated Shelley's poem, ."The Cloud." Pleasure, though an end in its own o~der, may, if handled prop-erly, be a means of drawing closer to God. A certain puritanical bent of mind prevents many from appreciating this fact. This is not to deny that one can practice virtue" by foregoing the enjoyment of l~gitimate pleasure. It is often said that such abstinence from legiti-mate pleasure strengthens the will so,that it wili be strong in temp-tation. There is certainly much truth in this statement, but it is well to rememberthat motivation rather than exercise is the best means of strengthening the will. However, it is clear that a religious would scarcely be imitating Christ very seriously if he endeavored to fill life with every legitimate pleasure. Christ being rich became poor for us. All who are in the way of the love of Christ know that they can manifest and add to their love by sacrifice. Even here it is well to remember that' ChriSt made use of at least some.pleasures of Ills, ¯ such as the enjoyment of friendship and of.natur~al beauty. And 228 September, 19~ 3 PLEASURE AND ASCETICAL LIFE theology will not allow us to forget the fact that all His life Christ enjoyed the Beatific Vision, even though it is true at least at times the proper effects were divinely withheld. As to whether Christ enjoyed the beauty of human art, we do not have much evidence. If he did not, it would seem that was Simply due to circumstances; cer-tainly the enjoyment of finite beauty is a very worthy human ex-perience, and Christ was a complete man. God it is who has given the artistic urge and God it is Who has created the arts in which man "imitates" the Creator. The artist, even though unconsciously, casts an illuminating light on some facet of a created good, and aids us to appreciate more fully, the beauty .of God's handiwork. Of course Christ did not need this aid, but there were many things Christ did not need that He made His own to be like us and give us an example. The question as to how far an individual religious ought togo in the renouncemen(' of even legitimate pleasure is a very personal question. Even one who wishes to go far in this regard ought to understand the truth of the matter, so that he knows to what he is bound and where he begins to practice supererogation. It is likewise well to remember that what may be or appear objectively best is not always subjectively so. An individual's nature, vocation, training, ¯ and the grace of God must always be considered in settling such questions. What is good for one may be bad for another. A novice in the spiritual life cannot do what a tried religious can do; an active religious cannot do what a contemplative can. It dbes seem that most active religious, at least in the early years of their religious life, may well use pleasure, the higher pleasur.es and even moderate sensible pleasures, to help them rise to the knowledge and love of their Cre-ator. In doing this they should not feel that they are turning their backs on Christ, for as they 'get to know His "mind" better and begin to love Him more, they will spontaneously and with peace.and equanimity begin to give themselves to what St. Ignatius styles the Third Degree of Humility, the imitation of Christ in s~ffering and humiliations through love. Certain young religious seem to think that what is really the strong meat of the mystic way is already for them early in their reli-gious lives, for they try to get to God without the use of creatures. Cardinal Bellarinine points them the way quite clearly: "But we mortal men (as it seemeth) can find no other ladder whereby to ascend unto God, but by the works of God. For those who by the singular gift of God have (by another way) been admitted into 2.29 ~JoSEPH P. FISHER Paradise to hear God's secrets, which it is not lawful for a man to speak, and are not said to have a'scended, 13ut to have been wrapt.". At death some religious who have been striving to fly without wings will agree v~itb this statement of Father Martindale: "But may not one of the great 'difficulties' of dying be this--not that yo~u. have worshipped idols--loved created things ~oo much--but that you have not loved them nearly enough? What suddenly appals one is,' that God surrc~unded one with a myriad things of unbeliev-able beauty--like butterflies, or the sea, or uneducated p, eople--and that one has allowed them to slip by almost unnoticed." Certainly one reason many do not get more out of life is that they fail to make Christlike use of one of God's good creatures-- pleasure. "For all things are yours, whether Paul, or Apollos, or Cephas; or the world, or life, or death; or things present, or things to cg.me--all are yours, and you are Christ's, and Christ is God's" (I Cor. 3/22:23). OU R CONTRIBUTORS ¯ "JOSEPH P. FISHER is master of novices at the Jesuit novitiate, Florissant, Mo." WILLIAM H. GREMLEY is Executive Secretary for the. Commission on Human Rela-tions, Kansas City, Mo. SISTER M. AGNESINE is nationally known as an expert on methods of teaching religion. JOSEPH F. GALLEN is professor of canon law at Woodstock Coll~ge, Woodstock, Md. C. A. HERBST is on the faculty of the Jesuit juniorate .at Florissant, Mo. ABOUT BOOKS It will be noticed that in this number of the REVIEW; book reviews, book. notices, and book announcements are conspicuous by their absence. The' reason for this is that the varied summer assignments of the editors made it impossible to do the ol~ice work necessary for organizing reviews, notices, etc. The deficiency will be remedied in the November number. 230 Some Developments in Intergroup Relations William H. Gremley IT IS almost anti-climactic these, days to dwell at length on the importance of social and political problems in America occasioned by intergroup relationships. The volume of press stories and magazine articles on the subject,, such as Supreme Court decisions, legislative action of one kind or another or "incidents," either posi-tive or negative in nature, increases daily and 'has come to be almost routine. Scarcely a Week passes without some high official, go+tern-ment or civic, making a major address regarding the international aspects of this issue. That it may be one of the most important topics of our day can-not be denied since, in degree, it permeates almost all other major nation~il concerns, yet, like all social or political issues, it must have proper perspective to be abso'rbed and understood. Unfortunately, the drama and emotion inherent in the problem is a barrier to this perspective. All ioo often the negative--the headlines on race-riots, the grim warnings that we are losing overseas allies, the economic loss from discrimination--dominates the over-all picture with scant emphasis on the positive. And, all too often, the positive is usu~illy limited to gome assertion that "ihe Negro has come a long way since slavery." A brief analysis of some developments in intergroup relations over the past ten years will disclose some positive aspects of far more importance and profundity than the latter remark. The objectives of this article will be to present some analysis of those developments, primarily as they relate to daily situations familiar to most readers. and to attempt a balance of both fiegative and pgsitive aspects so as to present a proper over-all perspecttive. " I Initially, some definitions may be of value as follows: t) The terminology of the problem has, in the past, often been misunderstood. To call it a "Negro problem" is a. misnomer for, in actuality, there is no such thing as a. N, eoro problem in the. United ~tates--nor,.for that matter, a ,Jewish, Mexi.c.o.n, or Puerto Rican .231 X~qlLLIAM H. GREMLEY Review/:or Religious problem or any other issue involving people of one race, .religion, or national origin. The problem, in. terms of a situation demanding attention or correction, is one involving re[ationsfiips between mem-bers of different groups. It is, thus, more accurate to define it as a Negro-white, Jewisb-Gentilel etc., relationship problem. Nothing in the entire range of group discrimination or prejudice has roots solely in one group. A sub-problem, for example, of employment discrimination against Jews or Negroes is dynamically related to the fears, myths, and prejudices of the white Gentile em-ployer. Moreover,. defining the issue as a "Negro problem"-implies a detached and overly-objective attitude toward 15,000,000 people that is quite unrelated to the facts of group discrimination. 2) The term, "intergroup relations" is replacing, in g~neral, such terms as "race-relations" or "human relations." The word "intergroup" obviously pinpoints the is~sue far more than either a phrase excluding religious or nationality conflicts or one embracing all personal relationships, both "inter" a'nd "intra." 3) "Minority groups," as a phrase, is confined solely to a group that, because of some facet of assumed ~roup identity--skin color, religion, language, or group, custom--suffers social, economic, or political discrimination against it. Actually, however, i'minority group" is divisive in itself since it segments people from others and should be used with caution and clarity. 4) " The phrase "civil rights" is distinct from "civil liberties" in that the latter refers to the political or quasi-political freedoms guar-anteed to all by Constitutional safeguards. These would include freedom of speech, press, assembly, religion, or right to petition or bear arms. On the other hand, "civil rights" ~ire much rffore social in nature, referring to rights involving places of piablic accommoda-tion, public or privately owned, employment, housing, health and welfare facilities, recreation or education. Somewhere in between the two terms would come rights concerning voting and police pro-tection. II. Perhaps tb~ most important single,development in intergroup relations in the last decade has been th~ establishment of official city agencies to deal with urban problems of this type. Known, for the most part, as "commissions" or "councils" followed by the words "on civic unity," "community relations," or "human relations," they represent a significant phase in the over-all advancement toward September, 1953 INTERGROUP RELATIONS solutions of these problems. In essence,, such, city agencies mean a full realization of and acknowledgement by city authorities that in-tergroup relationships in the diverse populations making up most of America's urban areas can no longer be left to chance or haphazard methods. Just as in decades past, public health, transportation, wa-ter supply, street maintenance, and a host of other various civic con-cerns have been progressively added to the functions of American city government, so too the concerns of intergroup violence, dis-crimination, and individual civil rights are now the official tax- " supported duties of more than 60 American cities. The origins of such city agendes, most of which are goyerned by city ordinance, date from the Detroit race riots of 1943. Shortly after that catast~rophe, a group of Chicago citizens, headed by the late Edwin Embree, then head of the Rosenwald Fund, persuaded the late Mayor Edward Kelly to establish the first such agency. In time, other cities followed suit ~nd today the list includes such arras as Detroit, Milwaukee, Cleveland, Buffalo, Toledo, Kansas City (Mo.), St. Louis, Cincinnati, Pittsburgh, Denver. Seattle, and scores of others. In addition, many cities, both North and South. lacking a tax-supported agency, have privately supported groups working to-ward similar ends. Basically, these agencies, composed, for the most part, of mayoral appointees serving without salary but with a paid professional staff, have three aims: 1) To prevent or lessen intergroup violence~ u~hether of the col-lective mob type or as an isolated action (i.e., a bombing or an indi-vidual attack). The most singular success in this regard has taken place in Chicago where the police force, after utilizing the guidance and resources of the Chicago Commission on Human Relations, has achieved a high degree of efficiency in the prevention of intergroup mob violence. (The Cicero riot of 1951 is a case in point. So strict and effective were police measures taken to prevent a "spilling"'over Of ¯ this affair into Chicago that, while law and order broke down com-pletely in Cicero--adjacent to Chicago-the prevalent tensions in the latter city were kept completely in check.) 2) To d~oelop harmonious relationships bettveen all groups And eliminate the causes of group friction and. prejudice. In this regard, such~ city~ag.encies have,available.,a vast.amount of resource material built up over the last ten years. The material available to schools of 233 WILLIAM H. GREMLEY Review for Religious all type~ and a~ all levels will illustrate. Audio-visual aids, teacher training workshops, and curriculum and school-community relation-ship material are some of the areas where resources may be obtained. In addition, ~xtensive tl~eoretical and practical research has been ac-complisbed regarding such problem areas a~ community organization, employment, housing, health, welfare, recreatiom and civil rights. 3) To safeguard and protect the ci~)il rights" of all groups. A greater divergence among such agencies is found in this objective th~an in the other two for an obvious reason~ The degree of civil rights legally accorded to citizens, for the most part, depends on the local or state laws on the subject. Many states, like New York and Rhode Island, have effective Fair Employment PracticeLaws. In addition, New York has a Fair Education Practice Law that prohibits school "quotas" based on group differences. Conversely the s~gregation laws of the South deny civil rights to manycitizens. Thus an inter-group city agericy relies on laws if they exist and persuasion to pro-tect such rights. In "border" states like Missouri, the agency must depend on persuasion alone to accomplish this objective. In general, the types of intergroup probiems faced by a city agency will depend on the population make-up of the city itself. In cities like Chicago, Detroit, and Kansas City, perhaps 90% of such problems spring from Negro-white relationships. New York City with a Puerto-Rican population of.some 500,000 must consider this particular problem along with Negro-white and Jewish-Gentile con-cerns. West Coast cities with people of Japanese descent comprising large .segments of the Ipopulation, Texas urban areas containing sig-nificant percentages of Mexican-Americans, and Rocky-Mountain or North Mid-West states with American Indian reservations, all have different kinds of problem areas sometim_es calling for different kinds of treatment techniques or materi~ils. III An inevitableconsequehce or ,concomitant.of the growth of both" intergroup city agencies and the extensive resource material men-tioned has beeh the development of the 'intergroup relations "pro-fessioni" For the most part, the usual frame ofreference associated with any profession--research material, academic courses and,degrees, job personnel standards, establishment of a national organization (in this case the National Association of Intergroup Relations,Offi-cials)--- characterize intergroup, relations. Over and above these cri- 234 Sgptember, 1953 teria, however, certain premises exist regarding this'field Which have strong foundation~ not only in law where the c'ase may be but, in all cases, in democratic and religious principles as well. -It may be un-necessars; to ~dd that such principles are wholly consonant with those of the two major religious traditions in America. Both Judaic and Christian concepts of individual dignity, of course, are clear and defined. Man is an individual with God-given rights as well as .God-given responsibilities. In addition, it is inher-ent in his nature to mingle and commune.with his fellowmen. Both singly and collectively, he has rights and responsibilities to others and to himself in'a social sense. It ,is thus essential to th~ nature and work of these city agencies that the premise of natural rights for all should underscore and per-meate their functions and programs. The assumption that the hu-man family is one under God, that variations between peoples of genes or customs do not detract from this assumption., and that, in keeping with this "oneness" under God, all are equally entitled, to basic rights, are fundamental four~ations for inte, rgroup wozk' not only of.the "official" city agency type but in the private an'd volun-teer area as well. Some exa.mples may help, to illustrate these concepts. Labor 1) The dignity of labor, exalted by Christ and sustained by the Popes through encyclicals, certainly means the right to fully utilize one's skills. Yet the record ~f denial ofthis righ[ by r~fusals to hire or to upgrade extends back to the mid~lle 19th Century when (and continuing almost to the 20th Century) such denial to Irish Cath-olics was illustrated by factory signs--"Help Wanted--No Irish Need Apply." Tod~y, through cultural assimilation, neither the Irish immigrant nor those of Irish descent suffer this indignity. In their place, the Negro or those of Jewish. faith.are the major victims of job discrimination. It may be said that, to some extent, every racial, religious, or nationality group whether indigenous or not to America has suffered this type of injustice. Recent advances, however, in this problem 'area give hope for the future. The numerous state and city FEPC laws, the changing atti-tude of many industries, aware of the great economic loss in wasted skills, the strong stand of the American Catholic hierarchy as well as other religious bodies against job discriminatioh--all developments INTERGROUP RELATIONS 235 WILLIAM H. GRE/vlLEY Review/:or ReligiOus for the most part of just the "past decade--indicate .a point in time when this problem will no longer be major. Health 2) Perhaps no area of life involves more compassion or human feelings than suffering brought about by sickness or accident, and in this area, perhaps above all others, divine precepts of mercy and brotherly .love should prevail. Yet, this compassion is, strangely lacking in many American cities when hospital facilities for Negroes are considered. Segregation, even in many Northern cities is the rule despite worthy exceptions and it would be impossible to estimate the amount of loss of life or unnecessary pain caused by refusals of hos-pitals to admit Negro patients. 'For example, in the Kansas City area recently, a young Negro woman, injured in an auto accident, was refused admittance to or hastily transferred from four different hospitals because of her color. Eventually taken to her home, she died shortly after. Competent medical authorities definitely asserted that, with prompt and adequate attention, she might well have survived. ' Adding to this problem is the inability of qualified minority-groups doctors, nurses, and medical technicians to obtain staff ap-pointments to hospitals practicing discrimination. Thus the ,hos-pital rationalizes--"We have no Negro doctors so we don't have Negro patients." In this aria as well as employment, however, encouraging prog-ress has been made in ~ecent years. Laws in many states have been .passed prohibiting hospitals from refusing emergency patients Because of race, color, creed, or national origin. Many single hospitals in ~ities like Chicago, New York, Kansas City, and others have taken the initiative in eliminating color bars and given Negro or Jewish doctors and nurses staff appointments. The number of Negro medi-cal students in formerly all-white attended schools is on the increase, and Negro graduates are finding it easier to obtain interr;ships, par-ticularly in municipal hospitals. Education 3) In the, field of education as well, divine concepts of justice and decency to all mankind are just as strong as the above, but school segregation, with its foolish emphasis on the "separate but'~qual" tbegry, at a time when equal facilitiesAor .minority grqups i.s .p.hy.~si.-~ cally and economically t;nfeasible, continues as a burning, national 236 September, 1953 INTERGROUP RELATIONS issue. The waste, not only in dollars but in imperfect or thwarted personal development because of these barriers amohg children is in-calculable. To fully equalize, for example, the separate public schools of the State of Missouri alone wduld cost $20,000,000 according to a re-cent surveyl--without counting the cost of continuing extra trans-portation for Negro pupils. 'On the other hand, it was estimated that approximately $.1,150.000 a year of tax-monies could be saved by integrating the Missouri public school system. It is in the field of education, however, that the record of ad-vancement in the last decade is brightest. U.S. Supreme Court deci-sions have opened ~graduate schools in the South to all applicants. (Those in the North, for the most part, have been integrated sinc'e the 19th Century.) The forthcoming Supreme Court decision on public school segregati.on may well mean thd eventual end of this-anomaly on American democracy. The record of Catholic school authorities in school segregation matters is most significant. In community after community, in-cluding' Kansas City and St. Louis and even in Deep South areas where school segregation was deep-rooted custom, boId and cou-rageous action by diocesan' or arch-diocesan officials have integrated Catholic schools at all l~vels. Jesuit colleges and high schools, in particular, have a record of many "firsts'" in this respect, welcoming all stu~tents in communities otherwise strongly segregated. " IV Despite the. admirable record of Catholic schools in eliminating school segregation, many serious problems still remain to be faced. Perhaps chief among these is that regarding the efficacy of teachers as well as curriculum material in instilling sound intergroup attitudes among pupils. Chiefly. because of existing residential segregation of minority groups in most American cities, the elimination of segregation in Catholic schools where ~t has been.accomplished does not always mean extensive integration. As a rule, a school attended wholly by white pupils remained white-attended With the reverse true for schools Wholly attended by Negroes or children of Mexican descent. It has been usually in the "fringe" areas--where the population was 1"The Cost of Segregated Schools"--Study by Stuart A. Queen, Washi~gtoa Uni-. versity. Available from Missouri Association for Social Welfare, 113 ~ West High Street, Jefferson City, Missouri. " " 237 WILLIAM H. GREMLEY mixed racially or ethnically--that significant integration of different groups took place. Such "fringe" schools are usually in a minority compared to the total number in any given urban community. Ex-ceptions should be made with reference to any isolated Negro-occupied areas outside .the main such area in an urban center. Even in those cases, however, usually not more than a handful of new Negro pupils were registered after the integration order. This residential segregation has, in some areas where the popu-lation is predominantly Catholic, stimulated several situations of racial violence in which the role of the Catholic school has severely been called into question. Following the Cicero anti-Negro riot of 1951, which occurred in a community estimated to be 65 % Cath-olic, the writer interviewed an official of a local Catholic ~chool. In response to questions concerning the use of curriculum material pro-moting positive intergroup attitudes, it" was indicated, that the teaching of such attitudes was confined to the history classes. Worthy as such teaching may be, it was hardly sufficient to relate present-day intergroup problems to the pupils. Since many of the youthful par-ticipants in that affair were observed wearing Catholic insignia of some type, such limitations were not effective as a deterrent to vio-lence. The Peoria Street violehce of 1949 in Chicago, in which extreme ¯ anti-Semitism as well as anti-Negro prejudice took the form of severe assaults and beatings on bystanders allegedly "3ewish-looking," oc-curred in an area estimated to be 90% Catholic. Teen-agers in both incidents played a predominant role in the violence. It is true, of course, that such incidents of racial and religious violence are by no means confined to areas predominantly or heavily Catholic in population. Numerous other disturbances equally or even more severe than those cited have occurred in urban localities pr(~dominantly non-Catholic. The immediate concern, however, is with the role of the local Catholic school, in social situations involv-ing pre.judice and intergroup violence and in localities where ~ignifi-cant portions of the population¯ are of the Catholic faith. Something Lacking? The percentage figures and role of teenagers in the above two af-fairs pose an important question--what was lacking in the teaching techniques of the local Catholic school that could have prevented such expressions of violence and prejudice at least by participants who 238 September, 1955 INTERGROUP RELATIONS may have been Catholic? That something was--perhaps is-- lacking is obvious. While it may be that such a lack is due to com-munity pressures and mores hostile toward p~ople of different color or religion, it is possible that lack of awareness by teachers of the problem coupled with teaching materials that possibly create disre-spect and prejudice for different groups, may also account for this deficiency. For example, in one type of reader used in Catholic ele-mentary schools, the following quotation is f6und: (The reference is to the American Indian.) "Hello, Mother," cried Tom, as he ran into the apartment house where he lived. On the table in the kitchen Tom saw a large white cake. 'Tm glad that I'm an American boy tonight," he said. "Indians never had cake for supper, did they. Mother?" "I'm afraid not, Tom," answered his mother. "They didn't wash their faces before supper, either, but American boys do that.''2 Apart from the "1o, the poor Indian" attitude implied, it is manifestly unfair to deprive tbe native American of his nationality. The matter of bodily cleanliness, of course, varied in custom among the numerous Indian tribes. It is hardly possible that- respect and dignity for the American Indian as an individual created by God could be implanted in children's minds from this passage. On the other hand, an example of the type of curriculum material that can advance positive attitudes in a realistic social situation sense is found in another reader containing the story, "Toward a Promised Land.''3 Dealin~ with effort~, based on race prejudice; to oust a competent Negro doctor from a hospital, the tale. resolves the situa-tion satisfactorily from both a moral and practical viewpoint. The efforts fail, the ~doctor is retained, and his little son sees another ad-vance toward "a promised land." Both examples above perhaps will illustrate the social impor-tance of developing proper intergroup attitudes among children, ad-mittedly often a difficult task in the face of possible parental prejudice and objections. This social importance, however, is far overshadowed by the spiritual importance. To permit or ignore the development in children of prejudiced attitudes, unchecked or not counteracted in 2"This is Our Town," Faith ~ Freedom Series, Book 3, by Sr. M. Marguerite, 'Ginn E4 Company, 1952, p. 46~ 3"These Are Our Horizons," Faith ~3 Freedom Series, Book 7, by Sr. M. Charlotte, and Mary Syron, LL.D. Ginn E4 Company, 1945, p. 136. 239 WILLIAM H. GREMLEY Review for Religious the school, may be almost as much a negation of. ~hrist'~ ~eaching.as the actual encouragement of group prejudice or bigotry. The re-sponsibility, ofcourse, is no less in the home than in.the school, but in the Catholic school the duty to ~each the'ethics of the brotherhood of man unde~ the Fatherhood of God seems of particular concern. The concern is that of Christ. In her excellent study4 on attitudes towards Jews~ by .Catholic school children, Sr. Mary Jeanine Gruesser states: "Interest in the social attitudes of Catholic children is bound up with Catholic belief and practice. Today the. tremendous~octrine of the Mystical Body of Christ is being .preached and taught with new stress and emphasis. In language that he can understand, the youngest Catholic school child is learning to live the fact that all are members, one of another, in Christ. But the teacher who is really concerned that the child take this lesson away from the classroom and back to his play group in the neighborhood, rnus~ know some-thing about the situations and conditions of intergroup interaction of which the child is.a part, of the attitudes toward other people, other religious and nationality groups, that be has already formed. These are the realities to which the doctrine' must be applied, but the two must be related t:or th~ child." Having stated and, it is hoped, adequately illustrated the prob-lem, some positive resources may be listed that may be of value. Available Resources 1) As indicated, a local city intergroup agency can be of as-sistance in suggesting acceptable audio-visual and curriculum ma-terial designed to counteract prejudice and develop healthy and wholesome attitudes in children regarding people of different groups. ~2) Private agencies such as local community relations bureaus,. some school or teacher associations or local offices of the National, Conference of Christians and Jews also have resources ~eadily avail-able for this purpose. 3) Teacher workshop~ in intergroup r61ations are now available each summer in practically every section of the country. For tb~ most part, these workshops are given at local universities and colleges. A lis[ of them may be secured from the office of the National Associa- 4"Categorical Valuations of Jews Among Catholic Parochial School Children," St. Mary Jeanine Gruesser. Dissertation, Catholic University of America Press, Washington, D. C., 1950, p. 8. 240 September, 1953 INTERGRouP RELATIONS tion of Intergroup Relations Offici'als.s Most of these institutes are secular in nature and sponsorship. They are open to all applicants and usually held during the day. A special workshop designed for Catholic religious teachers has been instituted in the Shell School 6f" Social Studies in Chicago. 4) Competent rating scales for determining children's attitudes toward members of other groups are available. Examples are the "Wrightstone Scale of Civic Beliefs," the "Bogardus Social Distance Scale," and the "Grice Scale for.Measuring Attitudes Toward Races and Nationalities." (The latter is available in Sr. 3eanine's study.) As initial steps, such s~ales are extremely valuable in determining an inventory of such .attitudes and measuring the extent of such prob-lems existing in any school. V In conclusion, the international significance of official city agen-cies as resources leading to solutions of group problems of education, employment, health, or welfare facilities is manifest. In essence, they indicatd a "coming of age" for America, a growing realization that America must and can fight its own dilemma on its own grounds. For too long the Communists have pointed a distorted finger of shame at this dilemma in our democracy withoutwas is natural for them--mention of the earnest and valiant efforts made to work 6ut these problems within the framework of our democratic tr'aditions. That we can and will continue to do so, that all group~ and re-ligious bodies, Catholic and 'iaon-Catholic alike, will strive to give substance and body to our great political and religious heritage, is inevitable. Despite the discordancies, whether of violence, discrim-inations, or prejudice, the record of progress in the over-all march of American democracy toward its fulfillment for all, is clear and pro-. found. SNational Association of Intergroup Relations Officials, 565 North Erie Street, Toledo 2, Ohio. "'Opposed to all of these and a billion times rhore powerful is that Love repre-sented by the Sacred pierced Heart of Christ. It is the love for all men, who have equal opportunity tOoshare that tremendous Love, and to return it according as they will, for it has "first loved them and gone down to death for them singly and col-lec/ tively. Such a Lo~,e, even more than the common hand of the Creator unites all men before God. Can men be so callous as to remember race-hatred while kneeling around the Cross of the Crucifie~[ Christ?" '(The Most Rev. Vincent S. Waters, 'Bishop of Raleigh, in his Pastoral Letter of June 12, 1953.) 241 A Year wit:h the Rural Parish Workers [EDITORS' NOTE: The Rural Parish Workers of Christ the King are laywomen de-voted to works oi~ the apostolate in rural areas. Father Edward A. Bruemmer, in whose parish they bare worked for several years, says of them: "[ am convinced that theE are as essential to the welfare of a rural parish as the teaching sisters in the parish school. Perform!ng the corporal and spiritual works" of mercy on a scal~ hitherto undreamed of, they have renovated the face of the earth here." We had planned to give a rather complete sketch of the beginning and growth~ of this work but it is impossible to do that in our present issue. We hope however, to give it later, because we believe it is very important for our readers to know about the va-rious possibilities ot: the lay apostolate. For the present, we content ourselves with printing this informal article written by a Rural Parish Worker who signs herself, Miss Mary. The material in this article can be obtained in brochure form from: The Rural Parish Wokers of Christ the King, Route 1, Box 194, Cadet, Mis-souri.] THE residence and center of the Rural Parish Workers of Christ the King (laywomen dedicated to the service of their neighbors in rural areas) is at Fertile.in the large rural parish of St. ,Joa-chim, Washington County, Missouri'. This is picturesque with its rolling hills, great trees and valleys, but there is evidence of poverty everywhere to mar its beauty. The inhabitanl~s for the most part are a poor, uneducated, generous, loving, and appreciative people. The Rural Parish Workers, cooperating with the pastor, do much to edu-cate, see social justice done, relieve want, spread Catholic Action in the area. I'm spending a year with the Rural Parish Workers, participating in their work and sharing in all their activities. This means sharing in the spiritual life also . . . daily Mass, Prime and Compline or Lauds and Vespers in English, individual recitation ot: the. Rosary, reading and study. This summer when I first arrived, along with two other volun-teers, Miss Pat and Miss Christina, plans for the Open House were already under way. This project is given yearly under the sponsor-ship of a group of men to make new friends for the Parish Workers and spread word of their work. We three pitched right in, helping clean up house and grounds with the neighbors and others who came to help. A week later the big day came. So did 1000 visitors. About the middle of the afternoon Mol~her .Nature came along with the 242 RURAL PARISH WORKERS biggest rain of the season! Many persgns hurried home, but many stayed, so we served food all over the house and on the porches until everyone was happily fed. That night we washed up the biggest gobs of mud and thanked God for a very wonderful day in spite of the rain. Not long after Open House we had a Clothing Giveaway for the needy people. Several times we went on visits in different parts of the parish which is 150 square miles in size. Can you imagine people who live only 50 miles from St. Louis being so isolated as not to see other human beings for weeks at a time? Well, I can state this is the truth. In 3uly a neighbor took us to visit such a family. You can imagine how glad the old couple were to see us. Even though we had been jostled around on the back of a truck (the only way we could get through the woods) and then soaked in a sudden down-pour of rain! Baptisms During another visit a littl~ girl came running across the road. "Could we come over right" away?" A neighbor's new-born baby was dying and the parents wanted Miss LaDonna or Miss Alice to baptize it. So we thankfully watched another child added to God's family in the car of the doctor who was taking the baby to the hos- ¯ pithl. We were present for many weddings in the parish church this summer. But one morning the celebration was for a different reason ¯ . . the baptism of an entire family instructed by Miss LaDonna. We volunteers were happy to witness the event and to take part in 'their joy. Although life with the Parish Workers is anything but routine, there are some things that must be done regularly. Each of us kept her own room neat and clean, and helped with the thorough weekly cleaning. We took turns, two together, in preparing meals and washing the dishes. Each evening one of us volunteers got to milk the goat. This was quite a thrill for us city girls. We volunteers helped Miss Alice with the outside work such as tying up grape vines, wa-tering trees, pulling weeds, raking gravel in the newly-made drive, etc. The Parish Workers' clean-up activities aren't limited t6 their own home, however. One afternoon we all went to watch the completing of the purifi-cation of the spring used by the people of the immediate area. The 243 RURAL PARISH WORKERS Reoieu) for Religious Parish Workers had had the spring cleaned and enclosed in 'concrete with a pipefor'tbe water to run through. This prevents people from dipping their buckets into the .waterand has greatly improved the health of the children in the neighborhood. After an especially b,u~y week we were all preparing for a day of rest when an elderly man came to the door. He bad walked several miles to tell us that his grandson was suffering from a brain tumor and must be rushed to the hospital ira.mediately. Could we get him in? So, this ended our day of rest and sent us on an errand of mercy. Several times this summer Father Bede, O.S.B., spiritual director of the Rural Parish Workers, visited us and gave us many interesting and enlightening talks which broadened our knowledge of the lay ¯ apostolate and helped our spiritual growth. Seven Weeks for doing something you thoroughly enjoy are too short as we three volunteers discovered when the Summer Session came to an end. We all left with heavy hearts. Miss Pat had to re-turn to school. Miss Christina was needed at borne. And I went borne to prepare my winter clothing and tell my family that I in-tended to return in September for a year.of service. Instructions Upon my return [ entered more fuIly into the life of a Parish Worker. Activities began with the start of weekly religious instruc-tions for the public scl~ool children. My class of twenty youngsters is made up of 2nd to 4th graders who have received their First Holy Communion. I find them very attentive and well-behaved with a thirst for knowledge. I had returned to Fertile when the country was most beautiful and the large pears on our tree were ready for picking. I donned a ¯ pair of blue jeans and an old shirt and had the time of my life climbing the tree and shaking down the pears, using the garden rake for the hi~hest branches. Seven bushels of delicious fruit were added to our pantry and shared with our neighbors. In October we entertained the members of the Parish Workers' Advisor~ Board and their wives ata buffet supper. Miss Par'and Miss Christina came to help with this gala affair., We all had so much fun together they were reluctant to leave. But plans were made to get together again when time came for selecting and packing Christmas gifts for.the 250 children in the families we assist during the year. 244 September, 1953 RURAL PARISH WORKERS Travel The distribution and sorting of clothes for these families has been given me as my special project, and I must admit I find it both interesting and helpful. Interesting because of a natural woman's instinct wondering what I will discover in each box I open, for these boxes and packages come to Fertile from all over, sometifnes from as far away as NeW York. And helpful, for in this exploited area wages are very low. Many times we bear of a child out of school bedause of no shoes or other clothing. And for many families the only new baby clothes are those we are able to supply in the layettes generously donated by women and college girls interested in this apostolate I am learning to drive. " If you ask'the Parish Workers how I am doing they ~vill answer, "Wonderfully well." But if.y6u put the question to me ~ am afraid you would receive a different answer. However, I shall keep on-, for often I could help out if I were able to drive the station wagon myself. We travel many miles,each month. Over two thousand is the average now. A number of trips are made to St. Louis, eSl~ecially to clinics and hospitals. One such trip concerned my special ,family. While visiting them one day I noticed the baby looked ill. He was terribly undernourished anyway, and I was truly worried about him. We telephoned a St. Louis hospital and the Sister told us a bed'would be available as soon as we could get.him there. The familywere un-able to pay anything but the baby remained in the hospital seven weeks and is now doing wonderfully. From.time to time I ~ake visits with ~ne of thd Parish Workers. One morning it was necessary to make a trip to the courthouse to see the judge about a f~imily we were helping. I was more than giad to be risked to go along as I would get the opportunity to meet some of the civic officials and learn how,they and the Parish Workers work together to help others. Since I have been here I have learned much about Secularigm and Communism and the inroads tb~y baremade in our country. I am also learning how to detect their prop~an~la in radio programs, newspaper articles, etc. Accompanying Miss LaDonna to the Well-Baby Clinic was al-ways a pleasure., until one day she pulled a fastone and asked the County nurse to give me a typhoid shot. Of course I knew about"it beforehand, but being a city girl I really h~d.~'tthought, much about it., We take pure drinking, water, for gr~inted' in the city, but out here 245 RURAL PARISH WORKERS Review for Religious it's different. All the water is from creel~s and springs like the one the Parish Workers fixed up last summer. The home of the Parish Workers is an old brick house. Major remodeling has made it into a modern home with many conveniences so that they may devote as, much time as possible to their apostolate of serving others. Minor work in the house proceeds slowly, one room at a time, and furniture is supplied by donations. Most of it we repair or repaint, but recently a women's group brought out a complete flew bedroom outfit which the Parish Workers placed in .my room. "Harmonious surroundings help in the development of a Christian home'," they always say. I know for sure they are relaxing at the end of a busy day. The apostolate of the Rural Parish Workers is not well known, although for several years, under the patronage of the Most Reverend Archbishop of St. Louis, they have been quietly working among the poor and downtrodden. So now we send out a monthly memo of recent news to The King's Men, an auxiliary of the Parish Workers. This and other secretarial work enables me to make good use of my typing learned in high school. Christmas There is always activity here at Fertile, but preparations for Christmas are something to behold. First, making of the Advent wreath. Three days before Advent we gathered pine from a large pine forest nearby. I had the pleasure of helping make thewreath, which we hung from the living room ceiling. ¯ With its four candles. magenta-colored ribbons and fresh green l~ine it was a beautiful re-minder of the season of preparation for the great Feast of the Nativ-ity as well as of the long period of waiting for the first "coming .of Christ over 1900 years ago. Decorations in the house were c.hanged to conform with the spirit of the season, and each evening after sup-per, as we lit the candles, one the first week, two the second, and so on, and asked God's help and blessing, we seemed to come closer to the Divine Infant soon to be born again in our hearts on Christmas Day. It was during one of these evenings when all felt in a gay and joyous mood that we selected the °"jewels" for our decorated cross. We finally all agreed on the selection and then could hardly wait for Christmas to hang the beautiful cross with its sparkling stones of red, yellow and blue. Several trips were made to St. Louis and near- 246 September, 1953 RURAL PARISH WORKERS by towns for Christmas shoppi.ng ~and to pick up clothes, canned goods, toys and candy donated by generous friends for "the needy. Also to distribute gifts to our families and friends~ Miss Pat and Miss Christina returned for a week-e.nd to help with the toys, sacramentals, and candy for the children. We were all busily engaged in this task when the Auxiliary Bishop, Most Reverend Charles H. Helrrising, arrived for a short visit with the ¯ Parish Workers. He .gave us his blessing and told us to tell others ot the need for volunteers in this rural apostolate. The following week we packed food for all the needy people of the area. We could gix;e large boxes, due to the generosity of our friends. Gifts and candy were also prepared for our children in the Sunday classes. Several trips were made to the parish church with the station wagon full of people. We live eight miles from church and "many neighbors .would have no way to get to. confession or Holy Mass if it were not for the Parish Workers. Even on the day before Christmas as we worked on the Crib and tree, time was taken so that no one would miss the opportunity to receive Holy Communion on the great feast. As we finished trimming the tree we realized the season of prepa-ration bad ended. Gifts had been hung on the tree ready for the children when they came to visit during Christmas week. They would come with hearts full 6f joyand expectancy to receive their gifts. And we were ready, too . . ." for the greatest Gift of all, ~he Son of God Himself. At Vespers on Christmas Eve the lights from the four candles of the wreath flickered and caught in the jeWels of the decorated cross. A feel!ng of peace and joy filled each of us. Later when we drove with our neighbors to Midnight Mass we could almost hear the Angels singing, "Glory to God in the.highest . . ." And afterwards the gently falling snow seemed to enhance the feeling of peace and love as all exchanged the Merry Christmas greeting. I have written of many things during my first six months with the Rural Parish Workers. There are many more, all pointed to the development of Christian homes, wi~:h interest in government, edu-cation, culture and religious welfarel But you have not the time, ¯ nor I the space to include them here. UPon reading this you may. ti~ink all is Work and no play. But that is not true. Recreation is impor~tar~t in the life of a Parish. Worker. And in the evening you may find us reading, listening to. 247 SISTER M. AGNESINE, Review [or Religious the radio, playing cards, doing hand work according to one's inte~- "ests, and occasionally going to a movie. This summer we even took time out to, go swimming, hiking, picnicking, or for an evening drive. You see, we are just one happy family and all share in one another's joys or" sorrows, working, praying and p, laying together for the glory of God and the service, of.our neighbors. " If I intend becoming a Rural Parish Worker I must spend a pe-riod of reading and instruction, and learning what my duties would be in this area or any area to which I may be sent. Already I have seen the need of the work and the good the Parish Workers are doing. So I say, "God bless them and all their under-takings, and please send more workers for this vineyard." Paging !:he Religion Teacher Sister M. Agnesine, S.S.N.D. " " THE story is told of a prosperous business man who claimed that allMs success was due to a single statement left him as a legacy by his father: "My son, when everything goes wrong with you and ill luck seems to pursue you, then look around and see where you are mismanaging things." Instead of throwing up our hands in despair, as we realize the cryi~ag needs of a world strayed far from its. Maker, suppose that we, too, look around to see whether by any chance we religion teachers might be mismanaging things. Making Religion a Living Reality Granted that we are thoroughly equipped, theologically and in-tellectually, what else is required to assure our success? Let us as-sume that we teach our religion classes regularly and cgnscientiously. We may even boast that our pupils know all the answers. But have we any assurance that they also accept these truths and are prepared to live them? In other words, have we set their hearts on fire with love and motivated their wills with .a strong determination to live their religion intelligently and consistently all th'rough life? Their words alone are not sutticient assurance: neither is their more or less praiseworthy conduct in school. Their religion must be a-living re-ality. It must be~:gme so much a part, of their being that they can- 248 SeptemSer, 1953 PAGING THE RELIGION TEACHER not. lose it without losing life itself. To imbue children with such. a living faith means more than merely teaching Christian Doctrine. It means keeping in mind the fundamental needs of our times and directing pupils to meet these needs according to God's plan. It means, therefore, to help them un~derstand and appreciate God's complete ownership of the world and all it holds, and instilling in them a deep reverence for His au-thority. ,It means helping them to evaluate the things of time in the light of eternity; of making them seeall of life from God's point of view. It means preparing them to meet the problems of life, whether as humble employees, as members of a Christian family, or as leaders of a nation. It means impressing them with a sense of responsibility not only toward God but toward their fellowmen, whom they must recognize as members of the My.stical Body of Christ. It means, finally, giving them a sense of direction, so that they will always and above all things keep clearly in view their eternal destiny. Knou)ing Not Onlg What But Also Hou) to Teach How can the religion teacher,acco, mplisb so tremendous a task? He dare not excuse himself by saying that it is primarily the function of the home to train theyoung for Christian living. For, while he cannot, exempt parents from their duties, the wise teacher will first re-establish Christian ideals in the home through the boys and girls in his classes by teaching them to understand and accept the responsi-bilities of Christian marriage and Christian family life. All of this means more than imparting knowledge. It is not the printed or spoken word alone, no matter bow important in itself, that is necessarily convincing. If the teacher is to gain the desired effect, be must know not only u)bat to teach but how to teach. He must not only inform the pupil's mind but also aim to arouse his emotions to love the faith and to move his will to accept and live it. "Religion is no use" says Father Drinkwater, "until it is accepted and" lived." Teaching b~j Example To teach religion for Christian li~ing, therefore, we must pene-trate the thick shell of modern materialism which surrounds the n~en-tality of even our Catholic pupils. But to be able to do so, we must first of all be living examples of the truths we teach. To the young--. and to the old as well--we are the Church, ~ve are religion, we are 249 SISTER M. AGNESINE Review [or Religious Christ. And unless we outrival in all that is ¯good and true,.in all that is. noble and beautiful in the highest sense Of tl~e ~word, those who, knowingly or otherwise, contrive to shape .the aims, the atti-tudes, and the ideals of the young, we cannot hope to influence them for life. If we.teach that religion must take prec.edence over all other values in life and that therefore the religion lesson is the most imPor-tant of all subjects on the program, then we ourselves ¯will have to put first things first and prove by our regularity and zeal that we mean what we say. Then, too, we will quite naturally do all in our power to make the lesson the most fascinating and interesting sub-ject taught in the school. That means, ir~ the second place, that the teacher must have some knowledge of the techniques of teaching. All too many instructors of religion are still under the impression that all they need to do is to explain the subject ~ind that the child will naturally imbibe what is being said. They do not realize that in spite of a seemingly atten-tive attitude, the pupil is often miles ~way during the religion period : like the boy who, after hearing a long explanation of what it means to be selfish and unselfish, innocently asked the teacher what kind of fish that was. Making the Lesson Purposeful and Effectit)e The following questions may help the teacher to see more clearly whether the proper means are being used to make the lesson effective. Do I know how best to appeal to the child's heart, in language adapted to his age and ability? Do I strive not only to teach the Catechism lesson but more particularly to give children a lasting love and appreciation of those sacred truths? If they are leaving the Cath-olic school or study group shortly after these instructions, am I rea-sonably sure that I have instilled into their hearts the desire to grow in the knowledge and love of their faith, through the grace of the sacraments and also through a desire for further study and readir~g? Do I have a fund of convincing illustrations and stories, prefer-ably out of everyday life, that come close to the experience and un-derstanding of my pupils, so that they will the more' readily retain what I have tried to impress upon. them? Do I giye my students an opportunity to do things for them-selves, to ask questions, and think things througb.? Or do I do all the talking myself and take it for granted that th~ pupils are thinking and learning? 250 SISTER M. AGNESlNE, Review for Religious Do I know how to motivate their wills to action so that th~ knowledge of the truths they have learned will carry over to future years? When I teach the Mass, for example, do my pupils giadually learn to live and apply its beautiful prayers and lessons to themselves, not only for the present but especially for th~ years to come? Do I aim to bridge the gap between the day's seemingly unrelated lesson to tomorrow's realities? The sacrament of matrimony with all its implications is a case in point. How well do I prepare espe-cially those pupils who are about to leave the Catholic school, to ac-cept and appreciate the Church's teachings on the subject, and to lay firm hold on high ideals of Christian family life for future use? Am I familiar with the many teaching aids that are at my dis-posal to make my work more interesting and to help deepen the im-pression? Do I know how to use them to the best advantage? There are charts and pictures, fil~ns and slides in abundance. Can I distin-guish between what is most helpful and what is merely ~ntertaining? Do I realize the importance of making careful preparation for the daily.lesson? To outline my objectives? To divide the subject mat-ter according to its imporian~e and time allotment? To test pupil knowledge and particularly to evaluate my own teaching? reading By wrong, things. Acquiring Skill in Techniques How can the religion teacher acquire a fuller knowledge of those procedures that will best insure success? Here are a few suggestions: By accepting wholeheartedly the~ responsibility to teach ~eligion for living, that is, in a manner that will help those whom he teaches to lead fully integrated Christian lives. By keeping an open mind and realizing that no matter how ex-perienced or learned he may become, there is always room for im-- provement. " By prayerfully and conscientiously preparing the daily lessons and by carefully thinking the subject matter through himself, so that he may present it most effectively. .By keeping in touch with modern methods of teaching, through and lectures, and by observing experts in the field. looking around occasionally, especially when things go to see whether by any chance he might be mismanaging If, then, we are willing to face our problems and to set about en-thusiastically learning how to meet them, we may hope to add our little share in the great work of restoring 'all things in Christ. 251 Prac :ice: ot: !:he I-Ioly . ee Joseph F. Gallen, S.J. ~ T IS both profitable and commendable for religious to study the ~ d0~uments of the Holy See that affec~ their state of life., .This is particularly true at present, when the Sacred Congregation of Religious is exercising a more .positive and directive influence on the lives of religious. This article is devoted prin~ipally to' documents addr,essed to individual religious institutes. These are evidently not a matter of general knowledge but they are of general utility, since they reveal the practice and thee principles of the Holy See. I. ERECTION AND PONTIFICAL. APPROVAL OF CONGREGATIONS 1.Constituti.ons of. a new diocesan congregation. For at least the licit erection of a new diocesan congregation, the local Ordinary must first consult the Sacred ,Congregation of Religious.1 This. con-sultation is to be addressed to the S. C. of the Propagation of the Faith for the .erection of native congregations in missionary countries. Diocesafi constitutions should be compiled in conformity with the Code of Canon Law and the practice of the Holy See as found in the approved constitutions of pontifical congregations. They ate to dif-fer from pontifical constitutions only in the matters proper to dioce- .san congregations. For the attainment of this end the practice of the S. C. of the Propagati~'n of the Faith had already commanded that after the erection of the new congregation: "The Constitutions of the new congregation, in Latin and in the vernacular (at least six copies), must as soon as possible be submitted to this Sacred Congregation so that they may be duly examined, amended, and returned with suit-able remarks to the Ordinary, to be approved by him.''2 The S. C. of Religious now follows the same practice and demands that the local Ordinary present the complete text of the 'constitutions with the con-sultation for the erection of the new diocesan congregation.3 At least one author had previously recommended such a practice to local Or-dinaries.~ The fear, already expressed by some authors, that this oractice 1Can. 492. § 1. 2Bouscaren, II, 158, n. 10. 3Larraona, CpR, XXVIII (1949), 228, nota ). 4Muzzarelli, n. 53. 252 PRACTICE OF THE HOLY SEE will ~ause an excessive similarity in the constitutions of various insti-tutes can be avoided by greater care in the. compil~tion of the spir-itual, as distinct from the canonical, ~rticles of the constitutions. The practice will also preclu,de the opposition that often arises when the ihstitute wishes to become pontifical. This opposition is usually con-cerned" with matters that are thought to be new but which should have been contained in the diocesan constitutions of the congregation, for example,~e system of delegates for the. general chapter and the six-year term~'Bf the superior general. 2. Mbtters to be presented fora decree of praise. A diocesan con-gregat! on ordinarily becomes pontifical by a decree of praise, With which the Holy See practically always now grants an experimental approval of the constitutions for seven years. The conditions neces-sary for pontifical approval are: the congregation by a sufficient test~ of time should have given proof of stability, religious observance, and of spirituai profit in its work; it is sufficient that the congregation number one hundred and fifty ~nembers and.is not necessary that the congregation have houses in more than one diocese. These facts are established primarily from the testimonial letters of the local Ordi-naries. To obtain a decree of praise the following matters are to be sent to the S. C. of Religious: a) A petition for the decree, of praise addressed to the Ron~an Pontiff and signed by the superior general and his or her c~uncillors. b) The testimonial letters of all the local Ordinaries in whose dioceses or territories the congregation has houses. Each local Ordi-nary is to send his letter directly to the S. Congregation. c) The"number of religious and houses. The S. Congregation will be aided in its judgment on the system of delegates for the gen-eral chapter !f the houses are listed in a tabular form that gives sepa-rarely the number of professed of perpetual and temporary vows in each house. d) The name in religion, full name in the world, and a brief biography of the founder or foundress and of the first superior of the congregation. e) The S. Congregation is to be informed of any extraordinary facts, such as visions and the like, .that occurred at the foundation of the congregation or thereafte~ and also of the special devotions and special and. favored religious exercises of the congregation. f) A copy of any special book of prayers in use in the congrega-tion. 253 ,JOSEPH F. GALLEN Review for Religious g) A colored picture of the habit of the professed and of the novices. h) 30 typed copies of the constitutions. These should prefer-ably be in Latin, but French or Italian is admissible. The constitu-tions should have been revised, for the new pontifical status and have been previously examined and approved by the local Ordinary of the motherhouse. They are to conform to the Code of Canon Law and the practice .of FheHoly See, and are to contain the norms and safe-guards necessary for attaining the special end of the c~regation. A recent form letter of the S. Congregati6n appears to demand only two copies of the constitutions, but it is not certain that the former num-ber of thirty is no longer obligatory,s i) Information is to be given as to the number of members who were formerly in other religious institutes. j) An historico-juridical account of the congregation from its beginning. k) A quinquennial report, which may be in the vernacular, for the five years immediately preceding the petition and compiled ac-cording to the questions of the new quinquennial report for pontifical institutes. 'A question that can apply only. to a pontifical institute will obviously not be pertinent. ¯ l) It is to be stated whether there are other religious institutes in the diocese with the same special purpose. m) If the congregation is a third order, an attestation of aggre-gation from the superior general of the first order must accompany the petition. n) The. superior general, with the consent of the local Ordinary of the motherhouse, is to designate a secular or religious priest resident in Rome to act as agent for the matter with the S. Congregation. 3. Miscellaneous details. The expense incurred at Rome for the de:- cree of praise is to be classed as insignificant. The. process can be quite slow. One American congregation mailed the necessary mat-ters to Rome in June, 1950, and received the reply in March, i953. During the pontificate of Pius XII (1939-1952) the decree of praise has been obtained by ninety-two congregations; the highest number in any one year was twelve;" and eight of the congregations listed have their motherbouses in the United States.6 4. Continuance of superiors in ottice. Muzzarelli states that on the scf. Guti,%rez, CpR, XXXIV (1953), 129. 6Cf.Guti~rrez, ibid., 130-138. 254 September, 1953 PRACTICE OF THE HOLY SEE occasion of obtaining pontifical approval .or of a new approbation of the constitutions the general, provincial, and local superiors.remain in office but only for the time for which they had been elected or ap-pointed. At the expiration of this period a new election or appoint-ment is necessary. The ~ame principle is to be applied to general, provincial, and local councillors and officials. Canon la.w regulate.s precisely the duration in office of a local su-perior, who may not have more than two successive full three-year terms in the sam~ house inclusive of the time in office hnder the for-mer and the new constitutions. However, in the case of higher su-periors the Code merely.prescribes that they are to be temporary and leaves the determined legislation on the duration.and re-election or re-appointment to the constitutions. The almost universal practice of the Holy See in approving constitutions now gives the superior gen-eral a term of six years and permits an immediate re-election only for a second ttrm. A mother general who had two full six-year terms expiring after the approval of the new constitutions is fully eligible for a six-year term, and even for immediate re-election on the expira-tion of this term, under the newly approved constitutions. The time spent in office under the former constitutions is not to be computed, since these have now lost all force.7 II. LAW 1, Observance ot: laud. It is evidently the duty of superiors to en-force the exact observance of all the pertinent laws of the Church on religious, the Rule, and the constitutions. Negligence in the observ-ance of inual[dating laws on religious can have most serious conse-quences, and this is especially true of invalidating laws on the novice-. ship and professions. The S. C. of Religious gently admonished the superiors of one institute to be more diligent in the future in com-plying with all the laws on the noviceship and the professions. 2. Exaggerated custom books. Customs are necessary for order, effi-ciency, and reasonable uniformity, but some custom books have been too minute and oppressive. From unofficial reports and summaries this appears to have been the thought at the meeting of superioresses general of pontifical institutes held at Rome in September, 1952. Greater attention is to be given to the spirit of the law, since the law of any institute should be the incarnation of its spirit. Not many prayers, but prayer is what is necessary. Formalism, legalism, and ;Muzzarelli, pp. 206-207. 255 JOSgPH F. GALLEN ' Revietv for Religious externalism are to be avoided. The centering of the religious life in the fulfillment of innumerable details, formalities, and observances should be abandoned. Religious are magnanimgus souls who have sacrificed everything to attain and intensify the love of God, not fussy externalists. III. HABIT OF RELIGIOUS WOMEN 1. Form o~ the "~abit. Pius XII expressed the. general principle on the habit of religious women when he state~l that it should manifest the consecration to Christ, religious simplicity and modesty, and be in conformity with time, place, work, and hygiene.8 This norm does not demand any universal and fundamental change in the traditional habit of religious women. Furthermore, the prin, ciple is not new in the practice of the Holy See. The Normae of 1901 stated that the habit in material, form, arrangement, and color~ should conform to religious dignity, gravity, modesty, and poverty, and that "it should exclude any adornment that was apt to l~rovoke adverse comment or ridicule.9 In its typical constitutions for diocesan missio.nary con-gregations the S. C. of tl~e Propagation of the' Faith enjoined: "The habit is to be simple, accommodated to the usages of the people and the climate and not to European customs.''1° In the Statutes for Ex-tern Sisters the S. C. of Religious cdmmanded that the habit of these sisters was to be suitably adapted to their external work and also to external and local circumstances.1~ Sincere reverence for the religio~s habit does not exclude neces-sary modifications. The more practical doubts that arise about some habits seem to be of the following nature: Is sufficient allowance made in .the habit as a whole for the heat of summer and the cgld of winter? The cove~ing of tl~e head and face often causes a questiQn in the chance observer by its stiffness, closeness, ornateness, the time evi-dently necessary for laundering, the extension of the covering beyond the face, and in a.few cases this part of the habit appears to be pro-vocative of adverse comment. We may be permitted one illustration of these observations. The extension beyond the, face does not con-tribute to safety in driving an au.tomobile, frequently makes conver-sation somewhat unnatural, and ~nust be an obstacle in such cases as working on .a patient with a doctor. This is not the most serious SAAS, 43 (1951), 741; 44 (1952),.825. . 9Normae of 1901, nn. 66-67. ' lONormae pro Constitutionibus" Cong(egationum luris Dioecesani, n. 19. IIStatuta a Sororibus Externis Seruanda, n. 26. 256 September, 1953 PRACTICE OF THE HOLY SEE defect that has b~en noted in some religious habits. The sane and practical principles of the Holy See are clear in themselves. Each habit should be sincerely examined on its conformity with these prin-ciples. 2. White habit. The Holy See has f~equently approved in constitu'- tions an ;irticl~ permitting the use of the white habit to hospital sis-ters and to those for whom such dress is necessitated or counselled by other duties or the climate. This habit is accordingly in use in sev-" eral institutes in the infirmary, kitchen, in teaching home economics, and. in similar duties. We can argue safely from the practic~ of the Holy See that such a use of th~ white habit is permitted in all insti-tutes of religious women. The white habit should be as similar as possibl'e to the ordinary habit within the demands of hospital effi-ciency, which is its primary use. The ordinary habit does not have. to be worn under the white habit. 3. Change in the habit. A change in the habit of a pontifical insti-tute or of a diocesan congregation whose habit had been submitted to the judgment of the Holy See may not be made wit,ho,ut the permis-sion of the Holy See; in other diocesan congregations the permissior{ of all the Ordinaries in whose dioceses the congregation has houses is necessary and sufficient.12 Since the habit ik prescribed by the consti-tutions, a change must also have been previously approved by the general chapter. It can be safely held that only a change in the ex-ternal appearance of the habit demands these formalities. The Nor-mae of 1901 required the permission of the S. Congregation only for a change in the appearance (t:orrna) of the habit,13 and the Holy See approves constitutions that demand the permission of the S. Congre-gation only for a change-in the form or color. These constitutions. permit the mother general with at least the advice of her council to, make other changes in the habit, for example, in the material, and this norm should be followed by all institutes for a change that does hot affect the externa! appearance of the habit. IV. DOWRY AND RENUNCIATION OF PATRIMONY IN CONGREGATIONS l. Dowrg. The dowry'is and always has been proper to institutes of women. An amount larger than the one prescribed may be re-ceived as a dowry. An institute that does not exact a dowry may ~2Can. 495, '§ 2. 13Normae of 1901, n. 70; cf. n. 69. 257 JOSEPH F. GALLEN Reviev2/:or Religious receive a dowry that is f~eely offered as such. A subject may give, comple'te, or augment a dowry during the novic~ship and after first or final simple profession. In all the cases listed above the amount that may be given is unlimited, but any amount accepted as a dowry is subject to the laws on the dowry. ' These statements are accepted canonical doctrine.14 2. Renunciation of patrimong in'a congregation of women. The point here can be more clearly proposed in the form of a case. Sister M. Anita, a professed sister in a congregation, has a patrimony of $50,000. She wishes to give the entire amount to her institute, but can. 583, 1°, forbids her, whether her congregation is pontifical or diocesan, to give away this money during her life without a _dispensa-tion from the Holy See. When asked recently for such a dispensa-tion, the S. Congregation replied that the sister, without any permis-sion. of the Holy See~ could give the money to her institute as a dowry or as an increase in her dowry. If the institute wishes to spend any part of the $50,000, permission of the Holy See will be necessary, because can. 549 forbids the expenditure of the dowry. This per-missio, n will be given if the. institute furnishes satisfactory guarantee of returning the capital sum to the sister in the event of her departure from the institute. The interest on the $50,000 is acquired abso-lutely by the institute, but the capital sum must be restored to Sister M. Anita if she definitively leaves the institute, licitly or illicitly, whether her vows have been dispensed or not,15 This is the prefer-able solution of the case, since it was proposed by the S. Congrega-tion itself. The same solution may be followed in any congregation of reli-gious women for either a professed or a novice. A dowry given during the noviceship passes into the revocable proprietorship of the institute only at first profession and thus is not a violation of can. 568, which invalidates any renunciation or obligation that a novice places on his or her patrimony during the noviceship.16 The institute is the mere depositary of the dowry, without p~oprietorship, use, or usufruct during the postulancy and noviceship. 3. Renunciation of patrimonV in a congregation of men or women. The prohibitior~ of can. 583, 1°, quoted above, applies to all congre-gations of men Or women. However, according to the common in- 14Cf. q. 194 of the Quinquennial Report [or Pontifical Institutes. 1SCan. 551, § I. 16Cf. Larraona, CpR, XIX (1938), nora 17. 258 September, 1953 PRACTICE OF THE HOLY SEE terpretation, this prohibition does not ~xtend to the case in which t'he patrimony is given away, wholly or partially, on the agreement and with secure guarantee that it will be restored if- the religious should leave the institute or be dismissed. Professed religious in congrega-tions of men may thus follow this solution, for example, to give their patrimony to their institute. If this solution is follbwed, no law of the Code obliges the institute to secure the permission of the Holy See for the spending of the money. 4. Partial renunciation of patrimony in a congregation of men or women. Without any permission .of the Holy See, professed reli-gious iri congregations of men or women may with safe pr6bability give away absolutely to anyone even a large part of their patrimony provided the amount retained is sufficient to take care of the support of the religious in the event of departure from the.institute. A patri-mony that is. so small as to be entirely inadequate for such support does not fall under the prohibition of can. 583, 1% and may be given away absolutely to anyone,a7 5. New tendency in povert~l of congregations. There are indications that some wish the poverty arising from the simple vow in congre-gations to be made the same or at least to approach more closely the poverty effected by solemn profession, for example, by permitting the professed of simple perpetual vows in congregations to give away all their patrimony.~8 Only one known concession has thus far been granted by the Holy See in this matter. An institflte of religious women of simple vows obtained the following indult from the Holy See in February, 1951: "With the consent of the Prioress General and of bet Council, and upon a favourable report from the Mother .I_n_st_ructor, the religiou.s __m_a.y.at. tb.e _e.n_~ of .tb_e!_r tert.ianship, that is, about ten years after their first profession in the Institute, and pro-vided they have made perpetual vows, renounce their personal prop-erty present and future in favour of the persons or institutions whom they judge before God to merit their preference." V. ADMISSION OF ASPIRANTS The following articles, found in some constitutions recently ap-proved by the Holy See, will be of interest to other institutes. The candidate is obliged to present a testimonial of her free state, that is, lvCf. Bastien, n. 543, 3; Larraona. CpR, II (1921), 71-76. lSCf. Acta et Documenta Congressus Generalis de Statibus Perfectionis, I, 377,429- 431. 259 3OSEPH'F. GALLEN " Ret~ietu for .Religious ¯ of her freedom from impediments. The testimonial of good character is to ,be obtained from the pastor or another known priest. ,The S. Congregation inserted the following article in one set of' constitu-tions: "The Mother General is to interrogate accuratgly on the mat-ter of health, especially concerning diseases that are classed as heredi-tary, and she is to record in writing the replies of both the aspirant and her.parents or guardians." VI. P0STULANCY Although the practice of the Holy See was said to demand that the time of the postul~ncy be accurately determined in the constitu-tions, thre'e sets of constitutions recently approved for congregations of sisters state this time only indefinitely, that is, "for .at least six months," and "not less than six months." A. congregation 6f sisters, whose postulancy is six months, re-quested and,received from the Holy See an indult for fivel years to prolong the postulancy two and a half months for all. This pro-longation will make it possible to complet~ a full coll~ge year during the postulancy. The Apostolic Delegate possesses the faculty of shortening or prolonging the postulancy prescribed by canon law.19 VII. SECOND YEAR OF NOVICESHIP 1. Dispensation. Canon law commands only one year of novice-ship, but many institutes prescribe a second year by the law of their own constitutions. The Holy See evidently does not wish an insti-tute to make a ~practice of asking dispensations from this second year. One pontifical congregation added the second year only recently, and {he Holy See granted an indult for three yeats to one of its provinces to have only. one year of noviceship. The province was.in extra-ordinary and urge.nt need of personnel. 2. Ernptogment in external" works. On November 3, 1921, the "S. C. of Religious issued an Instruction for all congregations, pon-tifical and diocesan, on the employment of novices in the external works of the institute during the second year of noviceship. " The Holy See inserts the principles of this Instruction in the constitutions of pontifical congregations. They should, therefore, be contained also in'diocesan constitutions, either approved 6riginally or revised after the promulgation of the Instruction.' These princil~!es are: (a) The spiritual formation proper to the noviceship.must be pri- 19Bouscaren, 1948 Supplement, 131. 260 September, 1953 PRACTICE OF THE HOLY SEE mary in the second year, employment in external works secondary. (b) This employment is allowable only if permitted by the consti- . tutions, custom, or usage of the congregation. (c) The only licit motive for such employment is the instruction of the novices, never th,e utility or advantage of the congregaiion. (d) The employment is to be carried out witb.~ruderice and moderation. Novices are never to have the sole charge of any external employment but are to work under the direction and supervision of an experienced and exemMary religious. (e) Novices may not be sent out of the novitiate house for such employment unless this is permitted by the constitutions, custom, or usage and the motive is exceptional, extraordinary, seri-otis, and based solely on ~be requirements of the. novice's t~aining, never on the necessity or advantage of the congregation. (F) All such employments must be given up for the two full months pre-ceding first profession, and this time is to be devoted wholly to svir-itual formation and to preparation for profession in the novitiate house?0 A congregation of sisters stated simply in a quinq.uennial report that i~ employed the second-year novices in external works. The reply of the Holy See contained the statement that the Instruction quoted above was to be observed.21 An unofficial summary of the Roman meeting of superioresses general quotes the Secretary of the S. Congregation, Father Larraona, as having r~asserted the principles of the Instruction. He is also reported as having stated that there are always dangers attendant upon this work outside the novitiate. The motive for a second year of noviceship has b~en the necessity of a deeper spiritual formation in institutes, devoted to a very active life. This motive is verified in practically all modern congre, gations. No one experienced in the training of young religious will deny that two years are too brief a period for a proper spiritual formation. It is not very reasonable to prescribe prudently a second year of novice-ship in law and then imprudently overturn the law in fact. This is the reason why the S. Congregation insists on the fundamental prin-ciple that the second year must be maintained as a year of novicesbip. Employment outside the novitiate house should be even mor~ care-fully avoided. The practical consequence of separation from the master or mistress o'f novices is almost always'the lack of any spir-itual formation proper to a noviceship. A sincere examination of the ~°Bouscaren I, 302-304. ¯ 21Cf. q. 176 of the Quinquenn:,al Ro~ort for Pontifical Institutes. 261 JOSEPH F. (3ALLEN ReOiew for Religio,,s effects of employing the second-yehr novices in external works will lead to a more universal observance of this most important Instruc-tion of the Holy See. VIII. PROFESSION I. Dispensation from longer period of temporary vows. The Code of Canon Law prescribes that a perpetual profession, solemn or simple, is invalid unless preceded by three full years of temporary vows.zz Only the Holy See may wholly or partially abbreviate this triennium in any institute; since the abbreviation would be a dispen-sation from the law of the Roman Pontiff. The same principle and reason are true with regard to permitting perpetual profession before the completion of the twenty-first year.23 Some institutes impose a longer period of temporary vows by the law of tfieir own constitutions. This period is usually five, much more rarely six, years. These added years are required only for the liceity o~ perpetual profession unless the constitutions certainly de~ mand them for validity. The latter is practically never permitted by the Holy See in approving constitutions. The constitutions of one pontifical congregation of brothers state that the prescribed five years of temporary .vows are required for the validity of its simple per-petual profession. ¯ In diocesan congregations the local Ordinary may dispense from the entir~ added duration of temporary vows if it is required only for the liceity of perpetual profession24 and probably also when it is demanded for the validity of the latter,25 since he is the legislator for such congregations.~6 Many canonis~s would very likely demand that the dispensation be secured from the Holy See in the latter case, if we mawr argue from their similar doctrine on a dispensation from the second.year of noviceship. The local Ordinary has no power to dispense in this matter in pontifical congregations. Some authors .permitted the religious superior who admits to perpetual profession to abbreviate briefly the added duration of tem-porary vows, for example, to dispense from three months of a six-year period, but they restricted this faculty to the case. in which the 2ZCan. 572, § 2; 574, § 1. ~Can. 572, § 1, I°;. 573; 574, § 1. z4Cf. Bouscaren, II, 167. 25Cf. Regatillo," Interpretatio et lurisprudentia, 172; Instituti'ones furls Canonici, I, n. 698. Z6Can. 492, § 2: 495, § 2; 80. 262 September, 1953 PRACTICE OF THE HOLY SEE added duration was required only for the liceity of perpetual pro-fession. 27 However, in the constitutions of pontifical congregations recently approved, the S. C. of Religious ,has been adding the clause that the Holy Seealone may dispense wholly or partially from the added duration, even when required only for the liceity of perpetual profession. Therefore, the faculty of abbreviation given to religious superiors in the doctrine of authors quoted above is more probably not true. The better doctrine is that they possess this power only if it is expressly granted to them by a general or. particular principle of their law. Otherwise any dispensation from the added duration in pontifical congregations should be secured from the Holy See .and in diocesan congregations from the local Ordinary. 2. Prolongation of temporary prot:ession beyond six years forbidden. The point here also can be more clearly proposed in a case. Brotl~er Francis Joseph made his temporary profession at the age of seven-teen. His profession extended to the completion of his twenty-first ~'ear. At the latter time and after the brother has spent four years in temporary vows, his higher superior is doubtful of his suitability for perpetual profession. May this superior prolong the temporary vows for another three years? Tlhe source of the difficulty is can. 574, § 2, which states: "The legitimate superior may prolong this period but not beyond a second term of three years . " The more probable interpretation of this canon has been that a pro.longation is illicit if thereby the entire pe-riod of temporary vows exceeds six years. The. contrary opinion was admitted to be probable and safe. One of the arguments for the first opi.nion has been the practice of the Holy See. The S. C. of Religious has constantly admitted a prolongation of only one year when the constitutions prescribed five years of temporary vows and has excluded any prolongation when the constitutions imposed six years of temporary vows. It was con-cluded that the S. Congregation did not wish the period of temporary vows to exceed six years. This argument is strengthened by the cur-rent practice of the S. Congregation, since recently approved consti-tutions contain the explicit statement that the entire period of tem-porary vows may not exceed six years. Furthermore, Larraona states that the 1)emporary profession may never be prolonged beyond six years without violating the Code and affirms that this has been de- 27Cervia, 128; Goyeneche, CpR, IX (1928), 325; Schafer, n. 973. 263 J(~SEPH F. G?~LLEN for Religious tided in plenary sessions of the S. Congregation and in audiences.28 He and Guti~rrez state that this same doctrine is based on a reply of the Code~ Commission, has been the constant in(erpretation and prac-tice of the S. CongrFgation, and conclude that a prolongation beyond six years in any institute demands an indult of the Holy See?9 This conclusion is justified by the arguments, even though the reply of the Code Commission has not been published. The solution of the case given at the beginning of t.bis number is accordingly that the vows of Brother Francis Joseph may be pro-longed for two years but a prolo,ngation beyond the six years de-mands an indult from the Holy See, whether the institute is pontifical or diocesan. 3. Place of first ternporar~lprofession. Can. 574, § 1, commands for liceity that the first temporary profession be made in the novitiate house. The Code prescribes nothing concerning the place of sub'se-quent temporary professions nor of perpetual profession, solemn or . simple. Constitutions frequently explicitly state that these may be made in" any house of the institute. For a proportionate reason, the S. C. of Religious.will grant a dispensation permitting the first temporary profession to be m~ide outside the novitiate house. If a motherhouse is under the authority of the one local superior and consists of a novitiate, juniorate, ter-tianship, and an academy for girls, the first profession may be made in any part of such a motberhous~ without a dispen.sation from the Holy See. The canon does not demand that the first profession be made within the part of the house reserved for or used by the novices but in the novitiate bourse. Th.erefore, a first profession m~ide any- .where in the latter satisfies the prescription of this canon. 4. Private devotional renetoal of vows. Constitutions approved by the Holy See often counsel th~ freqiient private .renewal of vows, especially after the reception of Holy Communion. Such constitu-tions usually add that special indulgences are attached t'o the latter ¯ practice. It is true that an indulgence, of three years is attached to such a renewal after the celebration of Mass or the reception of Holy Communion,3° but it is difficult to see why such a fact should be men-tioned in the constitutions, which are to contain.the more funda-mental laws of the institute. ,- 2SLarraona, CpR, XXVIII (1949), 196, nota 17. ~Larraona-Guti~rrez, ibid., 332~ .nota 42. 3ORaccolta, n. 695. 264 September, 1953 5. Special vows. The Holy~ See manifested from at least 1892 that it would no longer approve special vows in new institutes.31 The -same principle has been reaffirmed on more than one occasion. congregation of sisters, approved by the Holy See before 1850, re-cently asked the S. Congregation of Religious for an authentic inter-pretation of its constitutions on the. existence of a fourth and fifth vow. The S. Congregation in its first reply affirmed the existence of ¯ both vows, since the language of the formula of profession and the history of the matter clearly indicated that these were intended as special vows. The fourth vow was the ser'~ice of the poor, sick, and ignorant. This is especially the 'type of vow'that the Holy See will not ~dmit in new institutes, since it constitutes the special end of the institute, is already an obligation of the constitutions, and is accordingly pri-mary remot~ matter of the vow of obedience. The fifth vow, taken also in temporary profession, was that ofperseverance. A. second reply of the S. Congregation clarified this fifth vow: "The fifth vow of persevering in the same vows is to be understood in the following sense. The obligation of persevering temporarily or perpetually, ac-cording to the mind and practice of this Sacred Congregation, is in-cluded in the temporary or perpetual profession. Accordingly the words of the formula of profession on perseverance are not to be ¯ understood in th~ sense of another vow." The Holy See and authors have also defined the special vow of stability, taken in imitation of the Benedictine vow, as being con-tained in the obligation of perpetual profession,aa The vow of s~a-bility of Benedictine Sisters is defined: "By the vow of stability the Sisters attach themselves to the hbuse of their profession and ufiite themselves with the religious family there existing, and promise never to 'wrest their necks from under the yoke of the Rule.' " It is not impossible to find different and approved definitions of these special vows in theconstitutions of pon.tifical institutes, for example, that of stability. IX. TELEPHONE AND RADIO In a recent approval of the constitutions of a congregation of sis-ters, the H01y See inserted the.article: "The use of the telephone and alBattandier, n. 186¯ 32Normae'of 1901, n. 102¯ 33Bastien, n. 481. 2: Battandier, n. 187. 265 ,JOSEPH F. (3ALLEN ,Review [or Religious radio is to be regulated by the superior." In its reply to the quin-quennial report of the same type of congregation, the Holy See stated: "Listening to the radio in private does not appear becoming; therefore it would be better to forbid it." X. WORKS OF THE INSTITUTE § 1 Teaching Sisters and School~ 1. duniorates. This section on the works of the institute contains the most practical matter of this article. Unless otherwise noted, the articles quoted in this section have been inserted by the Holy See in constitutions approved during the past two or three years. The articles on the juniorate are: "After their profes,sion the Mother General shall assemble the junior professed in houses of formation, where, under the direction of a competent, l~Iistress, they shall attend Catholic schools, if. such exist. They shall be supplied with all m~ans necessary' for the pur-pose and shall apply themselves diligently to the attainment of diplo-mas that will be recognized also civilly." ¯ "During this time of formation it will be profitable to supple-ment the classes with lectures and instructions by learned Catholics, who shall emphasize the relation of teaching with Catholic faith and morals." The question of juniorates was discussed at the meeting o~ the superioresses general in Rome. The value and necessity of juniorates were clearly seen, but their immediate initiation, program, extension, and duration were left. to the individual institutes. The necessity of appointing a special Mistress of Junior Professed, distinct from the local superior, . was stated more categorically. It is to be noted that the article quoted above is far more absolute than the unofficial ,re-ports of the Roman meeting. I doubt that any experienced higher superior of congregatio,ns of brothers or sisters denies the necessity of juniorates for the proper spiritual formation and education of subjects. I personally believe that the necessity of juniorates has passed the point of discussion and opinion; it is now a matter of conviction and urgency. Congrega-tions of brothers and sisters should immediately institute a juniorate. This means that the junior professed will not be applied to the ex-ternal works of the institute until they. have completed their under-graduate studies. Extyerience proves that there is only one way of attaining this supremely important object: the superior general must 266 September, PRACTICE OF THE HOLY rise to his or her strongest moment and command it. Let no one swell the low notes of those who chant mournfully that it cannot be done: whaf has been done can be done. If the argument is proposed that the junior professed should be tested in the external works and life of the institute before perpetual profession, the answer is easy. The institute can study the expediency of increasing, with proper permission, the prescribed period of temporary vows to five or six years. The juniorate for those destined to be nurses will require study and investigation for the attainment of a suitable program. 2. Preparation for perpetual profession. This number and the pre-. ceding apply equally to brotbe~s and sisters destined for works other than teaching. At the Roman meeting of superioresses general the withdrawal of the junior professed from the ordinary life of the in-stitute for one or several months of renovation of spirit and of deeper and more mature spiritual formation before perpetual profession ap-pears to have been authoritatively favored. However, this can scarcely be held as necessary if the institute has an-adequate junior-ate. It will also be very close to the noviceship, since most institutes have only three years of temporary vows. While I do not deny the merit of this suggestion, it seems to me to be far more necessary for institutes of brothers and sisters to study the initiation of such a program several years after perpetual profession, when the religious has spent more years in the ordinary life and works of the institute and is in the age group of thirty to thirty-five. This is the critical age for religious. The vision and heart of spiritual youth have often suffered a slow death from worldliness, selfishness, the gradual e'xclu-sion of mortification, the abandonment of real prayer, and the de-structive, disillusioning, and even embittering example of others. It is. the age that needs spiritual revivification and rejuvenation. If this is not had, the soul can readily grow old with the body and crawl into eternity as enfeebled by mediocrity as the body is by age. A longer period is desirable, but it would be sufficient to devote one full summer to such a renovation. This plan does not exclude the advisability of the renovation before perpetual profession, but the necessity, value, intensity, and duration of such a renovation would depend on the length of the noviceship, the existence of a juniorate, the number of years spent in the active life, and the adop-tion of the later renovation here recommended. 3. Continuation of studies after the junforate. "After they have received their diplomas, it is the duty of the 267 JOSEPH F.'GAIzLEN Rebiew For Religious Sisters t6 advance their k~towledge by unremitting study anal reading of the books that are constantly being published." Th~ sense of this article admits no doubt, but its present observ-ance is more than doubtful; It is safe to assert that the daily average time granted to sisters for preparation for class and advancement is about an hour. If this is sufficient for preparation for class and ad-vancement, it seems equally safe to hold that only a genius may am-bition the life of a sister. ¯ The article is merely a dictate of common sense for instittites de-voted, to teaching. It will never be properly observed unless careful thought is given to such headings¯ as the following: learning is not incompatible with true piety: a solid and inspiring education in the juni0rate; the elimination of interminable vocal prayers in common: the realization tbat some spiritual duties may be made privately; the quick and painless death of the restlesshorarium that finds peace only in the clangor of. the bell; peaceful acquiescence in the fact that study in'one's room or cell is not forbidden by the natural'or canon law:~ sufficient sleep, holidays, and vacations; .a notable lessening of the time given to domestic work; the employment of more lay teachers and more secular help for domestic work; finally and especially; the elimination of the present totally unreasonable overwork. We can aptly add the admonition given by the Holy See in its reply to the quinquennial report of one institute. There are very few institutes of brothers and sisters that cannot profit by. this ~idmoniti6n: "If possible, something should be done to correct the situation whereby the' sisters, exhausted by excessive labor, are apparently exposed to many difficulties and dangers and consequently fail in carrying out, the religious life." An unofficial summary of the Roman meeting ~f superioresses general contains some very pertinent thoughts on this heading. Let us hope that the superiors subscribed .to these thoughts as actualities to be attained and not as 'the dreams of a waning summer. These thoughts are: "Maternai care must be taken of the health of the religious; the work of each must be orderly and moderate; each religious must have time for her exercises of piety." "The schedules must always be reasonable and adapted to the various regions and apostolic ministries today confided to religious." "In their individual houses, the Superiors General will provide for all the Religious the possibility and facility; 'of a Christian life 268 September, 1953 PRACTICE OF: THE HOLY SEE (with the Sacraments, the Word of God, Spiritual Direction, etc.) and of Religious life with the posiibility of carrying out the duties imposed on them by their consecration to God (day~ of Retreat, Spir-itual Exercises, and spiritual practices common to the individual In-stitute) ." "It must be remembered that the a~ostolate is also a science and an art and that the Holy See insists on the elevation of the literary. technical and professional culture of the Religious, on the absolute necessity of degrees required for the exercise of the various profes-sions: on the necessity of aspirin~ to a greater degree of proficiency, never thinking that one's culture is adequate f9r the present need." 4. Progress and annual meeting. "The Congregation is to adopt, the prhisewortby custom of an annual meeting of all the Sister teachers, under the presidency of the Mother General. for a discussion of methods of teaching and of the traditional pedagogy of the Congregation, in order that the schools of the Congregation may not only equal but surpass secular schools." 5. Subjects at~o to be studied. The following article will encourage those who are promoting courses of theology for brothers or sisters. Such a course should be partially completed in the juniorate. "They ar~ to study also dogmatic and moral theology, ecclesiasti-cal history, sociology, liturgy, Gregorian chant, and similar matters. For all of these studies the Sisters are to be" supplied with books for their individual and constant use." 6. Library. The community library, especially in small religious houses, can readily be neglected. If we had the pen and unction of Kempis, we would lament that the food of the modern monk is more abundant than his books. The library should be augmented con-stantly with books appert~aining to the subjects taught in the school and also with newly published spiritual and cultural books. The article of the Holy See On the library is: "Each house shall have a library containing Catholic books on the entire field of pedagogy." 7. Teaching of Christian doctrine. "The Sisters shall not forget that they must be approved by the local Ordinary for the teaching of Christian doctrine." "In explaining Christian doctrine, the Sisters .shall proceed gradually and, as far as possible, they shall aim to instill into the minds ,of their, pupils a thorough knowl~edge of the tt, u_ths of o~faith rather than to have them commit to memory a series of formulas." 269 JOSI~PH F. GALLEN Review For Religious The following articles were inserted' by the Holy See in the con-stitutions of a congregation especially dedicated to the teaching of Christian doctrin~ and approved finally by the Holy See in 1949. "Since the sacred sciences are especially helpful to an' understand-ing of Christian doctrine, the Sisters shall place great emphasis on the .study bf dogmatic, moral, and pastoral theology, eccl~siastical history, and similar subjects. A collection of books on Christian doctrine, especially ~f recent worthwhile publications, is to be ac-cessible to the Sisters and others who devote themselves to the teaching of Christian doctrine." ""It will be very advantageous for the Sisters, with the proper authorization', to publish and distribut~ printed works on Christian doctrine." 8. Some norms of teachin~l. , "The Sisters. shall take care that order and cleanliness are ob-served in the classroom." "They should stu.dy the character and disposition of mind of all their pupils and are to unite a certain gentleness of treatment with strictness, when/he latter is necessary." "The 'inordinate inclinations oi the children are to be corrected gradually, and they are to be aided in the acquisition of good habits by the stimulus of admdnition, opportune advice, and by bringing to light the law Of conscience, which,'as is well known, appears from the earliest years." "Offensive speech~ blows, and intemperate anger are to be avoided in punishments. A moral sense of responsibility for theii actions rather than servile fear is to be inculcated in the minds of the chil-dren." "The Sisters are to refrain absolutely from partiality and prefer-ence in their relations with the children. The deportment and coun-tenance of the.Sisters should manifest an evenness of disposition and kind.heSS united with something of reverence." "" "Experience proves that the fostering of the interior life, which is developed by good actions, faith in God, and self-sacrifice, appears even in young children as the right and safe path along which life is to be guided." "A love of modesty is to be developed in girls with regard to dress, deportment and their conduct with others." 270 " September, 1953 .PRACTICE OF THE HOLY SEE § 2 Sister Nurses arid Hospitals 9. Training and.continued pr6gress. "['he problem of overwork is particularly acute in the case of brothers and sisters applied to hos-pitals. In some religious hospitals a weekly holiday is apparently unknown. The continuation of this practice is unthinkable. Every brother and sister nurse should have at least one day a week that is completely free from hqspital duties, and it would contribute' much to 'their health, quiet of mind, and spirituality to spend as often as possiblea notable part of this weekly holiday awa.y from the hos-pital environment. Overwork will not facilitate the continued study and progress demanded by th~ following article that is inserted in constitutions by .the Holy See: "The Sister nurse must strive to increase her knowledge after she has secured a diploma valid also according to civil law." I0. Medical ethics. "A Sister is to refrain from administering medicines or assisting at Operations that are forbidden by the Church. In cases of doubt she is to consult the Superior." "Especially in extraordinary and important cases where there are at stake .the preservation of a human life, reverence for the human person, and care for the conscience of the patient, even if it is a case of extreme pain and gi.ves rise to such questions as euthanasia and others of similar nature,, the Sister shall be careful to give no help to an ac-tion that is contrary to Catholic principles." 11. Mod~stg¢. The Holy See has been inserting the following article in constitutions for several years past: "In certain cases where the care to be given is Of a particularly delicate nature, the Sisters shall dvail themselves, if possible, of the services of .the secular personnel or of the members of the sick per-son's family; for extraordinary cases the Superior should designate Sisters of proven piety and mature age who are williog to perform such works of chhrity. It is the duty of the General Chapter or Council to enact measures in this regard, to which the Sisters must con form." 12. Education as doctors. The following article, proposed to the Holy See in the genera] revision of the constitutions of two. congrega-tions, was approved by the S. C. of Religibus: "The Sisters assigned to the hospitals must be thoroughly pre-pared for the efficient discharge oftheir duties. There should be some Sisters educated as doctors and qualified for th6 various .departments 271 , C. A. HERBST Review for Religious ¯ of the hospital." Canon law does not forbid clerics or religious to study medicine or surgery. Canons 139, § 2, and 592 forl~id clerics and religious of both sexes to devote themselves avowedly, habitually, and for profit to the practice of medicine or surgery. Religious institutes devoted to nursing have by their approbation as such permission to practice the medicine and slight surgery demanded of nurses. Local Ordinaries in missionary countries may permit their missionaries, priests and re-ligious men or women, to practice medicine and surgery provided they are skilled in these arts, demand no payment, and observe rood-esty intreating the opposite sex. In other countries clerics, brothers, and sisters Who wish to i~ractice medicine or surgery must secure an indult from the Holy See. The article quoted above and approved by the Holy See implicitly grants to the two congregations a dispen-sation from th~ canonical prohibition of the practice of medicine and surgery for those qualified as doctors. Care is always to be taken to secure prbper civil authorization for the practice of these arts. [EDITORS' NOTE: Father Gallen's article will be concluded in November.] Discipline C. A. Herbst, S.J. It"I"HE very first step towards wisdom is the desire for discipline, .,| .and how should a man care for discipline without loving ~t, or love it without heeding its laws, or heed its laws with-out winning immortality, or .win immortality without drawing nearer to God" (Wis. 6:18, 19) ? Who could explain more clear!y or_show more beautifully than the Holy Spirit Himself does the place of discipline in the life of one who really wants to love God? "Order is heaven's first law" the proverb says. ¯ This conformity to law comes from discipline. Discipline in the passive sense is con-trol gained by enforcing obedience or order. There is order even in heaven, where God is supreme and the angels are ministering spirits. Where there is disorder chaos soon appears and it is impossible to at-tain the end of any organized society, which is the common good. The modern "autonomous man" is a law unto himself, a tyrant, an outlaw. Were the order established by discipline removed, "the bounded waters would lift higher than the shores," as Shakespeare says~ ?and make,a sop bf, all this.solid globe.';o ~ Then might, is right, "and the rude son should strike his father dead." Unleashed from 272 September, 1953 DISCIPLINE discipline, power obtained by our modern Hitlers and Stalins whets the appetite for more power. "And appetite, an universal wolf, must make perforce an universal prey, and last eat up himself." (Troilus and Cressida, I, iii.) Discipline corrects. This is its first function: a negative one, surely, but basic and important ever since the beginning when man short-circuited his powers through original sin and "to err is human" became a proverb. It is only too clear that in younger religious fre-quent correction is necessary. It helps to make away with the "old man," and who can put on the "new man" before putting off the old? The ways of the world (and they are gaining mightily with each decade) are not God's ways. In men of good will. which we presume aspirants to the religious life to be, correction should lead to prompt reform, or at least to a prompt attempt at reform. In those. who have already spent some time in religion it should lead not only to prompt but to thorougl~ and lasting reform. ReForm. That is a distasteful word to the worldling but opens up a vast field white for the harvest for the ease-loving religious. And we need not look across the table and plan reform for him. As Father said: "If ever you want to start a reform, start on yourself." "Charity begins at home" is true even in this negative aspect. Reform is the correlative and result of correction, and d'iscipline's first work is to correct. Discipline molds. It forms a religious after thi~ likeness of Christ. It shapes him. A character, a soul, is like clay in the hands of the p.otter. As defects are removed by correction the new man takes form under the interior influence of grace and the external influence of dis-cipline. It is exhilarating to see the young religious grow. That an earnest and fervent religious does grow even those who live with him can see. Those, however, who had known him i'n the world and after a few years see him as a religious are the ones who are really amazed at the change. The religious life is a school of perfection. One ex-pects a school to teach and mold and form and change and enlighten. ¯ .Discipline educates a soul, "leads out" its powers, the mind and the will, and induces them to make the most of the wonderful gifts God has given to each one of His children. Discipline strengthens. It gives one moral and spiritual power to act, live, and carry on enduringly and vigorously. This is conspicu-ous in the athletic world. Those who achieve fame in the field of sports do so because they have acquired physical strength, speed, and" accuracy of sense and muscle through long and severe disciplinary 273 C. A. HEI~BST Review for Religious train!ng. This extended and careful practice, their abstinence from food and luxuries and entertainment, is more rigorous than most re-ligious have to submit to. ."And they for a corruptibl( crown, but we for an incorruptible one." ~ Through discipline we store up resources of moral and spiritual strength whict~ we may draw upon in times of trial and temptation. A well-trained sc~ldier will come through many a difficult'and dang(r- ~ ous battle where an undisciplined one will succumb, as we found out in World War II. Through'discipline one acquires a great power of resistance. Discipline causes a soul to become effective and efficient in the direction~ of spiritual achievement, and to be foiceful in its life and work. A strong soul is ardent and zealous, too, and enthusiastic for, the things of God. Neither is a well-disciplined soul easily injured, subdued, or taken in. He is like a fortress, strong and firm. It is vigorous, healthy~ and tough, like an oak. Discipline makes a soul sturdy and unyielding. In the religious life we consider religious discipline in connection v~ith obedience. From an analysis of the word itself, discipline means teaching, training. "Considered in the authority which governs, re-ligious discipline is the sum total' of the rules with their ~anction. By the rules superiors teach the way which is to be followed; by pen- "ances in ~ase of infraction they bring back those who have strayed and repair the scandal given. Considered in inferiors, discipline is also c~lled regular observance, and is the ,faithful observance of the rules, in which observance all the members of the community unite in holy harmony. So important is religious discipline that it must be con-sidered as morally necessary for the conservation of the order as a whole, for that of.the religious life in a community, and for that of the spiritual life in each individual. According to what has been said, it is easy to see that superiors are under grave obligation to maintain religious discipline in the community; and in this regard, "connivance. on their part can easily become a consideiable sin" (Cotel, Catechism of the Vows, 137- 140.), In this connection we might note Canon 593: "Each and every religious, superiors as well as. subjects, must not only keep faithfully and completely'the vows they have taken, but also lead a life in conformity with the rules and constitutions of their own in-stitute and thus strive ~fter the perfection of their state." The rule of each religi0us.institute urges regular observance on ¯ all Each institute must first and foremost, of course, observe the law 274 ' September, 1953 D~SCIPLINE of the Church for religious. In Canons 594-612 we have mentioned especially the careful observance by all of th~ common llfe with re-gard to food, dress, and furniture; the careful performance of gpir-itual exercises; the wearing of the religious habit;

Issue 33.6 of the Review for Religious, 1974. ; Review 1or Religious is edited by faculty members of the School of Divinity of St. Louis University, the editorial offices being located at 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. It is owned by the Missouri Province Educational Institute; St. Louis, Missouri. Published bimonthly and copy-right (~) 1974 by Review ]or Religious. Composed, printed, and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $1.75. Sub-scription U.S.A. and Canada: $6.00 a year; $I1.00 for two years; other countries, $7.00 a year, $13.00 for two years. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money order payable to Review [or Religious in U.S.A. currency only. Pay no money to persons claiming to represent Review ]or Religious. Change of address requests should include former address. R. F. Smith, S.J. Everett A. Diederich, S.J. Joseph F. Gallen, S.J. Editor Associate Editor Questions and Answers Editor November 1974 Volume 33 Number 6 Renewals, new subscriptions, and changes of address should be sent to Review for Religious; P.O. Box 6070; Duluth, Minnesota 55802. Correspondence with the editor and the associate editor together with manuscripts, books for review, and materials for "Subject Bibliography for Religious" should be sent to Review for Religious; 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. Questions for answering should be sent to Joseph F. Gallen, S.J.; St. Joseph's College; City Avenue at 54th Street; Philadelphia, Pennsylvania 19131. Roman Documents The following three documents have been recently issued by the Pope or by Roman Congregations. ExPuLSION FROM EXEMPT CLERICAL INSTITUTES Experience has shown that many difficulties and harmful delays can result from the judicial process which, in accordance with canons 654-668 of the Code of Canon Law, must be established when there is question of the expulsion of a male religious in perpetual vows, whether solemn or simple, from an exempt religious institute. The heads of such religious institutes have frequently requested a dis-pensation-- already granted to some religious institutes, on an experimental basis in accordance with the motu proprio Ecclesiae sanctae, II, 6--from the obligation of establishing such a process for the expulsion of religious. They have requested that instead they be allowed to adopt the adminis-trative procedure laid down in canons 648-653 for the expulsion of male religious who have taken perpetual vows in non-exempt clerical institutes or lay institutes. That procedure is recognized as being in keeping with the demands of justice, canonical equity, and respect for the person. Having taken everything into account, the members of this Sacred Con-gregation unanimously decided on the following in their plenary session of October 23-25, 1973: When there is question of expelling male religious with solemn vows or simple perpetual vows, the religious orders and exempt clerical congrega-tions referred to in canon 654 are to follow the procedure prescribed in canons 548-653 for the expulsion of male religious with perpetual vows in non-exempt clerical congregations. The undersigned Cardinal Prefect conveyed this decision to the Supreme 1249 1250 / Review for Religious, Volume 33, 1974/6 Pontiff, Paul VI, in an audience on November 16, 1973. He ratified the decision of the plenary session and ordered it to be confirmed and promul-gated. Therefore by means of this decree the Sacred Congregation for Religious and Secular Institutes publishes the decision. The decree comes into force at once, nor does it need a formula o~ execution. It will remain in force until the revised Code of Canon Law shall have been introduced. Notwith-standing anything to the contrary. Given at Rome, March 2, 1974. Arthur Tabera, Pre[ect Augustine Mayer, O.S.B., Secretary MOTU PROPRIO APOSTOLIC LETTER ON MASS STIPENDS It has been a strong tradition in the Church that the faithful, moved by a religious and ecclesial consciousness, should join a kind of self-sacrifice of their own to the Eucharistic sacrifice so as to share in the latter more effectively and should thereby provide for the needs of the Church, above all for the support of the Church's ministers. This practice is in harmony with the spirit of the Lord's words: "The laborer is worthy of his hire" (Lk 10:7) which the Apostle Paul recalls in the First Letter to Timothy (5: 18) and the First Letter to the Corinthians (9:7-14). In this way the faithful associate themselves more closely with Christ who offers Himself as victim, and accordingly they experience more abun-dant effects. Not only has the practice been approved by the Church, it has been fostered, because the Church considers it to be a sign of the union of the baptized person with Christ as well as of the union of the Christians with the priest who performs his ministry for the benefit of the faithful. To keep this understanding intact and to protect it from any possible error, appropriate regulations have been made in the course of the centuries. These have had the purpose that the worship which the faithful freely offer to God should in fact be celebrated with no lessening of observance and generosity. Because of particular circumstances of different periods and human social conditions, however, it sometimes becomes morally impossible --and thus less equitable--to satisfy in their entirety the obligations which have been sought and accepted. In such cases, therefore, the Church is com-pelled by necessity to make a suitable revision of the obligations while trying at the same time to be consistent in this matter and to keep faith with the donors. With the intention that the regulations for Mass stipends--a'matter cer-tainly serious and one demanding great prudence--should be established equitably, by means of a notification from the papal secretariat issued on November 29, 1971, (AAS, 63 [1971], 841), we decreed that all decisions concerning reductions, condonations, and commutations of Mass stipends Roman Documents should be temporarily reserved to us and we suspended, as of February 1, 1972, all faculties, no matter to whom or in what manner they had been granted. Now that the principal purposes of that regulation have been accom-plished, we judge that the time has come to terminate the reservation. In order to place the appropriate governance of this matter on new foundations and to prevent any incorrect interpretations, with reliance on lawful prece-dents of the past, it has seemed best to now abolish any of the earlier faculties which remain. Nevertheless, to satisfy somewhat the needs which our brothers in the episcopate must sometimes consider and in ~,iew of the experience of the use of faculties granted to them in the apostolic letter Pastorale munus (AAS, 56 [1964], 5-12) and De episcoporum muneribus (AAS, 58 [1966], 467-72) issued motu proprio, we think it expedient to grant certain faculties to those who share the pastoral ministry in the Church with us. Therefore, after mature consideration, upon our own initiative and in virtue of the fullness of our apostolic power, we establish and decree the following for the whole Church: I. From July 1, 1974, the above reservation, mentioned in the notifica-tion of the Secretariat of State on November 29, 1971, ceases. From the same day the sacred congregations of the Roman Curia are empowered to resume their competence in this matter, but accommodating its exercise to new, carefully defined regulations imposed upon them separately. Thus petitions which may be concerned with this matter are once again to be presented to those congregations. II. From the same day all faculties previously in effect concerning Mass stipends, however granted or acquired, are completely revoked. Therefore, the faculties of any physical or moral person cease, whether granted by us or our predecessors, including oral concessions, by the Roman Curia, or by any other authority; whether by force of privilege, indult, dispensation, or any other reason, including particular legislation; whether faculties ac-quired .by communication, custom, including particular, centenary, or im-memorial custom, prescription, or any other manner whatever. In view of this revocation, we decree that only the following faculties have force for the future: a) the faculties now conceded to the sacred congregations of the Roman Curia, mentioned in no. I; b) the faculties contained in the apostolic letter Pastorale munus and in the Index o[ Faculties which are regularly granted to local ordinaries and to pontifical legates; c) the new faculties granted to bishops in this apostolic letter, men-tioned below in no. III. III. From July 1, we grant the f~llowing faculties to the same persons 1252 / Review for Religious, l/olume 33, 1974/6 listed in the° apostolic~ letter Pastorale munus, under the same conditions established in that letter: a) the faculty to permit priests who binate or trinate in the diocese to apply the Masses for a stipend, which is to be given to the needs assigned by the diocesan bishop to apply the Masses according to intentions for which a condonation or reduction would otherwise have to be sought. This faculty is not extended to concelebrated Masses of bination treated in the declaration of the Sacred Congregation for Divine Worship, August 7, 1972,, no. 3b (AAS, 64 [1972], 561-3), for which the reception of a stipend under any "title is prohibited; b) the faculty to reduce, by reason of diminished income, the obligation of cathedral or collegiate chapters to apply the daily conventual Mass for benefactors, with the exception of at least one conventual Mass each month; c) the faculty to transfer, for suitable cause, the obligations of Masses to days, churches, or altars different from those stipulated in the foundations. These regulations become effective on the first day of July. We order that everything decreed in this apostolic letter issued motu proprio be effective and ratified, anything to the contrary notwithstanding, including anything requiring very special mention. Given in Rome, at St. Peter's, on the Feast of Corpus Christi, June 13, 1974, the eleventh year of our pontificate. Paul VI VESTMENTS AT MASS Queries have come from many places asking whether it is lawful to celebrate Mass without the sacred vestments or with only the stole worn over the cassock or one's civilian clothes. These queries have been prompted for the most part by practical rea-sons, especially in cases of traveling, pilgrimages, excursions, and camping. But there have also been reasons of another k~nd, such as to fit in better with given surroundings--when, for example, chaplains of a factory cele-brate in overalls or when Mass is celebrated in Scout uniform for young mountain climbers. Hence the question has been submitted: What is the mind of the Sacred Congregation for Divine Worship on this point? The answer, neither difficult nor far to seek, cannot but be in conformity with what is laid down in the norms issued during these years of liturgical renewal. General Principles First of all, there are the General Principles of the Roman Missal. In number 297 it is stated: "The diversity of ministries in the carrying out of sacred worship is manifested externally by the diversity of sacred vestments, Roman Documents / 1253 which should therefore be a sign of the proper office of each minister." In the following number 298 we read: "The vestment common to all ministers of whatever rank is the alb"; and in number 299: "The vestment proper to the celebrating priest, at Mass and in other sacred functions directly con-nected with it, is the chasuble." These regulations, which echo tradition and renew it in particular matters, are in practice the basis of the norms laid down in the other docu-ments which touch upon the subject. For example, the Instruction on Masses for particular groups (no. 11 b) simply refers to the text from the Roman Missal cited above. The same is quoted by the Third Instruction (no. 8 c) which then adds: The abuse of wearing the stole over the monastic habit, the cassock, or civilian dress when concelebrating or celebrating Mass is (ondemned. Nor is it lawful to carry out other sacred functions, such as the imposition of hands during ordinations, or the administration of the sacraments, or the giving of blessings, while wearing only the stole over one's civilian dress. Norm Unchanged From this norm the Sacred Congregation for Divine Worship has never deviated, nor does it intend to do so either in regulations of a general char-acter or in particular indults. And the reason for this is quite simple, as already indicated in the General Principles--the distinction of orders, the decorum of the sacred action, and the clear-cut separation of the sacred from the profane. The community wishes to be respected, and it wishes to perceive also by means of the senses, the meaning of the rites, and to be included in the mystery. Only one extenuation has been introduced to facilitate the use of sacred vestments when traveling and changing from place to place, and that is the use of the chasuble without the alb. This presupposes that it is a full circular chasuble, reaching to the ankles, and with stole worn over it. In this case it is possible to do without the alb. The chasuble may always be of the same color, while the color of the stole will change according to the liturgical color of the day. This sacred vestment, when folded, can easily fit into a small traveling bag. But its use is limited to cases of necessity and it should be authorized upon the request of the Episcopal Conference of the respective country. Its use is regulated by precise norms (see Notitiae, 1973, pp. 96ff.). St. Pius once wrote: "Let beauty attend your prayer!" On that occasion he was referring more particularly to the chant, but it is applicable to the entire setting of the celebratioi~. The sacred vestment is one of the more important elements, and at the same time it emphasizes the sacredness of the celebration. All the ritual elements established by the competent authority should 1254 / Review ]or Religious, l/ohtme 33, 1974/6 be observed and respected so that every communication of the community with God should take place, through its duly qualified ministers, in a halo of dignity and solemnity that transcends the too worldly practices of every-day life. Annibale Bugnini Titular Archbishop of Diocletiana Secretary of the Sacred Congregation for Divine Worship Shared Prayer in Religious Communities Today Leonard Doohan Dr.Leonard Doohan writes from Ingersley Hall; Ingersley Road; Bollington; Mac-clesfield; Cheshire, England. A previous article by Dr. Doohan, "Apostolic Prayer," appeared in the July 1974 issue of Review ]or Religious, pages 785-9. The Spirit-inspired conciliar Church has presented all religious with five basic principles which ought to guide their continued developing growth in the spiritual life. They are: fidelity to the gospel, fidelity to the spirit of the institute to which the religious belongs, participation in the life of the Church, knowledge of the present world, and priority in conversion and in a deepening of the spiritual life. Each of these five spheres of life has focused more and more on the idea, so well developed by the Council (see AG 2,3; LG 9,1; GS 24,1i 32,1), that the person has the greatest possible growth within community. It is here within community, the Council says, that through a common effort in spiritual growth and development, the whole and each of the parts receives increase (see LG 13,3). Possibly, this idea of group growth is one of the great spiritual dimensions of the Council and reflection of postconciliar years. Moreover, no matter how mature individ-uals may be, there is still needed a painful and slow maturing and growth of the group's spiritual life. In any community's self-education to group growth, prayer in its various forms must have primacy. We hear.a great deal today about group discernment, community re-vision of life, assemblies, communication of life, chapters of renewal, forma-tion teams, community meetings, and the like; but if all these are not prayer experiences it is, I feel, really difficult for them to succeed as genuine steps in the development of the spiritual life of any group. All forms of prayer can lead to the development of the community's 1255 1256 / Review [or Religious, Volume 33, 1974/6 spiritual life. The form I would like to consider is that form of group prayer technically known as "shared prayer." Possible Indications of Origins Shared prayer is now a commonly accepted form of prayer and it is quite unusual to find nowadays a reasonably sized group without at least some being in prayer groups or sharing prayer within their own communities. Christians have become increasingly aware that while prayer is the raising of the mind and heart to God, for too long insufficient care has been given to a consideration of the subject of prayer--man. The subject of prayer is a person who is intimately connected with others--they are part of man. He grows and develops with others, because of others, but in prayer he has often tried to be without others and therefore has remained stunted in spiritual growth. I feel that the view of the great St. Teresa is correct that all real spiritual development is paralleled by a growth in prayer, and I think we can see that much of our frustrated effort at group renewal has at least a partial answer in the weakness of growth in group prayer in its many forms. Many rejected shared prayer, or never gave it a chance, because it was just one of the "new things" introduced without real need. Perhaps it is more correct to acknowledge that it is not new but unfortunately has been out of use for too long and as a result we have suffered. In the Acts of the Apostles we see the importance given to group prayer whether in the ideal image of Christian living presented by Luke in Chapter 2 (42), or in the practical'circumstances of daily life--Pentecost, election of Matthias, choice of the seven deacons, mission of Barnabas and Paul. In some cases, undoubtedly, study indicates that the prayer sp6ken of by the author of Acts could be the repetition of psalm-type Jewish prayers or, in other cases, a developing liturgical prayer. However, .in some passages, as the election of Matthias (1, 24-5) and the group prayer after the apostles' release from the Sanhedrin (4, 24f.), we are very definitely dealing with a group gathering where prayer is spontaneously shared. In fact, a reading of the Acts more easily leaves one with the general impression of a spon-taneous prayer-sharing rather than an already newly-structured prayer form or a total, unchanged acceptance of a prior Jewish-structured prayer-form. Moreover, the detailed description by Paul of the Corinthians' prayer meetings (1 Cor cc. 12 and 14) certainly highlights the characteristic of spontaneity in sharing; and, although he feels the need to regulate this, he continually reaffirms its value. The attitude of the early Christians is understandable enough--they were simply imitating Jesus who spontaneously shared His prayer with His disciples. In Jesus' case, it is true that some of His prayers are repetitions of Jewish prayer forms and in other cases are prayers put into His mouth by the evangelists. However, even when these clear cases are excluded, the Shared Prayer in Religious Communities Today / 1257 general picture left is still one in which Jesus, when praying to His Father, allows others to share in these filial expressions of His faith, hope, and love. It was in a general context of group sharing on a revision of apostolic life that Jesus burst into spontaneous prayer: "I bless you, Father, Lord of heaven and earth, for hiding these things from the learned and the clever, and revealing them to mere children" (Lk 10:21). The spontaneity of sharing JPY in apostolic success is praised by Jesus who, by example, goes on to show His valuing of spontaneity in prayer expression. In a brief article it is not possible to go into too many details. I would, therefore, just like to express the personal view that, in reading the early Christian fathers and ascetics of the first centuries, I was very definitely left with the impression of considerable spontaneous group spiritual sharing. Purpose of Shared Prayer The aim of shared prayer, like all prayer, is to g!ve glory to God by our thanksgiving, praise, sorrow, adoration or recognition of our total de-pendence on Him. In shared prayer we give glory to God with one mind and heart and in one shared expression. In some ways this form is possibly more ecclesial---it is more visibly shown that it is the one Spirit in each giving life to the whole body of the faithful. It think it is important to keep this aim clearly in mind and never to approach shared prayer merely as a means of bringing a group together. Moreover, when the aim is clear this undoubtedly modifies the way in which we approach the shared prayer--when convinced that the aim is to give glory to God we will more easily direct our prayers to our Father rather than drop to personal reflections for the benefit of the group. Effects of Shared Prayer The result of shared prayer over a period of time is very definitely abundant blessing by the Lord. Anyone who has shared prayer over a period of time cannot but be amazed at a growth and enrichment far greater than the effort put into it. Since we are concerned with a form of group asceticism, it is natural enough that the effects of shared.prayer, on the whole, parallel the normal psychological dynamic of growth in any group. If .we considered the dynamic growth of a group in five major stages: 1. Convocation, 2. Phase of human relationships, 3. Period of maturing of the ideal of a group, 4. Period of consolidation, 5. Permanence or disappearance ot~ the group, we would find parallel stages of growth in the prayer group. Moreover, it would be quite unreasonable for anyone to expect in the early ph.ase of convocation the results that come only after time together, growth suffering--real asceticism --in the later stages of group growth. On the other hand, some prayer groups never really move beyond the second phase of group development 1258 / Review ]or Religious, Volume 33, 1974/6 and the result is a weekly, monotonous repetition of the same petitionary prayer in a friendly atmosphere. Moment of Convocation ¯ A group will come together (moment of convocation in group develop-ment) only if there already exists some mutual acceptance and common aspirations. The reason for setting up the group for shared prayer is gen-erally the same clearsightedness or deep awareness and realization that salvation consists in brotherhood--and the brotherhood is a praying-sharing community. The setting up of the prayer group demands deep faith con-viction regarding group growth and this vision must be shared by the group who already have a certain basic mutual acceptance and trust. If these prerequisites are not present, then it would seem a waste of time to attempt to set up a group for shared prayer; and it must be admitted that frequently, even within religious communities, there is too little faith and vision for the existence of group growth. Mariy communities are characterized by an individualism which guarantees the permanence of partial Christian spiritual growth. It must be said that many who dedicate themselves to community living seem unaware that this implies group growth. This preliminary step in group development---convocation has the effect of setting up the group for shared prayer. Period o4 Growth in Human Relationships There follows a pdriod of growth in human relationships within the group when in the prayer group the continued sharing of prayer leads to growth in self-acceptance, and in acceptance of and trust in others. The prayer becomes richer and more deeply shared--because I won't say things if I don't trust. Another direct effect at this stage is increased sensitivity to others, and to the presence of the Spirit in others. This leads to an experi-ential knowledge of who the Church is. It is important that the life of the prayer group be not just the moments of shared prayer, but rather be frequently enriched, at this stage, with various get-togethers of a social, even recreational, type. This can facilitate the development of trust, sensitivity, and mutual acceptance necessary for the development of group prayer life at this stage. However, it is important, during this time, to maintain the sharing principally on the level of faith-prayer- sharing and not allow it to become a mere socializing. Moreover, to improve the quality of the prayer, and the trust and sharing which are basic to it, the group, during this period in its own growth, could complement the shared prayer sessions with other periods of group discussion, revision of life, revision of prayer. Unfortunately, some groups just plod on week after week with a medi-ocre shared prayer and never pass through this second phase in the life of any group. Shared PrayerI"zn Religious Communities Today / 1259 At this stage, some within the group become dissatisfied with the quality of prayer life and leave. Some overemphasize the socializing dimensions and are not prepared to accept the demanding aspects of group asceticism and growth in shared prayer and they too leave the group. Tension results and this is the first main crisis in the prayer group's life. It can be overcome when the group searches to clarify the true direction of its prayer life together. Maturing the Group's Ideal A third phase in any group's psychological development is the period of maturing of the ideal of the group. Possibly, we could take a glance, for a similar situation, at the advice given by Paul to the Corinthians. Accord-ing to Paul, in all prayer meetings the group should emphasize that which exhorts, encourages, and builds up the community to the glory of God. These are effects that result from a qualitative improvement in the prayer life of the group at this stage. It becomes a period of increased mutual understanding, increased sensitivity to others, much deeper prayer sharing. At this stage, the group begins to understand the phases of spiritual life through which individuals in the group are passing, and when personal difficulties or "nights" in prayer come, the group can be supportive. I personally feel that it is only after a sufficient time has passed that in accepting, sharing, and making one's own another person's prayer we grad-ually totally accept that other person. Younger people in religious com-munities accepting older members completely, implicitly accept in them and through them the traditions of' an institute which otherwise they would probably never have absorbed so completely. This period is vital for the shared prayer of the group. It ought to be supported frequently by other meetings dedicated to revision of the group's shared prayer. I consider this point as the key to the qualitative develop-ment of the group's shared prayer--frequent group revision of the prayer. Period of Consolidation The period of consolidation is a moment of maturing in the group's development. For the prayer group it is the time when the quality of sharing in prayer opens the group to the total Christian vision of salvation in com-munity. Sharing becomes not only an attitude in prayer, but a life style. The members become profoundly convinced of being Church--being just parts of a total body which expresses itself in many ways. It is a period of real, though partial, realization of the original vision. It is also the period of openness to others outside the group. The group which came together for prayer finds now that the union achieved in sharing prayer is of sign value to the world, and the group now takes on increasingly the apostolic dimensions of witness to the union, sharing, and love which are of the 1260 / Review for Religious, Volume 33, 1974/6 essence of Christianity. The union, trust, and sharing developed in prayer are contagious and expansive. Naturally enough, any group that becomes exclusive or even develops a certain type of spiritual ghetto has not reached this stage at all; in fact it has probably not even reached the preliminary moment of convocation in faith. That such prayer groups exist is also undeniable. The Final Stage The final stage in the psychological development of a group is the mo-ment of growth, expansion, or division. This crisis is the result of fullness and indicates the moment when the group sharing prayer should divide in order to be able to open to more people. No group should ever be exclusive nor is it a healthy sign when it is always the same. Rather, the growth achieved through group sharing in faith and prayer must be communicated. The sharing in prayer leads to a sharing of life and this sharing of life must not be just for the group but a gift for others. I realize that reality is more complex than a scheme, and life richer than a list, but I feel too that it is important to know the dynamic growth through which a group passes, and know what this can lead to in spiritual sharing in prayer. I have here tried to use one of the simplest ways of view-ing this. The general effects of shared prayer are increased acceptance, deepened trust, mutual understanding, increased sensitivity; those within the group receive exhortation and encouragement. They are helped in expressing themselves in prayer and the general result is now as it was in Corinth--the building up of community. Forms of Shared Prayer We normally consider three forms of personal, individual prayer: vocal, meditative, and contemplative. I would suggest that, in group shared prayer, there are three parallel types. Ihdividual vocal or formula prayer has as its group manifestation shared spontaneous prayer in which the expressions of each one are unconnected but shared by the group. Personal individual meditative prayer is, in the group, paralleled by a shared meditation in which the discursive aspects of meditative prayer follow, not the developing thought of an individual, but the train of thought of the group--the group meditates as a single mind. The third form---contemplative--is found in its .group manifestation, in certain genuine pentecostal prayer sessions. The form of group prayer we are concerned with, and which is generally understood by the current title of "shared prayer," is the first kind--shared, spontaneous expressions of prayer. In this group prayer, it is normal to begin with a short period of silence, then of prayer to the Holy Spirit to illumine the minds and enkindle the hearts of the group--to come and pray in the group. This prayer is made by a definite leader who then opens the Shared Prayer in Religious Communities Today / 1261 session with a reading, preferably from Scripture. This is followed again with silence--a strong, reflective moment from which vocalized prayer springs. When people begin to pray in their hearts--expressing the senti-ments brought forth by the reading--these sentiments should be vocalized for the group, and each person in the group unites himself with the prayer expressed. The word "shared" does not refer to the fact that we all pool together our prayers, but rather it refers to the fact that all in the group share the sentiments of anyone who vocalizes his prayer. Therefore, it is possible for someone who never vocalizes prayer within the group to share the prayer of all the others. It is not necessary to speak to share prayer. It is necessary to unite oneself with the prayerful sentiments of another. The leader should have a definite time to bring the session to a con-clusion. Some Problems Met in Shared Prayer When a group is just starting, it is frequent to find that all the time allotted to the session is filled with prayers of request. This is natural enough and is normal in the development of individual prayer too. The group should not be worried or discouraged by this, provided that, eventually, the prayer begins to open to praise, glory, adoration, thanksgiving, and sorrow. Again, the group should be on its guard that the time for shared prayer is not too full. If one after another within the group expresses prayer without much silence, then there is probably little listening. I can't come in straight away with my prayer if I was really listening and uniting myself totally to the prayer of the previous speaker. Good shared prayer needs silence and listening. Some will say that shared prayer is not natural, they feel uneasy and self-conscious. This is undeniable. For some it seems very artificial. On the other hand, anyone who begins to meditate following an Ignatian or Sulpi-clan or Carmelite method will undoubtedly feel the same way. Moreover, just as it becomes easier in personal meditation once the method is mas-tered and forgotten, so too in group shared prayer. Others will become frustrated by the slow development of the prayer and claim that what they have is better. I can only say that shared prayer needs time to develop. There could be no enrichment in any sphere of ex-istence without the tediousness of the early stages. A difficulty, or definite danger, that needs to be avoided is the substi-tuting of a pseudo dialogue for shared prayer. In'a period of prayer, instead of praying, we try to tell each other something and, at times, subtly surface a rejection or problem we cannot otherwise openly speak about. This must be checked. At times, someone will pray and monopolize the time of the session with long-winded interventions. This, like the previous problem, is best dealt with through a periodic revision by the group of its own prayer. I 1262 / Review for Religious, Volume 33, 1974/6 repeat a point I have already emphasized--for me, personally, the key to shared prayer is the frequent revision of it. On such an occasion it would also be possible to recall to prayer those who may just drop to shared re-flection, because if it is shared prayer it should be kept at that level. Some people ask whether it is advisable to have a group for shared prayer within a religious community if not all the community wish to par-ticipate. I would think that, if shared prayer is a growth factor in building commui~ity, it should be used wherever there is a group. If the participants take care to avoid becoming a ghetto, keep people informed, always let it be seen to be open, then the rest of the community should have no cause to object. Finally, shared prayer is not a substitute for personal, private meditative or contemplative prayer. Anyone who uses it in that way indicates a lack of knowledge of the spiritual life, and a lack of correct perspective or re-lationship between individual and group growth. Shared prayer is an excellent form of group asceticism and leads to personal growth and the upbuilding of the community. It needs to be ap-proached with knowledge, guided by experienced members and continually open to revision, correction, and development. It is an indispensable ele-ment in group growth, but must be used with considerable flexibility--the pattern for one group is not necessarily that for another. As it develops and is used by more groups, the Christian will learn to move freely with others of common faith and be able to say with Paul: "I am longing to see you either to strengthen you by sharing a spiritual gift with you or, what is better, to find encouragement among you from our common faith" (Rm 1:11). In the Context of Discerning Sister Marie Beha Sister Marie Beha, O.S.C., is a member of the Monastery of St. Clare; 1916 North Pleasantburg Drive; Greenville, South Carolina 29609. Everything, everyone wants to grow: The desire is as universal as new grass springing up after early rains and warm sun. But growth is never any more predictable than the uneven development of an adolescent. We want to grow, but we can't make ourselves grow, nor can we control growth. All we can do is to further it or impede it. There are the laws both of nature and of spirit. What makes us grow must come from another: sun and truth to warm and enlighten us; food and love to nourish us. In terms of spiritual growth, it is pre-eminently God who enables us to grow and this He does with all the tenderness of His love. God desires that we grow and provides what we need for growth. Our part, and it is an essential part, is to collaborate with what is given to us, to co-operate with God's action in our lives. So a critical part of our life in the Lord is a.matter of discerning His unique call to us, of co-operating in becoming the person His creative love calls us to be. When we do, we grow; when we fail, we ourselves remain stunted and the coming of His kingdom is delayed. Granted that discernment is only one part of our growing. To know is effective only if we are willing to live out what we have learned. But it re-mains true that the first thing is to know, to discern. Paul speaks of "the mature who have their faculties trained by experi-ence to discern between good and evil" (Heb 5:14). And we might add, to discern not only what'is good and evil on the broad scale of things but to discover what is right for oneself, wrong for oneself, what is helpful at a particular time, what is impossible. In other words, discernment is not 1263 1264 / Review [or Religious, Volume 33, 1974/6 so much concerned with the will of God in itself, but rather with the ways in which a particular person, in the concrete circumstances of everyday life, is drawn to respond to the Lord. As one matures, such deciding for oneself in terms of one's personal vocation becomes more and more necessary. General rules that apply to all have already been accepted and now must be passed beyond. What is uniquely personal must be" acknowledged and integrated into one's response. Such is the state of personal responsibility in which most Christians find themselves today as increasingly they must decide the specifics of their own life,~ relying less dependently on the laws of the Church. The present article hopes to deal with: (1) the context of discernment, the background within which discernment is operative; (2) some of the obstacles which prevent true discernment; and (3) conclude with some suggested criteria for discernment. Context of Discernment One of the most basic presuppositions of discernment is that it is an ongoing process, "ongoing" since discernment does not attempt to reach final answers which prescind from further need to discern. On the contrary, each discernment calls for yet another. It is like walking through a door, only to find still a further door to be opened, still another path to follow. Because of this, discernment is not just an exercise for a certain time of one's life, but rather something that must continue throughout life. If discernment has any seasons, these probably belong to the mature person, the one who has already incorporated into his life the general rules, the over-all direction and who must now make more specific application to his own life situation. So the focus continuously becomes more personal, more precise, more "vocational." Discernment is not only an ongoing necessity; in itself, it implies process. It does not reach infallible conclusions; it simply indicates courses of action which are clear enough to call for response. At this point, the focus of dis-cerning shifts from the original: Is this right, best? to How is'this effective in my life? What are its further implications? And the answers to these and similar questions may mean that the process has to be repeated. When this happens we need not feel that our first response was incorrect, a mistake. It may have been. But it may also have been simply a part of the process, the closing of a door that had to be opened and gone through before it could be honestly shut. If discernment, is process, then it takes time. How much time is some-thing that can only be determined in the very process. By this is meant that how much time a particular subject of discernment deserves is part of what must be decided within the context of discerning. If an issue seems of lesser importance, it may be the part of true discernment to spend only a minimal amount of time on it. But such a conclusion of triviality is already part of' In the Context o[ Discerning / 1265 the process, for what may b'e unimportant, in an objective sense, can be discerned to be critical in the context of an individual's life in the Lord; it can also assume increased importance at a specific moment of truth in an individual's life. Or the very raising of an issue of discernment may reveal that the time is not yet for this particular thing to be determined. Even though a decision would be helpful, efficient, even though other decisions may hinge on this one, there is nothing to do but wait for the right time to discern. One ot~ the surprises of discerning is the discovery that something which seemed to call for discernment has already been decided in the depths of one's own being. All the discernment process needs to do now is to reveal and so make explicit something that a person's life has already determined. In cases of important decisions that have to be made such a discovery of "it is finished" is delight and peace. In cases where reform and renewal are required, the discovery ot~ what has a!ready become vital is only the painful beginning of something that will require much labor. Discernment is not only process, it is a process most intimately, related to life. Its goal is life. In general, a positive discernment opens to life, to new life, to renewed life. It not only leads to fuller life; it is also something coming out of life. It comes, first of all, out of a life that is open to the Lord and His leading; and out of the reality of the individual's everyday. Dis-cernment is not theoretical, abstract, in the book; it is practical, specific, in the everyday. However, a caution is in order. Though daily life is one context of dis-cernment, it cannot be adhered to too narrowly, too pragmatically. Discern-ment can surface the unusual, the unexpected. It may seem to require an interruption, even an upheaval of the ordinary. But, I suspect, that when time has washed over the decision, even these unexpected developments, will be seen as congruent with the larger pattern of a person's life. And what appears to be an interruption proves, ultimately, to be only the surfacing of something that has been there all along. Continuity, even apparent discontinuity, needs to be tested against the reality of other people and of their lives. For the context of discernment is never solitary, just because our life in the Lord is never solitary. We stand before Him together and so the background for my discernment must be widened to include other persons with particular attention to those who are my neighbors. In some cases this may mean asking others for confirma-tion, suggestions, a different point of view. Even when such deliberate seek-ing out of others is not indicated, still the decision ot~ the individual must be viewed as part of love. Finally, the context of true discernment is always prayer, a life of prayer even more than specific prayer for he!p in each instance. Though an ex-pression of openness to God and desire to discern in the light of His truth is always right, still the most basic way in which prayer is part of the process 1266 / Review ]or Religious, Volume 33, 1974/6 is that it provides a continuing conscious relationship with God all through life. The more real this contact is for the individual, the more direct and simpie his process of discerning. For one who lives in the truth, discovers the truth almost intuitively. So vital is the part played by prayer in true discernment, that without it, discernment would be limited to a merely human weighing of pro's and con's, rather than responding to the specifics of God's call in one's life. Obstacles to Discernment What impedes the discernment process, even renders it invalid at times? The obstacles are as diverse and many-leveled as the reality of man him-self. On the physical level, we face as primary obstacles failures in timing and fatigue, to name a few. The former element of timing has already been suggested in the preceding discussion. Not only can we fail to discern be-cause we are impatient but also because we want too much too soon. So we are pre-disposed to seek what will flatter our ego and give us a sense of accomplishment. But in reality, we may be reasonably certain that the way in which we are going to come to God is not the way of egoism nor of still more total reliance on self. Fatigue, with its accompaniment of pseudo-discouragement, depression, and inability to get beyond the immediacy of our own inadequate state also clouds true discernment. Something as human and as simple as a good night's rest may open the way to greater truth. But such physical obstacles are relatively straightforward in comparison to the psychological difficulties which impede discernment. It even seems that the more refined the issues which must be discerned, the more subtle is the danger from blocks arising from the psyche of the discerner. Such blocks include any habits of thinking that make one less flexible, prejudices, any fixed patterns of behavior. For example, a pattern of thinking that the difficult is always the more perfect, a prejudice that rules out the pleasurable as somehow suspect impedes true discernment. Patterns of emotional re-action can also disturb and cloud one's response to what is truth in the Spirit. Anything that keeps us agitated, circling around self, critical of our brothers, angry with ourselves and with others becomes an impediment. Perhaps the most pervasive of these emotional blocks, though not the most apparent among them, is the presence of fear. Not conscious fear, with a reasonable objective basis, but the unreasoned fear, the subconscious terror that lurks in the dark. It is this kind of fear which inhibits true response, compelling us to react unreasonably. Such fear cripples freedom and so limits our presence to truth. It also projects a God, created out of its own unreality, destroying the possibility of a loving relationship with Him. Usually these emotional blocks are so deep seated and beyondconscious control that they can only be worked with when they are seen through the In the Context of Discerning / 1267 eyes of a more objective observer. Sometimes when they are surfaced and expressed to another just that much light dissipates them and true growth will go on from there. At other times, these fears must be acted against, strongly but gently, until counter patterns can be set up. How strongly, how quickly, will be part of the discernment process. At least they must not be allowed to blind the discerner, crippling the whole process. The spiritual obstacle to truth in the discernment process is sin, not only the sinful acts themselves but also all the tangled roots of selfishness, greed, lust, bitterness, jealousy that somehow enslave us and keep us at a certain distance from the truth of the Spirit who would make us free. It is a critical part of the process to expose these roots, to open them up to the hearing power of the Father's love. The more we have deepened these tendencies by our concrete actions, the more they will influence our discern-ment coloring it with their own distorted lens. As.a beginning to their ex-tirpation, such sins can be acknowledged and so be made less influential. At best, they can be diminished by our counter efforts and, far more, by the saving power of Jesus which we ask for in the effort to discern honestly. Criteria for Discernment The criteria for discernment are not objective standards with universal applicability but are themselves matter for discernment. Which criteria apply here, which are especially revealing, what is" the meaning of a par-ticular criterion, all these questions must be included in the process itself. With this in mind, we can state a few standards which can serve to stimulate and guide the process, preventing it, perhaps, from becoming too subjective. First of all, discernment aims at uncovering truth, personal truth, and so it must be rooted in truth. ~This means it must be concerned with the real, the practical, the possible in our lives. What is patently impossible can never be the call of God; what is very difficult may be. This difference is what must be discerned and then tested in the concrete of an individual's life. To aid in such testing, one can ask, does this particular "spirit" under-line what is human in me; does it strengthen what is healthy about my personality, rather than reenforce some tendency that is already unhealthy. In other words, does it strengthen my defense reactions or does it result in a lowering of my defenses, even though such an opening of myself may leave me painfully exposed at first. Discernment in truth raises such questions as: Where am I able to be most myself? What course of action grows out of my experience of self and calls forth my best self? Paradoxically enough, such a discernment of what is best for myself, will result in a capacity to forget about self. It will broaden from the truth of self to the larger and truer understanding of self- 1268 / Review for Religious, Volume 33, 1974/6 for-others. When this happens there need be no further hesitation; the truth of discernment is setting the self free. And freedom is a second criterion for discernment, for discernment can only arrive at the truth when it begins in freedom. The very initiation of the process must be a matter of the individual's free choice. If a person feels compelled to make adecisi0n, to come up with an answer, even when he realizes that the time has not yet come for working with this particular question, then the whole process can be set on a wrong course. In contrast, when the discernment begins in freedom, it ends by making the person more free. This is so true, that the experience of freedom gives some indication of a valid discernment. I say some indication because this experience of freedom may become apparent only after a painful period of struggle to integrate the newly discerned truth into one's life. This struggle may even be accompanied by a certain "compulsion" that is expressed in something like, "I must work with this now." This uncomfortable awareness that "now is the time" comes from within, however, and not from some external pres-sure, nor from a compulsion based on fear. When the individual can accept personal responsibility for what he feels "compelled" to do, then he can proceed in security and freedom. Freedom, as it is being used here, is almost synonymous with capacity to respond. The responsible man knows the reality of his own situation; he realizes and takes into account the needs of others and in doing this is free to answer "yes" with Christ to the Father. He is aware of the cost of his discipleship and willing to assume responsibility for it. In all of this he is free to discern and is being made freer in the very process. A third important standard for valid discernment is the criterion of unity. Can the particular result of this discerning be integrated into my life as an individual; does it serve to further unify and bring together the pieces of my life. When this is true, the new piece fits the pattern of my life and gives me a sense of comfort and ease. Such comfort and ease, however, may not be immediately apparent. Like a pair of new shoes, an unfamiliar truth or unaccustomed way of acting may take some breaking in, some getting used to but ultimately it should make the individual whole. Another way in which unity tests discernment is in terms of the com-munity. What will this course of action mean for others? Is it respectful of different gifts, of the complementarity of gifts? Again, this criterion must not be applied too readily. What may seem at first to be disruptive, what causes trouble to the community, may ultimately be for its peace. Perhaps this aspect of unity in community may best be tested in the willingness of the individual to consider the needs of others as part of his own discerning. Some of the differences between what is best for the individual and what is best for the community can be dealt with in terms of the gospel to which all are called. Does a particular object of discernment fit in with the message of Jesus in the gospel? Is it Christological? Paschal, involving both death In the Context of Discerning / 1269 and resurrection? When this is true it will bring peace to the individual and to the community. Not the peace of feeling that all is well but the peace of knowing that one is growing toward union with God. A fourth criterion of a discernment that is free, true, and unifying is the presence of a certain note of fidelity. First of all, the process must be faith-ful to the conditions for true discernment which have already been suggested. When these conditions are not met, when obstacles are not worked with, dishonesty eats holes in the foundation and the whole building begins to sink. In addition, fidelity, itself, is seen as open loyalty, coming out of a past and pointing ahead to a future. It must be consistent with the past of a person's life, unifying and giving a new meaning to what has gone before. This is so true that what has the elements of the new and unexpected to the casual observer will seem familiar and somehow right to the discern~r. Because true discernment comes out of a past it will often be characterized by a certain element of persistence. God's call to us has a way of repeating itself with growing insistency till we respond a "Here I am." But in the answering we come to recognize the call as something we have known, about for a long time, more or less consciously. Such recognition is, itself, an indication of a valid discernment. So truth in discernment is bound up with fidelity to one's past. But fidelity which only looks backward walks blindly in terms of the future. True fidelity has an element of openness which allows the individual to be moved ahead by the Spirit of God. In .practice what is discerned as right may not be equated with what is predictable. The Spirit blows where He will and this element of the unexpected is another assurance of His presence and His action. But the unexpected of God is not just the arbitrary. Quite often what we ourselves never expected, never dreamed of, is rather ob-vious to others; it may also become apparent to the individual once it has surfaced. In this case the surprise of the Spirit is welcomed with recogni-tion. Two other criteria for discernment are more specifically related to voca-tional discernment and its implications in the everyday of Christian life; these are the criteria of service and of prayer. When a directional force in life is to be discerned, or a particular course of action determined upon, a rather clear criterion is the question: Does this enable me to serve better? Does it allow me to become more aware of others, more open to their in-dividuality? Does it make me more compassionate? For one over-all direc-tion of life that must always be included in specific discernment is love. And in the Christian context love is spelled out as service so the where and the when and the how of my best service are always relevant evaluators. In a comparable way, prayer is both a means to discernment and a criterion for it. As m6ans to discernment, prayer calls for the most radical kind of openness before the Lord, a begging with one's whole being for 1270 / Review for Religious, Volume 33, 1974/6 His light and His direction. It requires more honesty than we can summon out of ourselves; it calls for the truth that is the Spirit of Truth. If our prayer is an occasion for spinning illusions about God and about ourselves, then we are not really praying. For prayer deals in revelation, not always the bright light of beautiful religious truth, but often the darkness of our need to be redeemed. Prayer makes demands: that we wait for the Lord; that we remain open; that we change; that we begin every day, new in hope. Prayer that begins with a sincere desire for the Spirit of Truth will form the background for the most searching of discernments. But in addition to providing context, prayer also helps in the process itself. Of a specific object of inquiry it asks, is this something I can comfortably take before the Lord? Will it stand testing in the light of exposure to His presence? Even to ask the question is sometimes to arrive at an answer. In terms of times and circumstances of one's life, the question can be phrased, Where and when is my prayer most real? Where does God attract me? Where am 1 most able to be present to Him? What have been theprivileged moments of my re-lationship with Him? These are questions for individual discernment, not matters for general application of pious principles. The question of where I am able to be most myself before the Lord and, more importantly, of where He can best reveal Himself to me are as uniquely individual as the core of my being. They can only be answered in the context of my life and its development. In all of these ways, through prayer and service, through fidelity to past and future; through a deeper integration of truth into our own lives and of our lives into the life of Christ; through doing the truth in freedom we finally come closer to that unique perfection to which God calls us as persons. In our own way and time we grow into that "wisdom which comes down from above which is essentially pure; which also makes for peace and is kindly and considerate; it is full of compassion and shows itself by doing good, nor is there any trace of partiality or hypocrisy in it" (James 3:17-8). Discernment of,Spirits in the Choice of Ministry: A Sociological View Leo F. Fay Dr. Leo F. Fay is the chairman of the Department of Sociology; Fairfield University; North Benson Road; Fairfield, Connecticut 06430. Introduction While the discernment of spirits as an aid to the. discovery of the will of God has a history that antedates even the Spiritual Exercises of Ignatius Loyola, it has become a critical issue for religious only in more recent years. Prior to the post-Vatican renewals of religious life, discernment in the major decisions of a religious' life was made through submission to the will of superiors. As that traditional notion of discernment through obedience to authority has become deemphasized, the question of how individuals and groups of religious should make decisions has been receiving more and more attention. Most of that attention has been theological. Articles and treatises have been written on the how, when, and why of discernment, but usually from the theoretical and normative stance of the theologian. The present article is an attempt to broaden the discussion of discernment, especially as it relates to the choice of ministry, by injecting the empirical and descriptive viewpoint of the sociologist. One of the assumptions behind this effort is that theological reflection on religious life and behavior can have disastrous consequences if it is not formed by a sociological analysis of the .empirical realities of religious life and behavior. Often, for example, theological efforts at renewal will quite correctly assume that a particular form or practice traditional in religious life has come intrinsically meaningless and outmoded. It may be, however, that such a practice has definite, if latent, social functions which are crucial 1271 1272 / Review ]or Religious, Volume 33, 1974/6 to the very existence of religious life and must be satisfied in another way. Three questions will be examined in this article: 1. What is the actual process of discernment in the choice of ministry? In other words, in what context; or under what circumstances, or in what setting does the contemporary religious make her choice-of-ministry deci-sions? 2. What is the content of discernment in the choice of ministry? In other words, what sort of considerations and motivations are religious in fact using in making those decisions? 3. What are the major problems with these trends, from a sociological point of view, for religious life and communities, and what directions might prove fruitful in the search for solutions? The Source of the Data The data for this article were collected from questionnaires distributed to 442 sisters of one of the American provinces of an international institute. 396 sisters (88%) returned questionnaires in this study of personnel plans and attitudes. The parts of the questionnaire that are of special relevance to our concerns here are two: a question designed to find out how the sisters themselves perceive and describe their own process of discernment when they are faced with a choice-of-ministry decision; and the reasons they give for choosing (or preferring) a particular ministry. The Process of Discernment The question of the sisters' perception of how they actually go about deciding on a choice of ministry listed thirteen alternatives for the respon-dents to choose among in describing their own discernment process, and left a fourteenth space blank ("other") in case they wished to express another possibility. Six of these alternative responses were authority-related: they included the bishops of the Church, the general chapter, the superior general, the provincial, provincial administrators, and local superiors. Four of the questionnaire items were personal (namely: "my own conscience," "my own reasoning and thought processes," "various kinds of reading," and "my own feelings and emotions';), and three were social (namely: "historical events and social conditions," "communication with other sisters," and "communication with the people I serve"). The results are very clear. The sisters' description of how they go about discernment in the chbice of their ministry is a description of an overwhelmingly personal process. The social context is a very poor second, and obedience to superiors is on the bottom of the list. The sisters were asked to rank the thirteen (or fourteen) items in order of importance to them personally in their own discernment activities. When we look at their first choices, we See that272 sisters (69.6%) base their discernment of God's will on processes that are basically personal, isolated, Discernment of Spirits in the Choice of Ministry / 1273 an individualistic. Forty-six sisters (11.6%) focus on social processes, and 14 sisters (3.5%) use authority-related processes. If we look, not just at first choices, but at the sisters' first three choices, the same general pattern persists, except that both authority-related and social processes do a little better. Out of 1188 responses (396 sisters × 3 choices) 7.9% are authority-related, 26.2% are social, and 53.5% are personal. The Content of Discernment The sisters who responded to the survey were asked to name specifically the ministry they expected realistically to be engaged in twenty months later, the ministry they would ideally prefer to be engaged in at that time, and the reasons for each of these choices. The questions on their reasons listed twelve items as possible answers and left the thirteenth space ("other") for expressing still another reason. Three of the alternative responses can be described as work-oriented (namely: "I f~el that position would make best use of my training," "I like that type of work," and "I am ready for another career"); three can be described as personal (namely: "my health makes it the best clioice for me," "I feel obligated by family circumstances to choose that position," and "I don't feel ready to undertake a move at this time"); three are situational (namely: "I would like to retire," "I like the living situation that goes with that position," and "I like the kind if clientele I would be serving in that position"), and three are congregational (namely: "I want to work with a group of sisters of this congregation," "I feel per-sonal loyalty to the position as a commitment of this congregation," and "I feel it is my duty to the congregation to fill that position"). The differences between the reasons the sisters gave for their choices indicate that the content of their discernment is overwhelmingly work-oriented. Looking at the sisters' first reasons only, we see that 37.2% named one of the work-oriented reasons first, 18.6% named congregational reasons, 12.4% had situational reasons, and 6.9% had personal reasons. If we con-sider the sisters' first three reasons for their projections and preferences, we find that 33.7% of the reasons given were work-oriented, 18.8% were sit-uational, 15% were congregational, and 5.7% were personal. Problems Arising from the Data From a sociological point of view, the data on the process of discern-ment in choice of ministry do not bode well for the viability of religious community. It might be serious merely to have discovered that obedience to a common authority is no longer of major importance in determining what the members of a religious community do with their lives. What is more serious is the discovery that the religious perceive the process they go through as so thoroughly personal, isolated, and individualistic. Serious 1274 / Review ]or Religious,' Volume 33, 1974/6 questions are suggested by these findings for both the community and the individual religious. From the point of view of the community (house, province, or entire congregation), the questions center on planning and even survival. What does it mean for any organization, religious or not, if the individual members see themselves as isolated and alone when it comes to deciding what to do with their lives, how to behave from day to day, and what their aspirations are? I am not referring here to the matter of obedience to authority; I am referring primarily to the fact that the religious do not see themselves as making decisions in response to their fellow religious, to the people whom they are sent to serve, or to the historical and social conditions of the world they are called to serve. From the point of view of the individual religious, the questions are of a more psychological nature. They come down to the difficulty of working out a meaning for the life she is leading. Traditional religious life, with its customs, rule, obedience, and so forth, did have advantage of a very clear meaning for most of its adherents most of the time. As these traditions have changed in response to the new respect for the person and for individual responsibility, the clarity of the meaning of religious life for the individual has been clouded. Now each religious is in the position of having to inte-grate into a coherent meaning system the apparently contradictory styles of corporatism and personalism, of commitment and freedom, of choice of ministry and responsible group membership. That integration is not easy. By contrast, the data on the content of the religious discernment in the choice of ministry seem much less problematic. The high degree of emphasis placed on work-oriented considerations suggests a professionalism that an outsider can only admire. Likewise, there is a solid (though much smaller) group that giv~es primary consideration to the needs and responsibilities of the religious institute. However, the strong emphasis on work, which suggests professionalism, does reinforce the problems already mentioned. Professional attitudes have consistently been found to be correlated with the need for personal auton-omy and independence; and whenever the latter qualities are found in any kind of corporate organization, they aggravate the tension between the needs of the organization and those of its individual members. Suggestions for Solutions It may very well be that, for those institutes which have established it, choice of ministry was an organizational mistake. Nevertheless, it seems to be firmly entrenched and destined to spread, so solutions to the problems of corporate unity and individual meaning must be found that are com-patible with it. I suggest that there are two general directions in which partial solutions may be found. The first direction goes to the process of discernment and concerns its Discernment o[ Spirits in the Choice of Ministry / 1275 formalization. The clear evidence that religious perceive their own discern-ment procedures to be isolated and individualistic suggests the need for instituting relatively formal and structured social procedures to be made available to all individual religious who are faced with a choice-of-ministry decision. These procedures should involve the participation of a variety of other persons: perhaps a few representatives of the province or congrega-tion, representatives of the ministries the individual is considering and of the one she is leaving, and a few close friends. If the individual should elect to go through such a formal procedure with a group like that, it would widen the perspecti~'e from which she views her choice and would lessen the isolation she feels in making it. The second direction goes to the content of discernment and concerns the introduction of a broader scope of factors to be considered in making choices. Since the evidence we have suggests a high degree of profession-alism which will likely be accompanied by increasing independence from the institute, a partial solution lies in keeping considerations of the institute's needs and responsibilities in the individual's consciousness. One practical way of doing that is the mechanism of communications from particular houses or works to the whole province or institute. Province newsletters, helpful as they are in many other respects, cannot satisfy this point: local communities and groups themselves must do the communicating. Further, these communications should avoid at all costs being theoretical, propa-gandistic, or complex, and should strive instead to be concrete and anecdotal, newsy, personal, and simple. Both these suggested solutions, of course, derive from the same funda-mental truth of social organization: as any group undergoes change in its traditional way of life, the greatest danger it faces is disunity and conse-quent disintegration. To avoid that, deliberate, even self-conscious steps must be taken to make concrete and real in the lives of individual members their membership in a corporate group. On Praying and Being Human: Reflections on the Anthropological Value of Prayer Eric Doyle, O.F.M. Father Eric Doyle, O.F.M., is a member, of the faculty of the Franciscan Study Cen-tre; University of Kent; Canterbury, Kent CT2 7NA; England. Introduction This article contains reflections on the activity we call prayer in terms of its anthropological value. Such an approach is possible because of the prior anthropological character of revelation, faith, and theology. Since there are two key concepts involved in these reflections, namely, anthropology and prayer, the articl~ has been divided into two major parts. The reason for presenting these reflections in a review intended principally for religious will be clear from the content of the first part of the article. I Christology and Anlhropology The Christological doctrine of the Church, if correctly understood, is the most radical and authentic anthropology the world has ever known. In the historical event which is the life, death, and glorification of the Man, Jesus of Nazareth, the Church has the source and center of everything that she knows and can ever know about God and man. Because He is the Incarnate Son of the Eternal God, Jesus of Nazareth discloses to us in the very reality of His own humanity who God is, what God is like; and this is expressed in its most original form by the words "Father" and "Forgiving Love." In the same way He reveals what it means to be man: the being in the world who is called in the innermost depths of his historical existence 1276 On Praying and Being Human / 1277 to surrender himself unconditionally to the will of God, as to his destiny, in faith, hope, and love. This is not to argue that the Church has nothing to learn about man from the historical, positive, and natural sciences or that she can ignore the teachings of psychology, psychotherapy, and sociology. What we are asserting here is that the Church has a point of reference for all that can be known about man and that point of reference is Christ who allows her to grasp the ultimate depth of meaning of anything that may be discovered about man. From this source and center there is one truth which the Church knows with infallible certitude, the truth namely, that God Himself is the guarantee of man's humanity. To surrender oneself to God is to arrive at one's own unique humanity. The process of growth in the relationship with God--a relationship established by grace which div-inizes and therefore humanizes man in his historical existence--is a process of drawing ever closer to the Origin of humanity itself and thus of becoming more authentically human. When the Church speaks of God, in virtue of the very word she utters, she says something about man; when she speaks of man in the light of the grace she has received in her Savior and Lord, she proclaims also a word about God. The Church's Doctrine of Man This essentially anthropological and authentically human orientation of the word she proclaims is the primary reason why the Church has a right to address herself to the world of today and to the men of our time. Above all, it is the foundation of her right to establish educational institutes of every kind and at every level--primary, secondary, and tertiary and of the right to present herself ready before the authorities of State and religiously "neutral" universities and other higher institutes of education, to form theo-logical faculties. She possesses a doctrine about man which has the courage to speak about his multi-dimensional nature and this doctrine is worthy of a hearing wherever and whenever men come together to pool their re-sources in order to grapple with the question of what it means to be human. It is true, of course, that this anthropological character of her word, her faith, and her theology has not always been apparent. Moreover, many people share the conviction that believers in God and especially theologians, are desperately concerned with some ideal world far removed from the stark realities of day-to-day life. Indeed, one still stumbles across the vulgar prejudice that theologians as a breed pass their time hairsplitting and jug-gling with ideas, oblivious of the world going on around them and even indifferent to its concerns. How far this idea corresponds to reality is, I suppose, a matter for some debate. In any case that it is now a figment of misinformed minds and has been for a good number of years will be obvious to anyone familiar with the development of theology in our times. It is incumbent upon us all who believe in the universality of the revelation of God in Jesus Christ who is Lord, to do all in our power to dispel these 1278 / Review for Religious, Volume 33, 1974/6 false notions and gross misunderstandings by the quality of our lives, the extent of our concerns, and the intellectual honesty, rigor, integrity, and high calibre of our theology. Christian Anthropology and Dialogue with the World The radically historical character of the Church's faith, in virtue of which she constantly returns to the life of the Man, Jesus of Nazareth, formally distinguishes the content of the Christian Gospel from all mytho-logical worldviews and explanations of the meaning of man. The doctrine of the historical incarnation of the Son must have a paramount place in all dialogue with atheists, anonymous Christians, and implicit believers. If we prescind for the moment from the source of the Church's belief in this doctrine, namely the gratuitous love of the Immortal God for mankind and concentrate on the content of the assertion as de facto held by com.- mitted Christian believers, we can make it our point of departure in the dialogue that we for our part are paying the highest possible tribute to .human dignity. The content of this assertion is that the being whom the human race calls God, the Supreme Being, is held to be present to and united with this Man who lived out a human life like other men and who reached His destiny in total fidelity to His own humanity and this in such a way that His humanity was not impaired or in any way abolished, but on the contrary.was radically realized as itself in its own true and authentic nature. The implications of this assertion for an understanding of man demand analysis precisely because of the influence that the content of this assertion has on the lives, outlook, and activity of a significant number of people today who own the name Christian, because of the history of the Church's understanding of this assertion, and because it is an essential ele-ment of the assertion that Jesus is most truly a man. The assertion cannot be dismissed simply by the shabby argument of "projectionism" firstly be-cause of the historically conditioned existence of this man and secondly because the assertion holds in its dialectic that by the vei'y fact that God is here, Jesus of Nazareth is the realization of what it means to be human. Revelation and Christological Anthropology This anthropological orientation of Christology must have priority also among Christian believers. This is the case not only that they may be able to present an intelligible account of the meaning of their faith to a largely sceptical and unbelieving world, but because it is part of the revelation itself. God's word and His grace are the foundation of authentic and integral hu-manity so that without Him we cannot be truly human at all. The anthro-pological orientation of Christology, therefgre, is in no way a betrayal of the specifically supernatural character of Christian revelation nor can it be suspected of reducing this revelation to a subtle form of humanism. Theo-logical science is not committed to answering riddles or solving problems in On Praying and Being Human / 1279 the manner of the positive and natural sciences. Its purpose in every age is to strive to understand man as he is and as he is becoming, in his finitude and openness as the being made in the image of God and called by God to share the divine life. This is an ongoing process which is always new and never exhausted. No matter howmuch more knowledge may be accumulated by man in the future, no matter how many more secrets may be wrested from nature, man will be always the being in history who is open to God and capable of receiving the treasures of divine grace. This would still be the case even in the condition of the world where the vast majority of mankind had ceased to have any belief in God at all. Leaving aside what might be said about such a state of affairs from a purely phenomenological standpoint, we would still have to proclaim that we have Christ's word in hope that He will be with us to the end. Though this word gives no guarantee about numerical quantity--and at present it does seem that the number of explicit believers is growing less--it is the sure basis that the Church will not disappear from the face of the earth and that the remnant will remain on behalf of the nations. Renewal in lhe Church What is written in these pages about prayer applies to every Christian believer and, for that matter, to any man who prays, as distinct from some-one who merely uses a method or follows a system in order to arrive at inner equilibrium. My reflections, however, are addressed specifically to religious in the Church and this for a number of important reasons. It is my belief that the renewal of the religious life is only now beginning to move out of its-preparatory stages. This is also true of the Church in general. The last ten years since the final session of the Second Vatican Council have been a time of re-assessment, of preparing the ground, of hammering out principles, and of establishing priorities. Much has been achieved, but there is quite an amount left to be done. Let us take one example: developments in ecclesiology. The Church has come to a deeper awareness of her own nature as a community of believers in the world. This community is founded on the gift of God's grace of unity which is logically prior to its every expression in faith, worship, life, and order. This awareness of the Church's nature as a community has had repercussions in every area of the Church's life. It has raised questions at the practical level which are by no means yet answered. For example: What do we mean by "community" when applied to the Church in general and when we use it of a local group in the Church? What is the relationship between a territorial parish as realized at present and the theology of the local community in terms of a constantly shifting population? How does liturgical celebration reflect and foster the presence of community? Should diocesan priests be scattered over a multiplicity of parishes in a town or area of a city where they are compelled to live alone or in groups of no more than two or three or should they work to establish 1280 / Review ]or Religious, Volume 33, 1974/6 a form of community life that is specifically priestly and not just a limp copy of religious life? If they were to live a much more realistic community life, how would they serve and retain contact with the people of those areas where once a priest was resident? What are the consequences for eschatology of this awareness of the Church as community? In what sense is "heaven" heaven before the Parousia of Christ? What is the relationship between a local parochial community and the community of a religious order in the parish? These are some of the questions that require us to reflect again on what may have appeared to us once as unchangeable structures and beliefs. A similar list might be drawn up with direct reference to the religious life. Enough has been said, however, to demonstrate that we ought not to allow ourselves to be lulled into thinking that the renewal is achieved and that we can now slacken our efforts. Religious and Spiritual Direction Religious life, as I have said elsewhere in this Review,1 is an indispens-able (not to say essentia!!) element in the life of the Church. If I read the signs of the times aright, then it seems to me that in the future members of religious order and congregations of men and women (I prescind here al-together from the question of the ordination of women, though it is by no means irrelevant to the point under discussion) are destined in the provi-dence of God to assume an ever greater if not the maximum responsibility for spiritual direction. This will be one of the finest fruits of the renewal of the religious life in the Church. It is already the case that people approach religious (and let us admit it quite simply and candidly that they approach us precisely as religious, that is, as those in the Church who publicly profess the evangelical counsels, however unthematic and even hazy their expression of this may be) with their questions or problems or mysteries and they rightly expect us to bring a spiritual dimension into the situation they present to us. They have the right to expect this of us for the simple reason that we are presumed to know something about the workings of divine grace in human life. After all, we have behind us the years we have spent in religious life with all the experiences of reflection and prayer that these years have provided--and we must not forget that it is the Church and God's grace, more than ourselves, that have made this possible. Moreover, we were called by God to the religious life for the sake of the Church. Psychotherapy and Spiritual Direction In emphasizing the importance of spiritual direction I am not denying nor even playing down the place of psychotherapy. Carl Jung has furnished us with more than enough evidence of how dangerous and uninformed such aErie Doyle, O.F.M., "Reflections on the Theology of Religious Life," Review ]or Re-ligious, v. 32 (1973), pp. 1258-60. On Praying and Being Human / 1281 an outlook is. Indeed, every religious, but especially those engaged in any form of apostolic work ought to read his profound and, in some ways, disturbing'essay, "Psychotherapists or the Clergy." Much of what he has to say about the attitude of the doctor may be applied without qualification to spiritual directors. One passage will suffice to demonstrate this. Speaking of the requirements in a doctor who wants to offer guidance to another he writes: We can get in touch with another person only by an attitude of unprejudiced objectivity . It is a human quality--a kind of deep respect for facts and events and for the person who suffers from them--a respect for the secret of such a human life. The truly religious person has this attitude. He knows that God has brought all sorts of strange and inconceivable things to pass, and seeks in the most curious ways to enter a man's heart. He therefore senses in everything the unseen presence of the divine will. This is what I mean by "unprejudiced objectivity." It is a moral achievement on the part of the doc-tor, who ought not to let himself be repelled by illness and corruption. We cannot change anything unless we accept it. Condemnation does not liberate, it oppresses. 1 am the oppressor of the person I condemn, not his friend and fellow-sufferer. I do not in the least mean to say that we must never pass judgment in the cases of persons whom we desire to help and improve. But if the doctor wishes to help a human being he must be able to accept him as he is. And he can do this in reality only when he has already seen and accepted himself as he is.'-' These words reminded me of a passage in the Rule of St. Francis of Assisi which, for all practical purposes, says exactly the same: "And they [the Ministers] must take care not to be angry or agitated on account of anyone's sin because anger and agitatiofi hinder charity in themselves and in others.":' The spirit and the psyche are intimately connected and any religious who bears the responsibility now or will do so in years to come would be well advised to acquire a basic knowledge of the principles and methods of psychotherapy. What I am anxious to stress in this context, however, is that spiritual direction exists in its own right and to imagine that it can be simply replaced by psychotherapy is patent nonsense. It would be as foolish to reduce spiritual direction to psychotherapy as it would be to hold that a glandular extract will cure a neurosis." New Forms of Prayer The new forms of community prayer, the sharing of experiences of God, the openness and sympathy in communicating joys and sorrows, emptiness '-'C. G. Jung, "Psychotherapists or the Clergy," in Modern Man in Search o] a Soul, trs. by W. S. Dell and Cary F. Baynes (New York: Harcourt, Brace and World, 1933), pp. 234-5. aRule o] St. Francis, Chapter 5. 4See Jung "'Psychotherapists," pp. 223-3. 1282 / Review ]or Religious, Volume 33, 1974/6 and fullness, darkness and light experienced in the spiritual life are also providential in regard to this matter of religious and spiritual direction. It is a well-known fact that religious, especially in the United States df America and, to a much lesser extent, elsewhere, are leaders in these new forms of common prayer and this highly desirable openness in sharing with others one's experiences of God. All this has served to bring home to many religious the fundamental reason why they came to religious life, namely, to love and praise the Living God, His Son, and the Holy Spirit and to love and serve the brethren of that Son throughout their entire lives. The actual sharing of these experiences .teaches, as no book can, how God intervenes in a person's life, how His blessed grace renews people in the hidden depths of their being, how the Holy Spirit of God guides and enlightens people in the midst of the most humdrum and monotonous daily lives. I know from my own experience that listening to another person speaking about God's presence in daily life can actually become an experience of thd presence of God for the listener. Religious and Theological Formation The mushroom growth in the numbers of religious who are pursuing theological studies is also providential and here again the United States has the lead. So many of these religious are involved in education and formation at various levels and there are many of these who belong to the Charismatic Renewal Movement. One must be careful, therefore, not to brand this Movement generally as anti-intellectual. Of course the beast of anti-intellectualism shows its ugly head periodically in the history of the Church and these are areas where it is raising its head at the moment. Experience itself teaches unequivocally, however, that a solid theological formation is an essential requisite for spiritual direction. Indeed, ! would go so far as to say as a general rule, that without a protracted period of theological formation no one should dare to assume the responsibility of spiritual direction at all. By theological formation I mean a formation that is firmly rooted in the Church's tradition of theological reflection and not confused with "fashion-theology" which arrogates to itself the titles "exis-tential" and "personal," shifts its point of reference with every "new" issue and is as ephemeral as it is superficial. This awareness among so many religious of the necessity of a theological formation is born of the sound intuition that pietism, fundamentalism, emotionalism, and comforting plati-tudes just will not suffice for the apostolate of spiritual direction. All theo-logical endeavor is subservient to the faith and the Word of God and can never be an end in itself. In accord with the signs of the times, as they appear at least to me, we may say more specifically that the current widespread pursuit of theological formation among religious is directed towards achieving a greater competence~in spiritual direction the responsibility for which, as we have already said, religious will assume increasingly at every On Praying and Being Human / 1283 level of the Church's life and, for that matter, outside the body of committed Christian believers. The Experience of God It is obvious also that religious will have to be more prepared and willing to speak to those who come to them for this kind of direction and counsel about the experience of God in their lives and this without embar-rassment, but with courage and humility. Such openness is desirable and necessary not only because it will aid committed believers to recognize God's presence in their own lives, but also because of its witness value and the salutary effect it has on non-believers, sceptics, and the doubtful: Just as a solid theological formation furnishes the believer with the means of present-, ing an intelligible account of the faith and of giving reasons for accepting the Christian revelation which forbid the non-believer to dismiss the Chris-tian as a hoodwinked fool--even when no "proof" is forthcoming for what is believed, so also the readiness to speak in humility and honesty of the workings of God's grace and the experience of His presence in one's life, demonstrates that the believer is not someone merely committed to repeating intellectual propositions and to presenting the "party line," but a person made more human by the grace of God, which forbids the non-believer to brush religion aside as having no relation to concrete human existence. What has been suggested above about the increasing responsibility for spiritual direction on the part of religious takes on added seriousness in the light of the following passage from Jung's essay already mentioned above. It should be emphasized that what he writes is the result of his own researches: I should like to call attention to the following facts. During the past thirty years, people from all the civilized countries of the earth have consulted me. I have treated many hundreds of patients, the larger number being Protes-tants, a smaller number of Jews, and not more than five or six believing Catholics. Among all my patients in the second half of life--that is to say¢ over thirty-five--there has not been one whose problem in the last resort was not that of finding a religious outlook on life. It is safe to say that every one of them fell ill because he had lost that which the living religions of every age have given to their followers, and none of them has'been really healed who did not regain his religious outlook. This of course has nothing whatever to do with a particular creed or membership of a church.:, With the principle of the anthropological character of the Christian revelation briefly established, we may now turn to the anthropological value of prayer. Jung pointed out, as we have already quoted, that a doctor can only accept a human being as he is "when he has already seen and accepted himself as he is."" We noted that this may be applied without qualification 1284 / Review [or Religiot~s, Volume 33, 1974/6 to spiritual directors. What we have to say from here onward can be taken as a commentary on this text as applied to the spiritual director. Our reflections belong, of course, to another dimension where science ends, but it is a dimension of human existence brought to be by the grace and the love of God. To direct and counsel another human being in the ways of God requires experience, personal prayer, theological formation, and some knowledge of the teaching of the classical author~ of spiritual theology. We are concerned here with one aspect of one of these requisites, namely, the humanizing power of prayer. By prayer one learns to accept oneself before God. The spiritual director must have already seen himself as he is before God and ~iccepted what he has seen. II. Praying and Being Thomas of Celano, the most famous biographer of St. Francis of Assisi, describing the Saint at prayer, tells us that "all his attention and affection he directed with his whole being to the one thing he was asking of the Lord, not so much praying, as becoming himself a prayer.''r This description serves to emphasize the principal point of these reflections: that prayer is not primarily saying something but being someone in virtue of a relationship with God Who is ever-present everywhere in the totality of His Being. The purpose of all prayer, be it liturgical, public, corporate, personal, vocal, or silent, is to deepen our union with God. It is essentially a relationship of union with God, made possible by God Himself who, in absolute freedom and pure loving kindness, bridges the infinite gulf that separates us in our creaturehood from Him the Sovereign Lord and Creator of the universe. In this relationship we draw ever nearer to Him and the nearer we are to Him, the more do we become like Him. The more we become like Him, the more are we made truly ourselves. We already have some faint notion of this on the ordinary principles of the Creator/creature relationship. In every man there is a desire, a longing--however it may be expressed--to reach the Source whence he came and to which he must inevitably return. Our cer-tainty in the matter, however, is given uniquely in the doctrine of the Incar-nation. Jesus Christ is the truest man, the most authentically human man who ever walked our earth. Jesus Christ the Man There has been great emphasis in recent times on the humanity of Christ and we have been advised frequently to throw off the shackles of the fear of Arianism. While this is a most desirable development in Christology, rThom~s de Ce,lano, I/ita secunda s. Francisi, 95, Analecta iranciscana, v. X (Flor-ence, 1941), p. 187: "Omenm sic et intuitum et affectum in unam quam petebat a Domino dirigebat, totus non tam orans quam oratio factus." On Praying and Being Human / 1285 we need to be on our guard constantly against any form of reductionism that would make Him no more than a particularly good man among men in the world. Nor should we forget that for Arianism not only was Jesus not God, he was not really man either, since the Logos (understood to be the first, the highest, and the noblest of God's creatures) was made flesh by taking the place of the soul in the man Jesus. What we need to stress now is that because Jesus Christ is God-made-man, he is more human than any man. In His humanity Jesus is set apart in His aloneness (not to be confused with loneliness), though He is not separated from us, precisely because He is so truly, so radically, so authentically, and so devastatingly human. Prayer and Human Life There is nothing that can make a man more himself than the constant effort to deepen his relationship with God by loving the divine will and living in the divine presence. The kind of response a man makes to the divinely-given awareness of the Blessed Mystery who is God, who penetrates every fiber of our existence, radically determines the type of person he is. Prayer is not some optional extra in our lives, not some purely peripheral activity out on the fringe of the real business of our concrete, practical monotonous day-to-day occupations, not a luxury for those with time to spare. Prayer is an indispensable element in our relationship with God springing from the trancendent dimension of human existence, without which nothing in our lives can ultimately have any lasting value or validity. This is the chief reason why those who hold that it is not necessary to pray if one works generously and devotedly for others, support a fundamentally anti-human doctrine. We know, of course, that there is a true sense in which to work is to pray, dependent on consciously attending to the things of God. But as anyone knows who has spent protracted periods in the active apostolate, work sooner or later begins to lose its attraction and become a boring burden. It is then that one understands the power and value of prayer: Without prayer there is s6on no work at all. Man is the being in the world who is becoming. He finds himself plunged into the flow of existence that is steadily making its way to a term. When he comes to ask himself the questions What is man? and Who am I? he discovers he is limited and finite, on the one hand and always something more, something beyond what he has thus far experienced, on the other. If the Source and Center of all existence is not somehow a factor in his becoming, then a man will never be human or r~ally himself at all. There is an area of mystery in every man at the core of which is an openness to God, the All-Holy One, who calls out to him from His own blessed eternity. Homo sapiens, the being who finds truth and reality not only outside him-self, but in the inner depths of his own being, must also be homo orans. If he is not the latter, then he will slip back into being no more than homo 1286 / Review [or Religious, Volume 33, 1974/6 sciens--and knowledge only puffs up, wisdom it is that builds up. Man must progress from homo sapiens to homo amahs by being homo orans, that is to say, by praying a man becomes himself a prayer. Belief and the Existence of God The Eternal God is the Absolute Other. He is ineffable in His being, uncontainable, incomprehensible, inconceivable, incomparable, inimitable, indescribable, without beginning and without end; He is the Immortal One. For the believer the existence of God is the most obvious thing in the world. God and His grace exist more truly than the world of sense objects and experience that surrounds us and makes us what we are. The believer knows that God exists more really than he does himself. Many people would claim that these are smug and arrogant assertions; others would listen wistfully, thinking to themselves: "How fortunate believers are to know with such certainty that there is after all something to cling to, something to give meaning to life; how blessed they are to feel that life is not in the end empty, pointless, and absurd." These reactions fail to appreciate all that is involved in belief in God. For it is only when God is accepted totally in faith that the real problems confront the believer and these are infinitely greater than the question of His existence. These problems arise from man's existence who as a believer finds himself faced with the absolute demands of God's existence. For once a man believes in God and lives by his faith in union with Him, he becomes aware sooner or later that this God is the Holy God. Unlike goodness, power, mercy, justice, beauty, truth, unity, and peace, holiness is a quality which is not immediately part of our experience. Holiness is a reality of another order altogether. In the faith encounter with God a man becomes aware that he is known in the inmost depths of his being. This encounter with God as the Holy One reveals the seriousness of existence and the responsibility a man bears for his existence in the world. From this arises the concomitant awareness of creaturehood which can cause a man to cry out to God in anguish: "What moved You in the depths of Your own eternal blessedness to bring my existence out of nothing?" In the anguish is the answer: "Love eternal called you out from nothing-ness" and in this answer a man knows that the source of his anguish is Love itself. The Holiness of God God is holy and He bears a holy Name (Ex 3:1-6; Jos 24:19-20; Is 6:1-3; Ez 36:16-36). The almost impossible truth is that He demands of us that we be h61y as He is holy: "Be holy for I, Yahweh your God, am holy" (Lev 19:4); "Yes it is I, Yahweh, who brought you out of Egypt to be .your God: you therefore must be holy because I am holy (Lev 11:45); "Be holy in all you do, since it is the Holy One who has called you, and scripture says Be holy for 1 am holy" (1 Pet 1 : 15). The holiness On Praying and Being Human / 1287 of God comes from His innermost Being which is separated from and utterly beyond everything that is finite and creaturely. God's holiness is not in the first place the opposite of sinfulness, immorality, and self-seeking-- though it includes the notion of moral holiness; it is rather the contrary of all that is not God Himself. God's holiness is the perfection of His Being which ineffably transcends everything created. In the fullness of His Being God is absolute identity between His Will and His Being. God is, simply and supremely. There can be no disparity, no contradiction between God's Being and God's Will: God is what He wills, He wills what He is. In His holiness lies the mystery of His Being, that is, the Mystery of what it is simply to be. God, then, is the Holy Mystery: Holy Source, Holy Wisdom, Holy Love--Holy Father, Holy Son and Holy "Spirit. God is the Mystery of the Thrice Holy One. God the Mysterium Tremendum et Fascinans The absolute identity of the Being of God evokes feelings of awe and reverence which go beyond the categories of the purely rational. Our utter creaturehood is revealed to us in the awareness of God's holiness and this revelation occurs in the deepest recesses of the soul. In His holiness, God is both terrible and attractive, the Mysterium at once tremendum and ]ascinans as Rudolf Otto has profoundly analyzed and described it? In the presence of the Holy God man is both afraid and not-afraid at one and the same time as Rat explained to Mole in The Wind in the Willows: Then suddenly the Mole felt a great Awe fall upon him. "Rat!" he found breath to whisper, shaking, "Are you afraid? . Afraid?" murmured the Rat, his eyes shining with unutterable love. "Afraid! of Him? 0, never, never! And yet---and yet--O, Mole, I am afraid!" Then the two animals, crouching to the earth, bowed their heads and did worship.~ God is the Rex tremendae maiestatis who is revealed to us as the one who is and, as such He is made known as utterly beyond us. As Pure Being He is so utterly other that when He is encountered in His holiness He inspires awe and reverential fear of necessity because as the Holy One He is unknown and precisely as holy is totally outside all previous experience. Were it not for Him we should not be able to sustain the awareness of Pure Being. Man experiences himself as divided and disorientated in his existence; there is always tension between his being and his willing, disparity and SR. Otto, The Idea o] the Holy: Apt Inquiry into the Non-rational Factor in the Idea o] the Divine and Its Relation to the Rational, trs. by John W. Harvey (Oxford: Oxford University, 1923). OK. Graham, The Wind in the Willows (London: Methuen Children's Books, 1972), pp. 92-3. 1288 / Review for Religious, Volume 33, 1974/6 open contradiction between what he is and what he wills. His being is fragmented and dissipated in its finitude and creatureliness. Yet God draws near to man; though He dwells in light inaccessible, He approaches man and reveals Himself as Holy Mystery and Divine Majesty. It is because He draws so close to us that we know Him to be totally other and utterly beyond us. A man is confronted with the truth of Pure Being and Total Unity and he is filled with awe and fear in the presence of such unambiguous simplicity. At the same time, however, this revelation of the holiness of God makes known to us that we are in some way like unto God. The meaning of having been created in the image of God is disclosed in all its wonder. Because He is One, the pure identity of being and willing, God is experi-enced as attractive, alluring and fascinating. In the absolute simplicity of His holy existence God is the fullness of reality. Man strives by the law of his being to be and to be more; he searches out and is drawn towards that which is to be most of all, most authentically and simply to be: the One who is the Holy Other and who lives forever. The Fidelity of the Holy God God the Holy One is revealed in the covenant wherein He pledges Him-self to man forever. Despite man's finitude, sinfulness, and ingratitude the covenant remains forever: "I will punish their sins with the rod and their crimes with the whip, but never withdraw my love from him or fail in my faithfulness. I will not break my covenant, I will not revoke my given word; I have sworn on my holiness, once for all, and cannot turn liar to David" (Ps 89:32-5). The fidelity of the Holy God evokes a personal attitude on the part of man which issues in adoration and establishes the foundation of true humility. In the presence of the Holy God man is made aware of who and what he is, not primarily of what he has done or has not done. God's holiness evokes an ontological attitude, one of being, not merely a moral or aesthetical attitude, which is brought about by the very presence of Pure Being and Simple Truth. The knowledge of God's holiness is what allows the man who arrives at it to integrate into his relationship with God the fact that he is a creature. The experience of the All'Holy God as the Mysterium tremendum et fascinans involves also an awareness of the absolute fidelity of God and of His total acceptance of a man as he is. This leads to self-acceptance as a creature and marks the beginning of the transformation into a new crea-ture. The realization comes that a man is known in the inmost depths of his being and this liberates him from the ambiguity of creaturely existence. Jesus Christ the Model of Prayer The unfathomable mystery of God the Holy One has been made known and drawn close to us. in the human life of the Man Jesus of Nazareth. Jesus On Praying and Being Human / 1289 Christ is the Father's Love which He will never take back; He is the Word that will never be revoked; He is the Covenant that will never be broken. In sending Jesus Christ to the world God has already accepted man and has already answered every prayer that might ever arise from a human heart. Since Christ is the foundation and center of the Christian life, it is only in contemplating Him that we can come to know what prayer means. We must now turn to Him whose life was itself an unbroken prayer to the Father. The pi-ayer of Christ is a favorite theme of the Gospel of St. Luke. He tells us that while Christ was praying after His baptism the Holy Spirit came down upon Him as a dove and a voice was heard from heaven: "You are my Son, the Beloved" (Lk 3:21). Again it was while at prayer that He was transfigured and a voice from heaven proclaimed: "This is my Son, the Chosen One" (Lk 9:28-,9). The foundation of Christ's prayer is the already established relationship with His Father, from which flow the desires of His will and the affections of His heart. Apart from the episodes where it is related that Christ went off to pray alone, St. Luke also tells us that Christ prayed in the presence of His disci-ples. This experience was one of the most treasured memories of the early Church: "Now one day when he was praying alone in the presence of his disciples he put this question to them 'Who do the crowds say I am' " (Lk 9: 18-9); "Now once he was in a certain place praying and when he had finished one of his disciples said, 'Lord teach us to pray just as John taught his disciples.' He said to them, 'Say this when you pray: Father, may your name be held holy' " (Lk 11:1-2). This must have been a frequent oc-currence in the disciples' experience, and it wasone they remembered in their preaching and one which the Church preserved for us in the Holy Scripture. There must have been something truly remarkable and unforget-table about the sight of Jesus at prayer. In the episode which records that He taught them the Our Father, the Evangelist states quite simply: He was in a certain place praying. It is not said that he was in ecstasy but simply that He was praying. It was evidently the sight of Jesus at prayer that moved them to ask .Him to teach them to do the same. What can have moved them to ask Him to teach them to pray? After all they were Jews and therefore familiar with pr.ayer.1° The daily life of the pious Jew was filled with a round of prayer. Yet all this had not taught them what the simple act of this man at prayer had called forth from the inner depths of their being. One can try to picture the sight of Jesus praying in the midst of His disciples and try to discover what made them ask Him to teach them to pray. Perhaps it was His serenity, the entire composure of His being; perhaps they wanted to get at what was going on in His heart and mind that made Him the kind of man He was. If we reflect a little on the passage ~"Joachim Jeremias, The Prayers o] Jesus (London: SCM, 1969). 1290 / Review [or Religious, Volume 33, 1974/6 in Luke 11 : lff., the answer will be seen to lie in what He told them to pray: "Say this when you pray: Father, may your name be held holy . " He told them to say "Father." It was this that came to His lips without hesita-tion, quite simply and in utter confidence. Perhaps this was the very word He had been using when they saw Him at prayer. In any case, the word "Father" tells us almost everything we need to know about Jesus and it is the clue to what caused His disciples to ask Him to teach them how to pray. He taught them to say "Father." This familiar little word, which no con-temporary Jew would have dared to use of God, Jesus made the heart and soul of all prayer for ever. The Sublime Mystery of God, the Sovereign Creator of the universe, is addressed by this Man in a term so familiar that it can only be translated "Daddy." God is our "Abba." What the disciples experienced, therefore, was not so much a man saying something as being someone. They saw Jesus the Son, that is Jesus being totally Himself in the presence of the Most High God. In teaching the disciples His own prayer which expresses the intimate relationship He had with Gdd, Jesus revealed to us well-nigh everything about God: His kindness, His love, His tenderness, His mercy, His desire that we approach Him on the same intimate and familiar terms as did Jesus Himself. We will never be able to grasp what it means to address God as Father because this is one of the most staggering mysteries of the entire revelation we have received in Jesus Christ. We say this prayer very often in liturgical worship and in public and personal prayer. We must always be on our guard not to allow it to become no more than a mere jingle of words. The Church has always treasured this prayer of her Lord and she always will. It is a matter for some sadness that the translations of the Mass have rendered the introduction to the Our Father Praeceptis salutaribus moniti et divina institutione forrnati audemus dicere by the limp invitation "Let us pray with confidence to the Father . " This rendering fails abysmally to express the sense of privilege and utter distinctiveness that audemus dicere contains. In this prayer we are using the very words of Christ and we are allowed to do this for no other reason than that He taught us to address God in His words and He drew us into His relationship with the Sovereign Lord of life and death. This sense of privilege has been beauti-fully retained in the translations of the Divine Liturgy of St. John Chrysos-tom: "And make us worthy, Master, to dare with confidence and without condemnation to call You Father, O God of heaven, and to say: Our Father . -11 By divine grace, which is the life and love of God Himself, we are truly 11"The Divine and Holy Liturgy of Our Father among the Saints John Chrysostom," Byzantine Daily Worship (Alleluia Press, 1969), p. 288; see also "The Divine and Holy Liturgy of Our Father among the Saints Basil the Great," ibid, p. 336. See also K. Rahner, On Prayer (New York: Paulist. 1968), p. 20. On Praying and Being Human / 1291 made God's sons an'd daughters. Now in human adoption there is necessarily r~quired a likeness of nature--the mother and father must adopt a human being. There is, however, no likeness of nature between God and man. God brings it about by His own most holy grace and we become like Him and are thus His sons and daughters. Human adoption is purely external, dependent only on the will of the adopter. In divine adoption there is realized an internal change so that we are rightly said to be born of God. Finally, in human adoption in order to succeed to the goods of the adopter, the latter must die. In divine adoption God the Adopter is always the Living God and we receive the riches of His love and eternal life in the very act of adoption. In coming to the awareness of God's holiness we arrive also at the knowledge of our own creaturehood--we come to acknowledge who and what we are. The.Incarnation of the Son discloses to us that we are accepted by the Holy God to the degree, that He makes us His sons and daughters and, therefore, that we are a new creation in Christ Jesus our Lord. With these two fundamental principles before our mind we can now turn to their practical implications for the life of prayer. Prayer and Becoming Ourselves The Creator/creature relationship has been transformed and elevated by God's grace to the Father/Son relationship of an entirely new order. In His revealing Word God has made Himself known to us as He is and it is through His Word that all prayer is possible. There have been many definitions of prayer, the best known being "the raising of the mind and heart to God." Yet every one of them proceeds from and is intelligible only in terms of this fundamental relationship with God the Father, through Jesus Christ, in the Holy Spirit. The purpose of prayer, in all its modalities, is to lead us to conscious awareness and ever clearer recognition of the grace of being a son of God the Father. This grace is not an entity added to our natural being as spiritual creatures, but a radical assumption of our entire being by the love of God. It is a dimension of our human existence which God has brought into being. Prayer increases our awareness of divine adoption--Tthat is, of being this person before God the Father by reducing to conscious reflection this fundamental condition of our human existence. When we place ourselves in God's presence we are before the One who is at once our Creator and our Father. We are able to do this because He has loved us from before the foundation of the world. We are not the result of fate nor the plaything of chance, but unique, original persons called into existence by the creative act of God's most sovereignly free love. We were willed into existence by the love of God; we exist because God wants us, as ourselves, to exist. The Father saw us from all eternity in the face of His Christ and He always loved what He saw. The simple truths that God created us and allows us to address Him as Father, disclose to us that God 1292 / Review /or Religious, Volume 33, 1974/6 is Love, not only in Himself, but also to us. In this most radical, most basic sense God has already accepted us even before we are able to approach Him and it is this acceptance that makes any relationship with Him pos-sible. We must be careful, therefore, not to think of God as changing His "mood" towards us; He does not, because He cannot, grow hot and cold in our regard. We must not project our own changeability onto Him. God does not "spy" on us, He does not try to "catch" us. On the contrary, He gazes at us in His sovereign holiness from His blessed eternity and by this gaze conserves us in being. Through prayer we deepen the awareness of who and what we are in the very structure of our being and this is the primary reason why prayer is indispensable in self-development. Prayer and Self-acceptance The awareness of who and what we are before God also reveals to us the dark side of our spiritual nature. This is not a pure.ly psychological phenomenon; it has its origin in the mystery of iniquity. The refusal to admit this dark side of our being and the tendency to reduce the awful reality of sin to psychological disorders and cultural conditioning are among the chief causes of the spiritual sickness of our time. From the dark and sinful side of our nature proceeds the strange power which drives us to seek ourselves and to assert ourselves. Yet instead of bringing us to a uni-fied selfhood, this self-seeking and self-assertion have the contrary effect of splintering our being in multiplicity and of driving us into loneliness in the midst of the crowd. This dark and sinful side of our being must be acknowl-edged. We have all experienced the divided self; denial of it is itself a further proof of the division in ourselves. We wear so many masks and it is worth comment that the very word person which describes our uniqueness is derived from the Greek prosopon which originally meant a mask. Yes, we act, we play so many parts, we assume such varying roles according to the circumstances of persons, times, and places. In truth we are pretenders and hypocrites. And while we wear so many masks we are hiding from ourselves. In the midst of this frightening multiplicity we are unable to answer the question "Who am I?" So we run away from ourselves, we try to forget what we were yesterday and to convince ourselves that we really are ourselves today. We are disgusted because we are counterfeit and we try to lose ourselves in the feverish activities of our life of masquerade, while being driven further into the desert of loneliness, so that we dare not be alone. Emergence of the Real Self When we place ourselves in God's presence--and this means that all pretense ceases--we see ourselves in the light of God's Primordial Unity behind the masks that hide us. We recognize the multiplicity of our being. On Praying and Being Human / 1293 We see ourselves in the midst of all our pretense, hypocrisy, and acting. Yet the miracle is that we do not go mad, we do not commit suicide. In prayer the real self begins to emerge and with it and through it the deeper knowledge and conscious awareness that we are loved already and accepted; that is to say, we know God as Father and Forgiving Love. He has not condemned us, we are not oppressed. By the power and grace of His ac-ceptance we are able to accept ourselves; we no longer turn from ourselves in nausea and disgust. From the moment of self-acceptance the process of unification of our being has begun. Furthermore, this grace of self-accept-ance begins to make itself felt outside the formal moments of prayer. The real self begins to appear in our relationships with others so that we are no longer the victims of our changing environment. The masks begin to drop away to reveal the much more delightful, lovable, and authentic some-one who was hidden under the rubble of hypocrisy ,and pretense for so long. Self-acceptance, however, must not be thought to be recapitulation before our sinfulness nor passive resignation in the face of our divided being. It is the realization of ourselves as creatures of a Loving Creator and sons of a Tender Father which defines our inmost being and which allows the absolutely unique, never-to-be-repeated, utterly original someone who we are to emerge from the depths of our being. With this comes the concomi-tant awareness of the uniqueness of others. Even in the act of speaking to another person we become more and more aware of the love of God and we are no longer afraid to let another look into our eyes. Self-acceptance through prayer brings recognition of one's dignity as creature and son of God. As creature we realize we owe to God our adora-tion, thanksgiving, praise, worship, and honor; as sons we know we owe Him our love. To love God with all our heart, our mind, our soul, and our strength--this is our dignity in the world as sons of God. Once we have learned this self-acceptance we will never be lonely again. Rather, we become conscious of our aloneness in the world which is part of our uniqueness. This brings with it a longing to be alone whenever life will allow us in the midst of all our duties, responsibilities, and work. These moments alone will be amongst the most blessed in our life, for they will be spent in the presence of our Creator and Father before whom, with whom, and in whom we will be most truly ourselves. Prayer and True Self-love Self-acceptance through prayer leads gradually to a true self-love. After a time God reveals to the man who prays that He does really want the love of the human heart. This brings us, of course, to the center of the mystery of Divine Love. How is it possible that the Eternal God in the self-suffi-ciency of His Triune Blessedness should want the love of the human heart? And yet this is the simple and staggering truth of God's will for man. The knowledge of this truth reveals to us our dignity and worth before Him. 1294 / Review Jor Religious, Volume 33, 1974/6 God wants the love of my heart. If I refuse it, then He will never have it, because no one can stand for another or take another's place in loving God. God's love of our love for Him brings us to a love of self which is born of the awareness of our uniqueness. Self-love, thus understood, will preserve a person from the frightful stupidity of wishing.he were someone else. When one examines the implications of this stupidity, which is the worst form of envy, it becomes apparent that it is the most awful act of ingratitude to God. For He has given every one of us at least one talent of being ourselves. If we have two or five talents besides, all to the good. But let us not ignore the one that is the most precious 'of all--ourselves. If we hide this talent or bury it under pretense and hypocrisy, if we while away our time in daydreams, wishing we were someone else, then we are ignoring not merely what we have, but actually who we are and there will be no interest at all on the day of reckoning! Moreover, if we recognize this" one talent and love it as a gift from God, then we will avoid all odious comparisons. For which is the fuller, a glass filled with water or a bucket filled with water? The fact that the bucket has more water than the glass is neither here nor there as far as the glass is concerned! Finally, true self-love brings with it the desire to be like God, that is, the longing for holiness. We do not mean a desire for the effects of holiness, but for unity of our being and our will. It is a longing for integrity, a longing to rid ourselves of the disparity between who we are and what we will and it is one of the most precious graces God grants to us. Integrity is not achieved at once, of course; it is the fruit of long effort and the constant practice of virtue. It demands a rooting out of all self-seeking which is hidden in the depths of our being. We will come back to this in a later section. Prayer and Listening It is not easy to be a lisfener. We often wait for what we want to hear, sometimes we do not listen at all. So often we imagine that our own words are far more important than anything we may hear. In conversations we find ourselves waiting for the other to stop talking so that we can cast forth our pearls and give voice to our wisdom! How sad all this is; for We probably say far more in the silence of really listening than by all the words that pour out when we talk. It is no fancy to describe prayer as listening. Not that this means hearing voices or having words whispered in our ear. Prayer is a listening to God, listening for the word which says "I love you." Fo

Issue 20.3 of the Review for Religious, 1961. ; CONGREGATION OF SEMINARIES Ecclesiasti .al Formation Prot. ,N., 2121:60 LETTER TO THE EPISCOPATE IN THE THIRD CENTI~NARY YEAR OF THE'DEATH OF ST. VIN, CENT DE PAUL ON CERTAIN PROBLEMS OF EC-CLESIASTICAL FORMATION. Your 'Excellency, On June 5th of last y.ear, the Sacred Congregation of Studies, prompted by the wonderful example of the priestly life as typified in the holy Curd of Ars, addressed a letter to the episcopate. [For the text of this letter, see REview Fort R~I.~ctous, 18 (1959), 321-27.] The,.purpose of this letter was to recall to mind some fundamental princi-ples 'of ecclesiastical formation, the lack of which might irrevocably affect the sound preparation of the candidate foi" the priesthood and thus his success in the sacred minis-try. The radiant figure of St. Vincent de Paul, whose name in the third centenary 6f his death has resounded in every corner of the world, induces us to continue and complete our thoughts on this matter. The occasion presents to us anew the life of a saint who/it can be said, was a perfect pattern of Jesus Christ, the Eternal Priest. It offers an ex-ample which merits the earnest consideration of all those who are engaged in preparing students for the priesthood, preparing those who have answered the call to fashion themselves according to the model of the Master. Do not think that w~ are presenting an anachronism; if the spir-itual conditions of the clergy and of ecclesiastical training are happily" very different from, those under which the saint carried out his ~igorous reform, nevertheless the guiding principles which were the leaven of his multiple activity ever remain valid. His activity was impir(d by the eternal value of the Gospel message. The heroic charity which permeated his whole life ca~ not be explained or understood in its full significance un-less we realize that it had its origin in his great concept of the priest and the duties of a priest. ÷ ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 I6! ÷ ÷ $ac~ed Congregation o] Seminaries REVIEW FOR RELIGIOUS In a time of dire calamity which he felt deeply in his heart, he knew how to confront miseries with comfort and to help all those in need. Through his w~ork of refor.m he had already enkindled in the clergy that zeal which fosters in the faithful the.well-springs of charity. It car/be safely affirmed that there are few ~who l~ave felt to the same extent as St. Vincent de Paul the shpernatural value of the priesthood and its essential importance the Church as the source of Christian life. He had in com-mon with his great contemporaries of the French school a most tender devotion to the mystery of the Incarnation and to the Priesthood of Christ; nevertheless, inspired by his own pastoral experience, he gradually develgp.ed spirituality of his own which was directed immediately towards the practical pastorate and was sustained by an ever.more earnest zeal for,the salvation of souls. His out-look ~ras determined by concrete cases and showed itself in various ways, but it was always based on this funda-mental principle that the priest is the man whom God has selected and called to participate in the Priesthood of Jesus Christ. His task is to continue the work of redemp-tion and, animated with the spirit of Christ, carry still fur-ther .the work which Christ has done and in the way He has done it. For St. Vincent de Paul, our Divine Lord is above all the Savior of mankind and the priest must be another savior who continues His mission of salvation. Therefore he clearly saw. tha_t, the firs5. qualit~ies a prie~st should possess are an ardent charity and apostolic zeal and that if the love of God be the soul of priestly activity, the object of that love must lie in the salvation o~ rfien. See how the saint emphasizes effective love of God: Let us love God, my brethren, but at the cost of our toil and the sweat of our brow. For it often happens that' the various affective acts of the love of God and the interior motions of tender heart, even if they are good and. desirable, are none the less suspect if ,t.hey do not result in effective love. Our Lord Himself says: 'In this is my Father glo~ifidd: that you bring forth very much fruit" (Jn 15:8). w~ must be on our guard be-cause there are many who think that when their exterior de-portment is correct and they are: filled with great sentiments tqwards God that they have fulfilled their duty; but.when they are confronted with the practical work of the apostolate their inadequacy is made manifest. They flatter tti~mselves with their lively imagination; they'are content to converse sweetly with God in pra~er; they even talk the language Of the~ angels; but outside of this when it is a. case of working for God, when.is a case of suffering, of mortification, of instructing the poor, of going in ~earch of lost sheep, of being content'under l~ri~,tions, of a~cepting illness and bther misfortunes, alasl they are not to be counted on, their codrage~fails. Nol Nol We must not deceive ourselves: our whole jqb consists in working.1 a St. Vincent de Paul, Correspondance, entretiens, documents, 162 edited by P. Cost~ (Paris: 1919--25), 11, 40-1. .We c~n say, then, that St. Vincent de Paul sees the priest in- the light of his ministry for souls, souls who are buried in.ignorance of the truths of the faith, souls who are in a state of sin. Or better still, he sees the priest in the light of his service of Christ Himself~' th~it Christ whom the saint kriew how to perceive clearly in the suffering members of the Mystical Body, .even though immersed in the most ab-ject spiritual and bodily misery.- His intense activity consisted in the continual oblation of himself for love of the.God whom he saw and loved in his brethren. Was this activity separated from prayer and from union with God? Such a thought would be the great-est affront to the saint bf charity, since the fire he en-kindled. in others, he had first drawn from the heart of God Himself. We can not do better than to continue the above quotation where We see how graciously the saint treats of the point in'question: ~ There is nothing more conformable to the Gospel than for us to accumu_lafe light and strength for our own souls in prayer, spiritual reading, and solitude, and then to bestow on men this spiritual food. In doing so, we are following the example of our Lord andHis Apostles; we are uniting the task of Martha to that of Mary; we are imitating the dove which itself takes a part of the food.it has gathered for its own nourishment and gives the.rest to feed its young. This is what we must do. This is how we must prove to Gbd that wd love HirfiNthrough the mh.dium"of~ our good works? The aspect'under which he loved to think of the Savior is that foretold, by the Prophet and used by Christ at the beginning of His public lifein reference to Himself: "The spirit~of the Lord is upon me. Wherefore he hath anointed me to preach the gospel to the poor, he hath sent me to heal the contrite of heart, to preach deliverance to the cap-tives, and sight to the blind, to set at liberty them that are bruised, to preach the acceptable year of the Lord and the day of reward" (Lk 4:18-19). The poor, those in tribula-tion and distress, were indeed the special care of Vincent de Paul even if he did not exclude any social class from his apostolic work, seeing it to be his duty as a priest to work for the salvation of all. But to the poor and humble he cer-tainly showed his preference. For them his love was bound-less; it was a love which has given us the most glorious pages, in the annals of Christian charity. They were his principal concern in his reform of the priesthood. "Make good priests" a favorite expression of his meaning "Make holy priests"--signified for him a bringing back of the clergy particularly to their mission of preaching by which th, ey would rescue the people from their ignorance of the truths of the faith and lead them away from sin. By means of this he established an indissoluble link between the See the preceding note. ÷ ÷ ÷ Ecclcslasticai Formatio~ VOLUME 2~ 1961 163 ÷ Sacred Congregation ot Seminaries REVIEW FOR RELIGIOUS 164 priesthood' and the laity: good priests mean a good laity; ignorant or sinful priests are their ruin. From this unify: ing principle, "As the priest, so the people," were derived all St. Vincent's projects for the formation and sanctifica-tion of the clergy: the Congregation of the Mission, for ordinands, the Tuesday conferences, clergy re-treats, and especially the establishment of seminaries. his innovations bore the stamp of God's approval, for hav-ing first given himself up to humble and unceasing prayer he then went forward with his plans slowly and carefully so as not to jeopardize, as he used often say, the work of God. That was in fact characteristic of the man: to ensure that in every undertaking, big or small, he followed will of God, avoiding all forms of impatience which is detrimental but especially so in the carrying out the designs of God. This accounts for the qualities of en-durance which characterized his work. He sought God's will in all things, straining with the single-mindedness a saint towards the perfection which was his ideal for priests. Selection and Evaluation of Candidat.es The reply of St. Vincent to those who were proposing one of his own nephews for sacred orders out of motives not altogether praiseworthy is well known. He s~tid: "F~my part had I known at the time when I haft the rashness to enter the ecclesiastical state what I subsequently learned, I would have preferred to work in the fields than to go forward to such an awe-inspiring state." If we can see here evidence of the saint's constant and profound hu-mility, we can also see an indication of his very great reverence for the priestly vocation. In those unfortunate days when men entered the priest-' hood for motives, other than the wish to serve God and save souls,. St. Vincent's only preoccupation was to prevent from such an unworthy course those "who make the just weep tears of blood." Clearly the reason for his care was that "God gives the graces needful for this hgly state only to those whom, in His goodness, He calls,''3 "Those who enter there without His call would seem to be lost.''4 In these and similar quotations there is obviously evidence of Jansenistic pessimism; we know well St, Vin'-' cent's undying hatred for the harm caused by this teaching and the part he played in its condemnation. Of course, th~ fact is that he saw the priestly vocation through the eyes a saint--in other words, in its true supernatural light. Each priest is individually chosen by God who gives St. Vincent de Paul, op. cir., 6, 155-56. St. Vincent de Paul, op. cit., 5, 569. qualities necessary for his state and the graces to live up to its obligations. It was, therefore, with the express inten-tion of testing the genuineness of vocations and making them effective for leading souls in the path of justice and salvation, that the saint applied 'himself with:unflagging zeal to the establishment of seminaries formed on the Zri-dentine decrees. His first difficulties and reverses in no way daunted him. ., The seminary is of necessity a place of selection and for-mation where~the Church lays on superiors the onus of picking out those really chosen by God in, order that these may be'brought to the height of perfection demanded of them fbr the profitable exercise of their ministry in the world. Selection and formation, therefore, are two essen-tial factors of a seminary which can not be changed. The Church d~mands that this be recognized at all times and under all circumstances. She is guided by Divine Wisdom in the adoption of new methods and their adaptation, de-ciding with loving care how to meet changing conditions. She can never afford to compromise, her fundamental at-titude when dealing with seminaries; according to their state, she flourishes or declines. 'The priesthood is such a high calling, it demands so fine a character, it confers such great powers that it must be the result of a special choice, a special vocation from God. This special vocation is essential to those who are to receive the dignity and exercise the prerogatives of the priesthood. It follows that both the student and the Church should make it their business to find out what the will of God is in each individual case: the student that he may not lightly intrude himself into a state of life so exalted and to which he can lay no claim, the Church that she may not take the risk Of conferring orders on one who has not the necessary requirements. The Church has the strict obligation to seek the signs of a true vocation in all who feel themselves called to the sanctuary. She must make sure, at the same time, that they have the quali-ties which will enable them worthily and efficiently to ful-fill their office. We know that whenever God lays on men such exalted duties and responsibilities, He gives to those so chosen sufficient graces to enable them to carry them out worthily. The candidate puts himself, forward for the judgment of. superiors. It is for the superiors to judge and act accordingly. This scrutiny begins from the time a student first enters the seminary. It ends either with his ordination or with his dismissal as soon as it becomes apparent that he is un-suitable. Each superior in a seminary has his own particu, lar sphere but each, by reason of his sacred trust, has a twofold office. He is to be an educator in the daily task of making a new man out of each of those entrusted to his ÷ + + Ecclesiastical Formation VOLUME 20~ 1961 165 + 4. 4. Sacred Congrega6on oy Seminaries REVIEW FOR RELIGIOUS charge; and he is to be a judge as to whether they are corresponding to the graces they have received, as to their progress or otherwise, as to the evidence of further physi-cal and spiritual develolSment, and. as to their resistance to or inability to profit by the work of formation, it task which can not be shirked. The superiors, in their ac-tions, must be guided by the light of God to whom hearts are open and whom all hearts obey. To evaluate a vocation properly, it is indispensable know the student's whole personality. Taking qualities and abilities singly, considering weak points and defects in isolation, it is possible to be seriously mistaken. These elements must be considered under the aspect of a per-son's whole character-only thus can~ they be viewed their proper light. If we are to reach a-correct judgment on the vocation of candidates for the priesthood, we must not base that jtidgment on first impressions of a particular facet of their character. Rather, we must strive to see the whole person and thus we can reach a balanced estimate of the particular elements which form the,total character. There is a fundamental element in every person from which all the facets of his character spring.It follows, therefore, that the. superior's energy must be directed a profound study of each individual student, maximum importance to,the resourceful energy of the mind which is called will power. For example, some brilliant personalities at first make ¯ very favorable but often they are inconsistent characters who lack the necessary stability and will be unable to face tomorrow's temptations and the great trials of life ahead. They will fall victims to fatal weaknesses altogether much for their defective will power. At other times a. close scrutiny can reveal as' unjustified'the esteem held up then for .the piety or at least the devotional piety of youth who~ otherwise showed no great strength of:'charac-ter. We speak of that apparent piety which is the uncon: scious refuge of the intellectual and spiritual pauper who, once his environment is changed, will stand revealed in his weaknegs, We would insist that superiors watch closely over un-stable natures to see whether this weakness springs only from the youth of the students concerned. This will especially apparent in adolescents. On the other hand, may be a permanent defect of character, as in a youth who will apply himself to a hundred tasks without seeing through to its completion. He may be a pefson of nervous temperament, always vacillating and undecided, who puts one in mind of the: basic neurosis underlying these symptoms. Such characters as ~these, the products of, a world in ferment almost to the point of frenzy, can be blamed for their condition, but they are certainly the most suitable candidates for the ranks of the priest-hood. This requires a strong and even temperament, one ready to endure any sufferings and to take any risks for the advancement of God's kingdom. Therefore, both the who!e.personality and the. many individual traits must be thoroughly.examined, with par-ticular attention being paid to psychological and emo-tional stability. The superior is dealing with the realms of the spirit where the meeting.~of God with man is the inti-mate personal; responsibility of each individual; he must tread warily, making constant use of humble prayer, ap-proaching God with reverence, waiting and listening and sensitive to the-manifestations of His will. Supernatural means must always take the first place, but the aid which the sciences of the educationalist and the psychologist af-ford should not be forgotten. When one's own experience does not suffice, a specialist should be called in. This, of course, must involve no compromise of the faith and nothing which is contrary to Catholic morality must be countenanced. We can never be too careful in such deli-cate matters; this is especially~true because, as competent psychologists tell us, the mental maturity of modern youth frequently lags behind his physical growth---a trap for the unwary who would content themselves by judging from appearances. . In this matter, the Code of Canon Law, c. 973, §3, clearly lays down that there must be "a moral certainty based on positive arguments" . of the candidate's suitability. That is the judgment to be formed before a superior can with a safe conscience advance his candidates to holy orders. If it is impossible :to arrive at this moral certainty, the other rule must be applied, the r_ule stated by Pope Plus XI with equal clarity in his encycIical,letter .4d Catholici sacer-dotii of December 90, 1935: ", . in this [the Pope is speak-ing of dismissal from seminaries] they should keep to the most secure opinion, which in this case is the one most in favor of the penitent, for it saves him from a step which could be for him eternally fatal.''~ The. reason for this clefir~and uncompromising attitude must be evident to all who have at heart the good of the Church whose well-being depends on the qualities of her ministers. In her age-long wisdom, the Church has satis-fied herseIf of the real worth of these qualities, all the more so in view of the heavy burdens she places upon her ministers. Daily, every priest has an enormous weight of pastoral responsibility to bear. The various urgent prob-lems which clamor for his attention create tension and fatigue. He is beset with dangers at every step he takes in a world which is losing its Christian values and submitting ~Acta Apostolicae Sedis, 28 (1936). 41. ÷ + ÷ Ecclesiastical Formation VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation ~o! Seminaries REVIEW FOR RELIGIOUS 168 to a paganizing influence. In view of this, it is no wonder that the Church exercises the greatest caution in the choice of those who are to be her priests. For the sake of her good name in the world and for the common good of the faith-ful, she can not afford to advance to orders even a single one whom she deems less suitable, such is the damage she might suffer at his hands. The unsuitable student of today is the unworthy priest of tomorrow. The Church must train up young men of sound moral fiber, ready to re-spond to the highest ideals, men of deep-root.ed convic-tions, prepared for sacrifice arid self-oblation. Only then does she feel confident in presenting them to her divine Spouse for the seal of ordination. Canon law carries a warning for those who have not a true understanding of the "tutiorism" clearly set forth in both general and par-ticular terms in many papal documents. They can not escape the penalty for defaulters with regard to the canon mentioned above. In fact, they are running a grave risk of "sharing in the sins of others:" All laxism must avoided and no other method or moral system may be countenanced which departs.from the line laid down, es~ pecially when it is a matter of making a final decision on student's ability to observe clerical celibacy. Undoubtedly, some otherwise sound moralists hold opinions which can hardly be reconciled with the "tutiorism" of papal pro-nouncements and repeated above. Unfortunately, there is no escaping the fact that 'in spite of the strict instructions of the Sacred Congregation of the Sacraments (Quara ingens of December 27, 19~0, and Magna equidem of December 27, 1955) not a few candi-dates without a true vocation have been admitted to holy orders. It is not a question of mistakes due to human falli-bility, since on examination of the hist6ry of many ship-wrecks, one becomes perfectly aware that clear indications of a lack of vocation to the priesthood could have easily been noticed during the period of training in the semi-nary. Besides, the Sacred Congregation itself has been able, through periodic apostolic visitations ordered in the vari-ous countries under its jurisdiction, to verify the.fact that not infrequently the fault lies in an inadequate sifting of candidates and the retaining in seminaries of students of little promise either from the human or from the supernatural point of view. It would seem that the policy of many superiors is guided by ~the sad state of dioceses which are hampered by a serious lack of priests. How can one act differently, one hears it asked, when we have not the necessary organization for pastoral work---even for the bare. administration of the sacraments? Is it'not per-haps better to have priests, even if they are not the best type of priests, as long as they provide ior the basic spiritual needs of the faithful? Such a utilitarian concept of the priesthood constitutes a denial of the very essence of the priestly vocation and the priestly ministry. Even if it is true that the efficacyof the sacraments does not de-rive from the goodness of the~minister, yet it is no less a fact that the building up of Christian life is closely bound up with the holiness of God's priests. Their mission, as seen from the Gospels, consists precisely in enlightening their flock and protecting them from corruption, not only iby means of grace, but also by the personal example of 'their lives (see Mt 5:13-14). We must not reduce the priest to the level of a mere bureaucrat of the things of God by ignoring his personal qualities and depriving him of the glory of his intimate union with Christ, a union which consists not only in sharing in His powers but also in copy-ing His virtues. This would be to deny in practice the in-escapable demands of the Catholic priesthood and its transcendent dignity. Preoccupation with numbers regardless of quality is clearly seen to be a mistaken policy. The admission to the sacred ministry of men who are only mediocre is a corrupting influence not only on the zeal of their fellow priests whose apostolic effort is thereby lessened but above all on thd intensity of the religious life of the laity. This last, of course, is a necessary condition for the birth of good and numerous vocations. It is' well to remember that in the ordinary course of events the appearance and develop-ment of priestly vocations d~rive from the personal action and example of the priest as from their instrumental cause. It is an undeniable fact that vocations flourish where there are real men of God~' SuCh men who believe in and love the sublime things they handle show forth in all its pure beauty the ideal which they preach. Acting as poles of attraction, they enkindle the spark of the divine call in generous souls who respond to living example rather than to mere words. Let it therefore be quite clear that preoccupation with numbers, whenever it tends to compromise quality, is self-destructive, slowly but surely drying up the sources of vo-cations and paralyzing the work of divine grace. It shows a weak faith, as we see from the vigorous words of Pope Plus XI, quoting St. Thomas Aquinas: Bishops and religious superiors should not be deterred from this needful severity by fear of diminishing the number of priests for the diocese or institute. The Angelic Doctor, St. Thomas, long.ago proposed this difficulty and answered it with his usual lucidity and wisdom: "God never abandons His Church; and so the number of priests will be always sufficient for the needs of the faithful, provided the worthy are advanced and the un-worthy sent away." . We reaffirm that one well-trained priest is worth more than many trained badly or scarcely at all. For ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 169 4, 4, Sacred Congregation o~ Seminaries REVIEW FOR RELIGIOUS 170 such would not be merely unreliable but a likely souxce of sor-row to the Church,° This Sacred Congregation, therefore, demands with all the force that accrues from its high mandate of watchful-ness, that the most exact and scrupulous care be taken in the choice of candidates. We exhort all those responsible for the task of selection not to minimize in the slightest degree, the wise rules laid down in this matter by Holy Church. Are we to allow ourselves to be overtaken in this respect also by'the children of darkness? We are well aware of the great care these latter exercise in the selection and training of those of their disciples who show the greatest natural gifts and display an ability to influence others; their intention is to use such men to permeate the masses and gain them for their own ends. It is a principle both human and divine that the fate of institutions depends on quality and not on numbers. "Gidedn, with an im-mense host at his command, a host seemingly ready to face any danger or difficulty, hears it said to him by the Lord that in great enterprises, one must count on few, not on many. Selection is the rule of existence, of progress, and of perfection.''7 Let us, therefore, rest our hopes on those alone who are chosen by the Lord. Filled with the spirit of Christ, these men will be the vigorous band who by the integrity of their lives and their burning zeal for souls, will,lead the people of God back to the pure.sources of Christian life, thus ensuring the growth of a vigorous generation of priests. The Training of .Seminarians "To devote oneself to making good priests and~ to co-operate to this end as the secondary, efficient, and instru-mental cause, is to fulfill the very task of Jesus Christ. Our Divine Lord during His life on earth seems to have taken it as His very special work to train twelve good priests, His Apostles; with this end in view, He deigned to stay with them some years to instruct and train them for this sacred ministry." Teachers in seminaries must, then, be intimately united to Christ and must give themselves com-pletely to Him, for their work is the priestly work par excellence, "the most difficult, the most sublime, the most important for the salvation of souls and the progress of Christianity.''s "To make'more perfect priestsl Who can understand' the sublimity of this work?"9 "To make good priests is the greatest achievement in the world; it is ira-e Ad Catholici sacerdotii, Acta Apostolicae Sedis, 28 (1936), 44. ~ John XXIII, "Discourse ~to the Students of the Roman Colleges," January 28, 1960, in Acta Apostolicae Sedis, 52 (1960),272. sSt. Vincent de Paul, op. cir., 11, 7-8. * St. Vincent de Paul, op. cir., 11, 9. possible to conceive anything greater or more impor-tant." 10 For St. Vincent de Paul, therefore, those who have the task of educating candidates for the sanctuary can only be described as the perpetuation of Christ in th.eo~ighest realms of the priesthood. Such m~n carry on the teaching work of our Savior, instilling into the youths called to fol-low Him, those principles which He Himself taught to His Apostles before He sent them out tO procla.,im the message of salvation before men. It follows from this that in the mind of the saint, the seminary must be nothing other than a school in which the students, by means of a fitting preparation, learn those things both human and divine which they will need later if they are to bring forth the fruits of salvation. But they must learn these lessons from their superiors who, for them, stand in the place of Christ and who must be capable of instilling in them the spirit of Christ. The saint's spirituality is vigorous, Some have even con-sidered it hard, but such people have stopped at the mere letter of his vehement teaching without considering the thought behind it. It is true that he never tires of preach-ing reunciation, sacrifice, and detachment from family and from worldly goods; he demands the unconditional surrender of the will; he condemns in no uncertain terms indolence and laziness; he. brands pride as the chief ob-stacle to the triumph of grace in the soul of the priest. He insists on penance as the undoubted means of bearing fruit in the sacred ministry; he exalts the value of suffer-ing, renunciation, sacrifice, and detachment fromrfamily, the complete submission of one's own spirit in order to possess the spirit of Christ. Here we have the pure teach-ing of the Gospel, untainted by compromise or human considerations. It is from the Gospel that the Vincentian method of seminary training gains its strength and vigor. If the saint demands renunciation and sacrifice, he shows them in the light of the love of Christ and of souls. He preaches death too but only as the gateway to a richer life; he too takes the shears to the vine to prune it, to cut away all that is disordered and superfluous, but it is in order that the plant may have a more vigorous growth; he too preaches immolation in union with Christ, but it is as a way of coming to the triumph of the Resurrection at Easter and to the fullness of the Holy Spirit at Pentecost. Because he was intolerant of any form of self-love, including that kind which is more subtle and capable of cloaking itself ambiguously under the most plausible pretexts, he had a heart as vast as the ocean, a heart which was most t~nder, always ready to sympathize with every form of misery, ~°St. Vincent de Paul, up. cir., 12, 14. + + + Ecclesiastical Formation Sacred Congregation of Seminaries REVIEW FOR RELIGIOUS 172 and to beat with a zeal which in him was a devouring flame. Worthy friend of St. 'Francis de Sales, he possessed the delicate virtues of meekness and forbearance; he could rise on the wings of the supernatural over the limitations of human nature and yet stoop with understanding to its weaknesses. He was the Good Samaritan who saw in hu-man nature the humanity of Christ. For this reason he looked upon it with serenity and kindness, seeing it as the necessary foundation on which the dignity of redeemed mankind had to be built. But being conscious of its weak-nesses, he would allow it no more than the role of a means, never that of an end: "For he that will save his life, shall lose it; and he that shall lose his life for my sake, shall find it" (Mt 16:24-25). It is often repeated, and not without truth, that prior to making priests, the teachers in our seminaries should make it their first care to train upright men. The purpose of this assertion is to emphasize the importance of human qualities in the full priestly personality. This is the sincere mind of the Church. She demands precisely the presence of notable natural gifts in formulating a positive judg-ment on the worthiness of candidates, and these are the foundation, the starting point, of the ecclesiastical forma-tion. A vocation does not involve the rejection of the hu-man qualities of man. On the contrary, it places the high-est value on what he is by nature and by grace. The God who gives the divine call is the same God who has be-stowed the gifts and who waits for the day when these talents show their increase (see Lk 19:22 ft.). Grace does not destroy nature; but, according to a Thomistic princi-ple so very fertile in the field of theology, it restores, puri-fies, elevates, and transforms nature. Moreover, it can even be said that, in the ordinary course of events, nature con-ditions grace inasmuch as the action of grace is facilitated where human qualities abound, whereas it is stultified where human qualities are lacking. Consequently, any-thing which is contrary to nature has no part in Christian and priestly virtues; and any educational system which dis-dains natural virtues, even though it be presented under worthy pretexts, would be unreasonable and confusing and fraught with dire consequences. It could become the rock on which the frail barks of many vocations, guided by inexpert helmsmen, would founder. Much more en-couraging is the exhortation of the Apostle: "For the rest, brethren, whatsoever things are true, whatsoever modest, whatsoever just, whatsoever holy, whatsoever lovely, what-soever of good fame, if there be any virtue, if any praise of discipline: think on these things" (Ph 4:8). A wise teacher, then~ conscious of his responsibilities with regard to his students and in the eyes of the Church, will consider with religious care the individuality of each one and will know how to accept, stimulate, and develop the precious per-sonal gifts of each character. However; there has arisen today even in ecclesiastical circles an excessive tendency to ghrink from these duties as educators and to submit ~' ~l~e iiadividualism df oi]r mod-ern youth who seem intolerant of all discipline. There is much talk of how the child must be prepared for future responsibility by reducing restrictions in the field of edu-cation. In the community as a whole, self-government, the vital spirit of democracy, and group decisions are widely praised. This involves an ever decreasing guidance or so-called "interference" from superiors. They accept, that is, if not in theory, at least in practice, the conclusions of certain authorities whose theories, though much in vogue, are nonetheless reprehensible: We may rightly include under this category, those modern theories which, though presented under different names, agree in regarding it as fundamental in all forms of education that children should be allowed to mold their characters entirely at their own will and discretion, Advice from teachers, or elders is rejected and no account is taken of any law of assistance, human or divine. '. Unhappy illusionl Claiming.to emancipate the Child, they enslave'him; they make him a slave to arrogant pride and irregular desire, to a pride and passion which, if their system is true, are to be approved as the needs of an autonomous human nature?a Such theories owe their origin to an over-optimistic con-cept of human nature. They do not appreciate the frailty and inadequacy of man, nor, in his fallen state, his need to be ruled if he is to achieve self-control. This is above all the case with adolescents and young people who are natu-rally immature and often lured by merely transient en-thusiasms and torn by conflicting emotions. "The same thing is not possible for one who has a virtue and for one who does not have it; so too the same thing is not possible for a boy and for a perfect man".''~s If they lack singleness of purpose and perseverance, our students will never be able to control their impulses. In all kindness they must be made to accept subjection to rule and to realize the force of law. In this way, they will acquire deep-rooted habits which will neither stifle thei~ conscience nor restrict their liberty, but which are, on the contrary, the source of freedom and a guarantee of its ex-ercise. There is no doubt that the authority of the su-perior should control the liberty of the student but always in an atmosphere of mutual confidence, active collabora-tion, and charitable understanding. Thus[ the student's development will not stop short at mere p~assive submis-sion, bu.___~t will go to the very roots of his personality. n Pius XI, Divini illius Magistri in Acta Apos,tolicae Sedis, 22 (1950), 69-70. = St. Thomas Aquinas, Summa Theologiae, 1-2, 9.6, 2. + + + Ecclesiastical Formation VOLUME 20, 1961 173 Sacred Congregation of Seminaries REVIEW FOR RELIGIOUS Therefore, we can not approve of the attitude adopted in some institutions where there is not the necessary in-sistence on the fundamental value of the rule in the for-mation of young men for the Church: Discipline is the rule .of life and the way of virtue. If a rule life is necessary for men in general, how much more necessary is it for those called to the priesthood. Therefore, the discipline of the seminary and the observance of rule, even on minor points, should be close to the heart of every student. Superiors are necessary just as Supervision is necessary, but clerics should behave and fulfill their duties without the need of a superior to watch over them.= ~'o ask young students still in the process of formation to carry out their many duties without the help of a full and'detailed rule, to refuse them the benefits of a well ordered discipline, is to leave them a prey to uncertainty and to deprive them 6f an atmosphere which would be most helpful to their own personal efforts. The daily "bearing and forebearing" of a rule observed in detail will bring much fruit. It will develop reserves of will power; will prepare characters of strength and perseverance; and it will foster balanced and methodical minds, minds which will be able to remain master of themselves and control the situations which inevitably arise from the clash with the difficulties of life. We repeat therefore: It is one thing take care that our students, while being obliged to carry out their duty even to the smallest detail, are imbued with right principles both human and divine such as will en-able them to assume responsibili'ty in the future; it is an-other to exclude or compromise the actual value of the obligation. If discipline is to be fully effective, individual teachers must not operate in isolation. On the contrary, one must work together with his colleagues, taking c~re, however, not to intrude unduly in the province of any other. With this collaboration and guided by like con-victions, all can work for the progress of the seminary as a whole. We do not intend to evolve these ideas fully here. But, unfortunately, we must take notice of the fact that natu-ralism seems to have penetrated even into some institu-tions for ecclesiastical training. This has been partly due to those who universally condemn the past as unsuited to the task of forming new generations of young priests and who eagerly search for "up-to-date" methods. Yet an-other cause is the rather fatalistic passivity of those who indeed regret in their heart of hearts this dangerous in-novation in the field of education but still accept it as the inevitable consequence of living in our times. In these instances, there is evidence of a gradual decline which ~ St. Plus X, "Discourse to the Seminaries of Milan," October 14, 174 1908, in Enchiridion Clericorum, n. 827. seems to be affecting every aspect of ecclesiastical educa-tion. The common factor in the whole process seems to be an apprecxable lessemng of the supernatural element. The true foundauons of genmne oecclestast.lca! education prayer, intimate union with Gbd, a spirit of mbrtifica-tion, humility, obedience, withdrawal, and. s.eparauon from the world are retreating ever more into the background to be.replaced by externahsm under the g~ ~se of chanty. The intention is to '~'understand" our' era and the new generation. In reality, it only means givi~ng way to its Shortcomings. One has the impressi6n that teachers, far from exercising restraint, have encouraged and even be-come. obsessed with what is novel and untried. They are concerned rather to grant what would most ~tplease the stu-dent than to insist.on what wouldbe most beneficial, and they have not the courage xo ask.for self-dehial and sacri-rice. ! ¯ But Christ asks for both ~self-~en~al and s crifice. "Deny yourself'.' (Mr 16:24) is at the root of all Hislteaching, and ~t contains the,key to the secret of Christiari vocation and above, all the priestly, calling. The priest is the man of sacrifice, chosen to fill up by his own suffering, sacrifices, and his daily self-immolation that which ~s wanting m the sufferings of Christ (see Col 1:1 2 ) . H . eI ~Socalled to,bear fruits of grace; but without the Cross therelcan be no re-demption (see Heb 9:22). He is called to be alshining'light, but this can only be if he is aflame,with the spirit of self-sacrifice. We need hardly say that this liker~ess to C~hrist, Priest and Victim, must begin in the semirlary.We well realize how long the road is and how strong the resistance of human nature, for many "follow Jesus to the breaking of bread, but few to the drinking of the chalice~of His Passion.TM It is essential, therefore, that ou} students be-gin their self-denial and sacrifices from the loutset. Thus they may come to understand the truth and joy contained in these, words: I But blessed is that man who fir thee, O Lord; abandons all things created; who offers violenc~ to nature and through fervor of spirit crucifies the concupiscence of. the flesl~, so that with serene conscience he.may offer to thee pure prayer and become worthy to be admitted among the choir of angels, having ex-cluded himself both exteriorly and interiorly[ from all the things of earth.~ ., Above all, we must insist on the conflict which Christ Himself emphasized, between His ~spirit andI the'spirit of the world, the world for which Christ did[not wish to pray since it was already permeated wit[i the[spirit of evil and hardened against grace. Therefore His o~n must not :: ~.hKOemma~S,~.'~e:sP.i~, Zmitation o, Christ, ~, 1,, 1. " " P'o , o ¯ I 4. + Ecclesiastical Formation . VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation oy Seminaries REVIEW FOR RELIGIOUS be of this world, just as He Himself was not of it (see Jn 17:9 and 14-16; 1 Jn 5:19). They must appreciate that they are consecrated ~o the things of heaven and that al-though taken from the world, they are no longer of it. Only as they detach themselves from the attractions of the world, from its principles, from its methods and from its facile compromises, will they become the salt of the earth and the light of the world. They must be made to realize that a priest does not cut himself off from his own times simply because he refuses to accept their fallacies. In a word, "the man dedicated to the Church, walks indeed this earth, but his mind and heart must look to heaven.''le Likewise in the delicate question of the students' as-cetical training, it is necessary to move slowly and with discretion and to maintaina gentle but firm hand: "ford-ter in re, suaviter in modo" or, to quote our saint, "firm-ness and constancy regarding the end, sweetness and hu-mility regarding the meansY This simply means that we must go back to the' life and teaching of our Savior which, if well presented, exert an irresistible attraction on the minds of the young. Nothing can equal these pure founts. Our students must be led to a spirit of intimacy with Christ, they must live according to that spirit which brings truth and freedom. They must believe in Christ with that strong faith urged by St. John (14:1), that faith which im-plies an unquestioning acceptance of His word, complete. confidence in His help, and a loyalty and correspondence with grace, even to forgetfulness of self. Through 'their daily contact with their Divine Master, they will be im-pelled to be more like Him (see 2 Cor $: 18), to assume His spirit, and thus gradually to achieve "unto a perfect man, unto the measure of the age of the fulness of Christ" (Eph 4:13). This seems to us to be'the royal way, in fact, the only way, in which our students can be made into the apostles of the future, "perfect men, furnished to every good work" (2 Tim 3:17), who will contribute successfully towards "the edifying of the body of Christ" (Eph 4:12). In fact, zeal for souls has always been nourished by a deep spiritual life and by a mortification which is wholly directed to- Wards personal holiness. But there is always a danger of destroying in a short space of time what has taken much labor to prepare. We are referring especially to the impatience, so common these d~ys, whereby our young students are submitted too easily and without the necessary precautions to trials which are beyond their strength. The aim of this, it is said, is that they may become aware of the surroundings 1e John XXlII, "Discourse to. Roman Colleges," in ,4cta Apos- 176 tolicae Sedis, 52 (1960), 262-70. advocate this method deceive themselves inl thinking that I in this way they are securing students against the dangers they are bound to meet with and that at ~he same time they are arousing in them at an early stage, [ m action and by action," the spirit that must animate their future apostolate. Yet they flatter themseh, es th~,t the diocese will thus be supplied with better priests; priests who from the beglnmng of their pastoral work will b'~e able to pro-duce more results and better results; priests who are .in the public eye, leaders of men, who are inla position to bear faithful witness to the Gospel. This policy of haste is not only based on a!mistaken ner-spectlve, ~n so far as it gxves first place to what must neces- I sarily take second place both in importance and in se-quence; but m addmon ~t presupposes somethang whxch does not exist at all, namely, a sp~rxtual, ~nt~ellectual, and moral maturity that is essential if this exper~.ence of which we speak is to be of profit. What is more, it distorts the nature and aim of the seminary as conceived by the Church's legislation. The seminary is not a~ad never can be a place for testing theories and still le~ss a training ground for dangerous and compromising actxwues. It can be nothing other than a home for deep ~piritual and intellectual formation. O1: course, the futureI apostolate is and, must be a source of inspiration, but anyI practical ex-perience must come by degrees and only when the student has reached the requisite standard. Such is th~ mind of the Popes. They are so concerned with keeping the true aim of the seminary intact that they visualize a particular in-stitution with the specific task of initiating the young priests into the various fields of the apostolat6. In this way the transition from the quiet of the seminary is brought about naturally and, with a more adequateI preparation in theory and practice, the danger of eventual spiritual unbalance is precluded,x7 | TO destroy the whole balance of the life~of our semi-naries and their proved worth on the plea of a~n imaginary "apostolate of action" must of necessity do ~mmense harm~' Indeed, it is to be feared that, if priests of t~e future are trained by such a method based on activity, they will not be able to perform really fruitful apostolic ~lwork. They will not be able to surmount difficulties andl discourage-ment and will fall an easy prey to the moral ihstability of ttle restless and treacherous world in which ~ve live. Ex-perience teaches that the bridling of the passions is an interior achievement that must be accomplished in the secret depths of the soul. It takes place slowly ~nd only by a~ See Menti Nostrae (Acta Apostolicae Sedis, 42 [1950] 691-92) and the motu proprio Quandoquidem (Acta Apostolicae S~,dis, 41 [1949], 1.65-67). 4. Ecclesiastical Formation VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation oJ Seminaries REVIEW FOR RELIGIOUS means of reflection and recollection. If we allow our stu-dents to throw themselves into external activity, if we leave them free to indulge in that kind of enthusiasm which could easily lead them away from their strict but necessary life of piety and study--even if it is to gain experience of the apostolate---does it not mean, perhaps, that we are drawing them away from their day to day formation which is nourished on prayer, study, and sacri-fice? And at length when their training in the seminary is at an end and they have to face the serious reality of life without sufficient preparation, is it not to be feared that passions suppressed but'not truly subjugated will return? The results of such an education can be observed while still in the seminary. A weakening of piety, a lack of in-clination for all forms of study and especially for specu-lative thought, a discipline that is undermined at its very foundations, and, above all, the appalling superficiality that is found in various branches of education--surely these things are incapable of producing true apostles for the Church. Here we can appropriately quote a saying of St. Vincent de Paul. It can serve as a general rule of- be-havior but it has a special value :when applied to educa~ tion. "Good works fail because people act in too great haste, because they act on their own impulses. This haste has the effect of obscuring the mind and reason and pre-sents the object as possible and opportune. It is not so, and subsequent failure makes it evident.''is Accordingly, rather than use doubtful methods to train a priest just for the present, we must make every effort to form one who will be a priest forever. Conclusion I Your Excellency, before concluding this present letter' in which we have sought to express our concern on cer-, tain matters, we can not but address a last word to the teachers in our seminaries. Whatever position they hold, they are well aware of the seriousness of their duties and of the great responsibility "they bear before God for their students, whom they are seeking to train for the high office that awaits them. In this .unremitting yet hidden toil, which often brings little human satisfaction though it earns much merit, they must never forget their great aim. We are all fully convinced of the importance of en-vironment. Therefore the good will of the students must be encouraged and they must be helped at every stage, of their path towards priestly perfection with all the a.ssist: ance they require. Above all, we would wish that the golden words of Pope Leo XIII be engraved in the hearts of all: 178 nSt. Vincent de Paul, op. cit., 4, 122. n their own field, a personal example of a full, priestly life. l'he example of those in authority, especially for the young, is he most eloquent and persuasive way of convificing them of heir own duties and of fostering a love of wrtue. It is good then that teachers in our semin~aries should se outstanding for their natural gifts, w.hich can win for hem the esteem and trust of their pUpils.°But~ at the same ime, they must realize that natural qualities hnd achieve-nents are of httle use ff they are not ammated by a deep plr~tual hfe. Only th~s can ensure that their work will be ,f real value and bear fruit. The Dlwne Maste.r who dwells n our hearts and speaks to us there "Christ is our ! eacher and He is within us"=0--will be ev, er ready to ,less, increase, .and perfect their work which, by the "rovidence of God, is destined to spread thd mystery of ~Iis Love. We are certain that Your Excellency will ~.ee that this etter be brought to the attention of the superiors of your emmary for their careful cons~deranon. At the same ume, -¢e gladly take this opportunity of express~,ng tO Your ;xcellency our feelings of highest esteem. Rome, Sep-ember 27, 1960.] Yours devotedly in our Lord, JOSEPH Cardinal PIZZARDO, Suburbican Bishop of Albano, Prefect. DINO STAFFA, Titular Archbishop of Caesarea in Palestine, Secretary. Leo XIII, Fin dal principio in Acta Leonis XIII, 22, 254-55. St. Augustine, In lo, 5, 19 (PL 35, 1557). ÷ ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 179, JAMES I. O'CONNOR, S.J. Some Aspects Religious Authori9 ÷ ÷ ÷ James I. O'Connor, S.J. is professor of canon law at West Baden College, West Baden Springs, Indiana. REVIEW FOR'RELIGIOUS In the Church there are different kinds of authority, One form of authority is called jurisdiction and is the pub lic power of ruling or governing others. It is called publit because it is a power belonging to a perfect society for tht direction of its subjects to the end for which the saic society was constituted. Thus defined, it is a power which belongs both to the State and to the Church. If we narro~ our consideration to jurisdiction in the Church, we can de fine it more fully as the public power of a legitimate su perior, granted by Christ or by His Church through ~ canonical mission, of governing baptized persons to tht achievement of their eternal salvation. This power, native to the Church by reason of its con stitution as set up by Christ, can be and is shared by tht immediate or constitutive parts of the Church by reasor of a canonical mission for the attainment of the purpose o~ the Church. Immediate parts of the Church are diocese: and the clerical exempt religious institutes, As a result! local ordinaries and superiors in clerical exempt religiou: institutes possess true jurisdiction, although the bases art different in each case: in the first case, it is territorial; ir the second, personal. Other moral persons in the Church do not possess juris diction because they are not immediate divisions of tht Church; that is, they are subject to the authority of ar immediate section; "examples of such are parishes, none exempt religious institutes, and so forth. Consequently~ such divisions are sometimes called mediate sections of tht Church. If such a division has jurisdiction, it is by specia~ grant, not by reason of its nature. Within the perfect society which is the Church, w~ find also other societies which are imperfect in the sens, that they are not self-sufficient and are not independen'li although they have a purpose of their own which, how. ever, is a means to obtain the purposes of the Church. Ex amples of such societies are religious institutes. Therefore, ander different aspects, clerical exempt re'ligious insti-tutes are both immediate and mediate sections of the Church whereas all other religious institutes, are mediate ~ections only. Just as the Church in itself and in its cons,ututive divi- ,ions has authority to govern its subjects (and such power I s called jurisdiction), so also the mediate secuons must have and do possess authority for their proper govern-ment. Since this latter authority ~s not jur~s~hct~on, It ~s :alled dominative power. Both types of powerlor authority are set down in canon 501, §1 of the Code of Canon La¯ w: 'The superiors and chapters, conformably to the consu-tutions and to the umversal law, have dominative or .z°vernin~'o~-r~°wer over their sublects,o and .in eve~ ~ exem p t :lerical institute, they have ecclesiastical jurisaiction in both the internal and external fora." ~i UP to the present century, by way of to juris-cfion as a 'public power to govern, dominhtive power as often called a private power. It was calledI dominative power because it was understood as the power or force .~xercised not only on the matter or content ~of the com-mand- theth "ing to be done or not to be done--but also ~n the will of the subject so that the will oflthe subject igree with that of the superior. Perfect s.u~bjection or ibedience brings the intellect of the subject xn,to harmony qith that of the superior insofar as such subjection may )e possible ~ in view o~ the evidence presented to the in-ellec~. By way o[ further distinction, a third kind 6f authority vas recognized by some writers. They called ~it domestic ~ower or authority. This is the power, for exar~ple, ~vhich ~ religious superior exercises over lay peopleI who work or the community; it is also the power of a ~resident of ~ commercial firm, or the supervisor of a hospital floor or . he head o[ a department has over the employees, It is the ~ower or force over the matter or content of the command ,nly--the thing to be done or not done; there ~ no power ,ver the will, much less over the intellect of th~ employee. While these were the usual distinctions of r~ligious au-hority, they did not cover all the authority of a religious uperior, even in a non-exempt institute. A r~,ligious su- ,erior has authority over many things which ,do not fall .nder dominative and domestic power as described above. 7h ose powers all deal w"~th phy"sical persons~, iwith in" d~- iduals. Some illustrations of a religious superior's au-orxty not exercised over lnd~v~duals as such, at least dl-ectly, are the following: admission to the no,~t~ate and ~ religious profession; limited power to dispense from n.pediments to such admission; administration, of the re- .g~ous community as such; administration of the tern- Religious Authority VOLUME 20, 1961 + 4. 4. James I. O'Connor, S.J. REVIEW FOR RELIGIOUS 182 poralities of the entity over which one has authority, example, to contract loans, negotiate sales, lease property and so forth. What kind of authority is this in the case a superior in a non-exempt religious institute? For centuries it was very disputed among canonist., whether such authority was part of the dominative powel of religious superiors.1 Spearheaded by Father (now dinal) Larraona,~ the opinion that such authority was anc is part of the dominative power of a religious superiol gained ground in the present century. As a result, the olt description of dominative power as a purely private powel had begun to fall by the wayside and certainly seems belong there in view of a rather recent reply from tht Holy See. The power in a society has to correspond to it nature. That nature is public since religious institutes art set up by pontifical authority .as a public state of life More%ver, the Church through lawful representatives r ceives-the vows of such religious and these vows are publi both in themselves and in their effects (Canons 488, 1° 1308, §1). Canon 501, §1 acknowledges only two kinds o authority in religious life: jurisdiction and dominativt power. Since in a non-exempt institute the authority is no jurisdiction and since the power over such things as tern poral administration is not a private power, dominativt power must now be classified in two forms: public ant private. Relative to jurisdiction, many questions can arise; fo~ example, kinds of jurisdiction, delegation and subdelega tion of jurisdiction, conferral of jurisdiction in cases whert a doubt is had as to whether a person possesses or cat possess jurisdiction, conferral of jurisdiction on a persor who objectively does not have it but is commonly believec to have it. All these, as well as some other aspects of juri diction, are nicely provided for in canons 196 to 209. N such provision was made in canon law for correspondin' questions pertinent to dominative power. Nevertheless the same questions.and problems can and do arise fo non-exempt religious superiors. All the discussions which proposed solutions to suc] vexing questions were finally brought to an end by al affirmative reply of the Pontifical Commission for th Authentic Interpretation of the Canons of the Code c Canon Law. An affirmative answer was given on March 2~ 1952, to the question: "Whether the prescriptions c 1Those interested in this dispute and the development of th notion of dominative power are referred to a study by the preser writer, "Dominative Power of Religious Superiors," which was pul fished in The Jurist, 21 (1961), 1-26. ~ "De potestate dominativa publica in iure canonico," in Congressus luridici Internationalis, v. 4 (Rome: Pontificium Insl tutum Utriusque Iuris, 1937), 145-80. canons 197, 199, 206-09, concerning the power of jurisdic-tion, are to be applied, unless the nature of the text or context of the law prevent it, to the dominative power which superiors and chapters have in rehg~ous institutes and in societies of men and womenliving in 'common with-out public vows?''a Many religious superiors seem never to'.have heard of this reply, much less of the canons cited, their wording, and their interpretation. Therefore, we shall :first give an Enghsh translauon of those canons, substa, tuung dorm-native power for jurisdiction so that it will be easier to read, understand, and, later, comment upon them. Canon 197, § 1. Ordinary dominative powei: is that which the law itself attaches to an office; delegated]power is that which is committed to a person, §2. Ord:'.nary power can be neither proper or vicari-ous. Canon 199, §1. One who has ordinary dom,inative power can delegate it to another totally or partial,ly, unless the law expressly provides otherwise. §2, Moreover, dominative power which ,has been dele-gated by the Apostolic~ See can be subde~egated for a single act or habitually, unless the delegate was chosen be-cause of his personal qual,ficauons or subdele.gatmn is for, bidden. §3. Power delegated for a whole class of. cases by one who has ordinary power but is subordinate t0 the Roman Pontiff can be subdelegated in individual cases. §4. In other cases, delegated dominative power can be subdelegated only if subdelegation is expressly permitted. §5. No subdelegated power can ~n turn be subdele-gated unless the power to do so has been expressly granted. Canon 206. If several persons have been d~legated suc-cessively, that one must execute the busines~ whose com-mission was given first and has not been expressly re-voked by a later rescript. Canon 207, §1. Delegated power ceases to exist: by fulfillment of the commission; by lapse of time or by exhaustion of the nut Lber of cases for which it was granted; by cessation of the reason for the delegation; by revocation by the delegator together with lirect notice to the party delegated; or by renunciation on the part o[ the one d, elegated to-gether with direct notice to and acceptance ~by the dele-gator. However, delegated power does not cease with the expiration of the authority of the delegator ekcept in the tw~ cases mentioned in canon 61 . 8Acta Apostolicae Sedis, 44 (1952), 497; T. Lincoln Bouscaren, S.J., Canon Law Digest, v. 3 (Milwaukee: Bruce, 1953), 73. + 4. 4. Religious Authority VOLUME 20, 1961 183 4. 4. ]ames I. O'Connor, $.]. REVIEW FOR RELIGIOUS 184 §3. When several persons have been delegated cor-porately, if one of them loses his power, the delegation of all the others also expires, unless the contrary appears from the tenor of the delegation. Canon 208. In accordance with the norm of canon 183, §2, oidinary power does not expire with the expiration of the authority of the person who conceded the office to which the power is attached. However, it does cease with the loss of the office and is suspended by appeal made ac-cording to law, unless the appeal happens to be made with-out suspensive effect, saving the provisions of canons 2264 and 2284. Canon 209. In common error or in positive and proba-ble doubt of law or of fact, the Church supplies dominative power for the external forum. We shall now give some commentary on each of these canons as well as illustrations of their application and non-application. Canon 197 The word ordinary here is a technical term and is not to be confused with our everyday usage of the word as meaning usual, regular, habitual, and so forth. For power to be ordinary two things must be verified: 1) the power must be given by the law itself, whether that law be the Code of Canon Law or the constitutions, which are the particular law of the religious institute; 2) the power con-ferred by this general or particular law must be attached to an office in the institute. An office, as canon 145, §1 tells us, is a function permanently established by divine or ecclesiastical ordinance, conferred conformably to the sa-cred canons, and carrying with it some participation in ecclesiastical power of orders or jurisdiction, or (now in virtue of the 1952 reply) dominative power. Thus, the power of a superior to govern the house or the province or the whole institute is ordinary dominative power be-cause the power is conferred in canon 501, §I of the code and is attached to the office of superior, no matter who may be the incumbent .in the office. The details of that power are partly spelled out in later canons of the code and partly in the constitutions. Some examples of ordinary power from the code are: government of the community over which one is superior; administration of the temporalities of the entity in which one holds office; admission to novitiate and to religious profession; limited prolongation of postulancy, novitiate, and temporal profession; anticipation of renewal of tem-porary profession; change of cession and disposition of one's property; admission of outsiders into cloister in certain instances; egress of religious from cloister under certain conditions; exclusion from renewal of temporary vows or admission to perpetual vows; in all communities, the conduct of the preparatory process fo~/ dismissal of perpetually professed members and, in diocesan law in-stitutes, also that for dismisSal of temporaiily professed members. Not every superior ~has all these powers: some be-long only to the superior general; others ark had also by provincials; still others are possessed by the 16cal superior. Just which superior, alone or conjointly with! another, has these powers must be learned: from reading ~he code and the constitutions. ~i. Some common examples of ordinary power from par-cular law, that is, the constitutions, are: reception of isitors; going out to visit; making trips; dispensation from disciplinary articles of the constitutions; and ]o forth. The details determining the exercise of such po.wers will, in each case, have to be gleaned from the constitutions. Delegated power is defined in the canon. It is any power ~or ta bueth iomriatyg iwnehdic, hw iist hnoout to crdoinnsairdye.r Dinegl etghaet ep~lr psoonw eorf cthane ~lelegate whereas ordinary power can be conceived even though nobody holds the office to which the law attaches ~1 e authority. Ordinary power ~s inherent ,to the office; ~elegated power must always be invested in aI person. r Delegation is conferred by word of mouth or in writing wh l"ch may be the written law itself or some other form of ocument or rescript. A rescript ~s s~mply a written reply to a question or petition. Delegated authority must always be given expressly. Express conferral may be explicit or implicit. Explicit :lelegation is had when the superior in so many words nforms another that he is hereby given suct~-and-such a ~ower or faculty or authority. Implicit delegauon is ~ower of authority or a faculty which ~s not conferred in o many words but which is contained witl~in another ~ower or faculty explicitly conferred which, m turn, can ~ot be exercised either at all or, at least, not ade-quately unless the other power or facul'ty is also ~ossessed. In such a case that other power or faculty s implicitly conferred. Thus, for example, a supe- "ior delegates a subject to investigate a t~oublesome ~tuauon and take care of it. This is explicit delega-ion. When the investigation is made, the delegate finds hat the effective way to correct it is to revoke ~ delegated aculty of the party concerned or to impose a penance. qowever, the superior did not tell the delegate he had he power to revoke in one instance or to punish in the ~ther. Nevertheless, since the superior delegated the per-on to take care of the situation, implicitly ~e thereby lso delegated to him all the power necessary to effect that vhich was explicitly delegated. Delegated authority is not to be confused with pre-÷ ÷ ÷ Religious Authority VOLUME 20, 1961 185 + lames I. O'Connor, S.]. REVIEW FOR RELIGIOUS 186 sumed authority. In the case of presumed authority, the person making the presumption can not contact the party having the authority. Further, after weighing all the cir-cumstances and what is sincerely believed the superior or official would do if asked, he draws the conclusion that the authority would be granted if the superior or official could be contacted. Such action is very different from the express grant of authority made by the superior or official to a definite 'person or group of persons. What power can be delegated will be taken up under canon 199. Ordinary power is said to be proper when it is possessed and exercised in one's own name. Hence, the authority given by the code or constitutions to the superior general, the provincial, and the local superior is both ordinary and proper. Vicarious power is ordinary because the law, especially the constitutions, provides for the office of vicar and the authority of the vicar is determined and conferred by the law itself. However, vicarious power differs from proper power in that the former is not exercised in one's own name but in the name and according to the mind of the superior whose vicar this party is. As a result, when the superior can not discharge his office, for example, because absent from the community or because confined to his room by sickness, and so forth, the vicar becomes acting su-perior and has most, if not all, of the authority of the su-perior. But this authority must be exercised as the supe-rior himself would exercise it. Consequently, the vicar may not take advantage of his position to change the policies established by the superior, even though the change may be desirable. Likewise, he can not grant a re quest which has been already refused by the superior. Moreover, as soon as the superior is again able to discharge his office himself, the power of the vicar ceases because the function of the office of vicar ceases. Vicarious power and delegated power are alike in that in both cases the power is not proper and so is exercised in the name of another. These powers are unlike in tha! vicarious authority is annexed by and spelled out in the law whereas delegated authority depends totally on the will of the delegator as to what authority is possessed. Th~ two forms of power also have different norms as to when and how they are terminated as will be seen by comparin~ canons 207 and 208 as well as what was said above abou~ the cessation of vicarious power. In the light of these distinctions between delegated, Vi carious, and proper power, it seems worth while notin~ that in orders and congregations having a hierarchica form of government, the local superior in regard to hi own community is not a vicar or a delegate of the pro vincial or general superior. This point is explicitly se down in article 312 of the Normae drawn u~ by th Sacred Congregation for Religious. Some . superiors seem not to be aware of the position legally held by the local,superior. This Is especially, true when, the major su-perior drops in~ on the local community either merely for a stopove;,or for a canonical v, isitation. ThE local superior is and remains the true superior of the lo~al community and still possesses and has the right of exercise of all the authority cgnferred on a local superior byI the code and by the constitutibns; The Norma~ in article 265 e~plicitly state thav a provincial or general superior ,can not at the same time be a 19cal superior. A very immediate~and logi-cal ~onclusion follows from tha~t premise: Itherefore, the major suoerior can not take over the functions of a local superi~r.'O'ne,can not.lawfully discharge tl~e function of an office one'does not and ~n h~t ha~. , The only ~xception to this ge~aeral rule islthat in which the local c~mmunity is composed only of m~mbers of the provincial or general curia. Even ~n such cases, ff the com-mumty ~s large, as it ~s in some orders and congregauons, a special religious ~s appointed to be the local superior of the house since such work would notably interfere with the prlnc~paJ wo.rk 9f the major sqpenor m the admxms-tration of the province or institute. A word of caution o~ught to be injected here. There are some "active'-' communities which seem n_ot ~to be obhged by, the~above norms because their local superiors have on!y thg authority th,e top sup.eripr grants the~m. However, such communities do not have the government olan of the ordinary order or congregation. Theirs is [1~ monastic form of government inowhich there is only lone superior who is the equivalent of the abbot or abbess in a ~trictly monastic con~munity. What look like local-~ommunities are not such, canonically; they are not separate moral or jund~c.al~persons. As a result, the superiors" of such houses, are not true superiors in their own right but are vica~rs qr delegates of the one and only true superior. Their authori~ty, then, is only what th,,e one superiorl gives them. Canon !~9 . This canon sets down the rules governing tlie' delegation of authority. In the first place we are told that everybody who has ordinary dominative power can delegate any part of it or the whole of it to another person unless the law, namely the code or the constitutions, expressly declares otherwise. In the absence of a contrary reqmre, ment ~n the law, the delegator may delegate any person competent [or th e assi"gnment, whether the delegated party be a mem-ber of t e ~nst~tute or not. Hence, a qualified s~uperior can delegate the priest who comes to say the community Mass to receive the vows of one of.the commumty. ,Whale the canon does not put a time limit on the duration of the Religious Authority VOLUME 20~, 19bl 187 James 1. O'Connor, $.J. REVIEW FOR RELIGIOUS delegation, even when all the authority of a sup6rior or official is delegated to another, it is usually p~inted out'by moralists and canonists that such unlimited delegation of all authority is an abdication of one's own resppnsibility. Therefore, delegation of total authority should be granted for a fiXed time only and, ordinarily, for a comparatively short time. ' ~ Delegated power can be used in any legitimate way un-less the manner of use was also defined at the time of dele-gation. When delegation is made, the terms of delegation should be clear to both delegator and delegate so that all doubts and misunderstandings can be avoided. In this first paragraph of canon 199 the solution is of-fered to many problems of superiors. So very often supe-riors, and especially local superiors, complain that the), have no time to be a real superior, to be a mother or father, ~s the case may be, to the members of the community be-cause their time is largely taken up with granting routine permissions, distributing articles, for example, writing supplies, dentifrices, ~ind so forth, so that there is very lit-tle or no time left to help subjects with doubts, questions, and problems. One way of getting that necessary time is to delegate some one or more persons in the community to grant those routine permissions, to distribute articles to the members of the comm~unity, to handle the mail, and so forth. Heretofore some superiors doubted whether they could use such a means as delegation) Whatever grounds for doubt" existed earlier, there is certainly no basis' for such doubts since the 1952 reply of the Code Commission. In as much as the right to delegate is granted by law to all having ordinary power, this power to delegate is itself part of that ordinary power and the superior needs no approval of a higher superior if he chooses to delegate his authority. It may be that a superior in one institute can not delegate to the same extent as a superior in another in-stitute because of a limitation contained in the constitu, tions which is not found in the second set of constitu(ions. Such a limitation, however, has to be found in the law; otherwise there is no restriction except, as previously noted, in the case of delegation of total authority for an indefinite period of time. Occasionally a superior is afraid to delegate authority because he fears the delegated party may use poor judg-ment, abuse authority, and so forth. This simply means that the superior should be as careful as possible in" the selection of the person to be delegated. Sometimes this is the only real way to find out what a given person will do with authority. Secondly, if such faults occur and the dele-~ gate does not amend after advice and correction, since the authority belongs to the superior, just as that authority Could be delegated, so also it can be revoked at any time the delegator judges it should¯ Conseq.u1e tnht dyl, e e e-gator never has to feel that once authority is delegated, it is gone forever from his control. The second situation in which delegation is allowed by general law is that in which~:tileHdly See d~leg'a~t~s an in-fervor, who, ~n turn, may pass on delegation to a third party. Such delegation of delegated power is called sub-delegation. Subdelegation can be granted either for a soli-tary case or for all such cases unless the Holy See's con-ferral of delegauon exphcltly states that the delegate has been chosen because of his personal quahficat~ons or un-less the Holy See exphcltly forbids subdelegauon. To date, there is no general grant of delegation of dom~na-ttve power by the Holy See to all'religious superiors. An examrfle of such a general grant of delegatei:l ]urtsd~ctton ~s the brochure of qumquenmal faculties to local ordi-naries, some of which can not be subdelegatedA Another occasion in which subdelegationlcan be made is found in canon 199, §3. Here the original delegate re-ceives his authority from a person who posse.sses ordinary power 'but who is a. subordinate, of the Holy See. More-over, the delegate must have authority over a whole class of cases or business. In this situation, the del~egate has the authority from the code to subdelegate t~artt or all of his authority to a given individual for all cases! or only one case, or he can subdelegate many persons forI one case. There are or can be a number of instances in which this law can be applied. Perhaps the best exampl~ is that of a hospital administrator or a college or university president, The ultimate responsibility for the hospital br school be-longs to the superior. However, because ofI the load of work involved in functioning as a religious superior,' espe, clally of a large commumty, and also funcuomng as the I administrator of the hospital or the president of the col-lege or university, the work-load is split andlthat part of the superior's authority which pert~ains to thee operation of the hospital or school is delegated to another who serves as admtmstrator or president.5 Th~s ~s delegauon by a person hawng ordinary power but subject to the Roman Pontiff. It is conferred for a whole class of cases or busi-ness, namely, operating the hospital or schooi. If need or usefulness should dictate, the administrator ~r president | t T. Lincoln Bouscaren, S.J. and James I. O'Conn!r, S.J., Canon Law Digest, v. 4 (Milwaukee: Bruce, 1958), 69-82. I . ~ Such split authority can give rise to many problems. A suggested method for dividing the authority in the case of hospitals can be found in an article by the present author, "The Hosp.~tal ~n Canon Law;" in Hospital Progress, 41 (February, 1960), 361-87. Most of the suggested division of authority can be applied to col!ege and uni-versity presidents by simply substituting "president" for "adminis-trator ¯" I Religious Authority VOLUME 20, 1961 189 ]ames L O'~,o~nor, S.]. REVIEW FOR RELIGIOUS 190 has the authority from the code to subdelegate part or all of his authority in~ an individual case. Another example, in a different line, is that in which the local superior is delegated by the superior general or, if competent, by the provincial, to receive the vows of all~ who make profession, temporary or perpetual, in the hduse of that superior: This, again, is delegation for a whole class of cases, namely, the reception of vows. Such a local superior, if impeded from receiving the vows him-self, could subdelegate another, for example, one of the community or the priest celebrating the vow Mass, to re-ceive the vows on this particular occasion. Apart from the two cases provided for in §§2-3 of canon 199, §4 prohibits subdelegation of delegated authority un-less Such delegation is expressly permitted by the original delegator. Subdelegated authority can never be again sub-delegated unless an express grant to that effect was .made when the first subdelegation was given (canon 199, §5). Canon 206 Canon 206 supposes a' situation where, for example, three sisters receive delegation for the same task: Sister Felicitas on January 2; Sister Mary on January 3; and Sis-ter Josephine on. January 5. While all three have delega-tion, which one has the right and obligation to exercise her delegation? Canon 206 replies that the person whose commission was first given has the right and duty; in: our case, that is Sister Felicitas, An exception to this rule is made if a later commission contains a revocation of the earlier grant; for example, if in Sister Josephine's appoint-ment there is also found an explicit revocation of the dele-gation previously extended to Sisters Felicitas and Mary~ Canon 207 ~ Canon 207 lists the ways in which delegated power ceases to exist. Only §1 and §3 are quoted above because §2 can not apply to purely dominative power. Only a brief commentary seems useful here. I) Fulfillment of commission: the delegated authority ceases as soon as the job for which it was given~has been completed. 2) Lapse of time: authority was delegated to December 31, 1960 inclusive. With the end of 1960 the delegated authority also ended. 3) Exhaustion of number of cases: delegation, was ex~ tended to receive vows on five occasions. After the fifth occasion the delegation is lost. 4) Cessation of the reason for delegation: Sister Felicitas is delegated to govern the convent of St. Helen, December 26-31 because the local superior is to be away to attend a series of special conferences. On December 24th word is ~ceived that the director o the con erence has taken eriously sick and the conferences have been ~alled :of[. As result, the superior does not go away Dece.mber 26-31. ince the reason for Sister Felicitas' delegation .has now eased, her delegation also ceaseS. .5) Revocation by the delegator roger er wxth direct no-ice to the delegate; of great imp ortance in~ this stpi ula-ion is the word direct. An example: Brother Hilary has ¯ een delegated by his provincial to negouate the, sale of a ,fece of community property. Before he has time to com- ,lete the transacuon, he hears from a fellow rehg~ous who appened to pass through the prownclal's re.s~dence 'that he provincial said he was writinga letter to Brother Hil-ry revoking his delegauon. The same day l~e hears this ews, Brother Hflary happens to have an appointment to lose the property deal. Does he still have~delegauon to do :~? He does, because he himself has not received dire~t otice from his provincial of the revocation ofldelegation; e merely heard of it from an unofficial sourc.e. If the fel- :~w religious was commissioned by the provincial to in, ~rm Brother Hflary of the revocauon, then Brother s elegat~on would cease as soon as he was informed by h~s eligious confrere. ~6) Rentinciation on the part of the delegate ~together ,ith direct notice to and acceptance by the:del~gator: Two ~ings are to be noticed in this instance: dire~t notice to nd acceptance by the delegator. Direct ha~ the same -~eaning as above regarding revocation. In addition to the irect notice, for instance, Brother Hllary reforms his pro-incial by letter or phone that he is renouncing the dele-auon g~ven him, there must be acceptance by lthe delega- ~r. Brother Hilary does not lose his delegation unless his rovincial accepts.,the renunciation. | . After listing all the ways a given individual@ay lose his elegation, the canon goes on to add a situation in which elegation is not lost, even though, at first glance, it might -em delegation is lost: An illustration will l~elp: Sister enigna, a local superior, has been delegated by her ,other general to receive all vows pronounced in her con-znt. Mother general went out of office Januu~ry 5th be-muse she died that evening. On the morning.+f January ,~h, Sister Benigna received the vows of some s~sters in her ~mmunity. Later that day she learns of mother" general!s eath. Now Sister Benigna wonders if she had ~lelegation ~ recexve the vows that morning. Sxnce no hm~tat~on was ut on her delegation, her authority continued on Janu-y 6th and still continues after that date unless the new ,other general revokes the delegation. The law on this point makes an exception in the two ~ses mentioned in canon 61 which reads: umess ~t should opear otherwise from appended clauses, or unless the re~ I ÷ ÷ ÷ P~ligious Authority ¯ VOLUME 20~ 1961 19l ÷ ÷ ÷ ]ames I. O'Connor, S.J. REVIEW FOR,RELIGIOUS script confers on some person the power to grant a favo to particular persons named in it and the matter is stil intact." Examples of "appended clauses" are: "As long as I a. superior general"; "As long as I wish." With her remova from the office of superior general, both appended clause cause a cessation of the delegated authority. The "As lon as I wish" can be had only if she is competent to grant th delegation. With removal from office she is no longer co petent to have such a wish effectively; therefore, the del gation ceases. The second exception supposes delegation, for exampl to permit Sisters Gervase and Protase to take a trip t Europe. For one or other reason, the delegate has not ye done anything about granting the permission to :the tw sisters named. Unexpectedly, the delegating superior die Since the matter of the delegation is still intact, that i has not been touched, has not had even a beginning o execution, the delegation ceases. Hence the erstwhile del gate is no longer competent to grant the favor and Sister Gervase and Protase are out of a European trip. Canon 207, §3 considers the case where two or more pe sons have been delegated as a single body to carry ou some commission. Brothers John, James, and Joseph hav all been delegated as a unit to transact some business fo the community. Brother Joseph renounces his delegatio by direct word to the delegator who, in turn, accepts th renunciation, Unless the contrary appears from the orig nal delegation, the delegation of Brothers John and Jame automatically ceases. Canon 208 In canon 208 the code turns to the question of cessatio~ of ordinary power. It repeats the norm already mentionec in canon 183, §2; namely, an ecclesiastical office is not los by the loss of authority in the party who conferred th~ office, Therefore, canon 208 draws the logical conclusio~ that authority attached to an office by the law, that i~ ordinary power, is not lost when the party who conferre, the office loses his own authority. This norm is similar t. that for delegated authority at the end of canon 207, ~§1. In the present instance, the case supposed is that, fc example, of a local superior who was appointed to offic by a competent higher superior. The term o~ the highe superior ends before that of the local superior appointe~ The local superior's power, derived from law through hi office, continues even though the party who put him int the office has now lost his authority. Ordinary power ceases when one loses the office t which such authority was attached. The power is su pended, that is, it is possessed but can not be used, if i! possessor lawfully appeals a decision to a higher superior, unless the nature of the appeal is such that it does not prevent immediate execution of ~the original deCision. Ap-peals in judicial processes usually produce suspension of the decision; otherwise, for example, in purely°fid~ainis, trative decisions, appeal or, more exactly, recourse does not suspend the decision (canon 1889). The norm set down above does not derogate from the provisions of canons 2264 and 2284. The first of these canons stipulates that an act of dominative power is il-licit if placed by an excommunicated person. Further, if the excommunication has been pronounced in either a condemnatory or a declaratory sentence of a judge, the act is also invalid. An exception to that law is contained in canon 2261, §2; but both it as well as canon 2284 can ap-ply only to priests, not to sisters and brothers. Canon 209 The last of the jurisdictional canons made applicable to dominative power is of .extreme importance, even though it is not usually of frequent'application. It solves situations which earlier caused very serious problems. Canon 209 supposes a situation where, in the objective order, a superior certainly lacks dominative power or has it only in a doubtful way, In the latter case, the doubt must be positive and probable, that is, there must be good arguments in favor of possession of the authority but there must also be good arguments against its possession. The source of the doubt may arise from a lack of clarity in the law itself or from the lack of certainty that a given fact or facts exist. An illustration of a doubt of law is found in canon 105, 1° concerning the necessity of having a consultive vote of councilors in order that the superior may act validly. As it stands, the canon says: "It is sufficient for valid action if the superior hears the councilors." It is disputed among canonists whether such a hearing is required for valid action because, contrary to its usual language, the canon does not say required. As a result, since the law itself is doubtful, even if the superior did not consult the council where consultation was prescribed in the general law or in the constitutions, the superior's exercise of dominative power is certainly valid since', in virtue of canon 209, de-fect of authority is supplied by the Church in such an in-stance. A doubt of fact means that with regard toa given event there are arguments for and against its existence. If the fact is required as a condition for possessing dominative power, the Church again supplies the authority needed. To illustrate: On May 15, 1960, Brother Joachim was ap-pointed provincial by competent authority. Some time + + + Religious Authority VOLUME 20, 1961 ~93 + ÷ ÷ James 1. O'Connor, $.]. REVIEW FOR RELIGIOUS later it comes out that at the time of his appointment Brother Joachim seems not to have completed his thirtieth year of age. If that is true, then, without a papal dis-pensation he is not a validly appointed provincial and, furthermore, lacks the dominative power of a provincial. An investigation of the matter shows some documents as well as testimony of relatives and friends indicating he was born August 16, 1929. However, other reliable sources give the year as 1930. Further investigation does nothing to solve the doubt regarding Brother's-birth date. If he was born in 1930, he did not possess one quality required by canon 504 to qualify'as a valid provincial. The doubt in this problem has nothi~g to do with the meaning of the law; it centers on whether or not a given fact occurred in one year or another. Hence, it is a doubt of fact, Since the doubt is both positive and probable, that is, capable of proof both ways, the Church supplies the dominative power brother needed for all his actions. As a result, they are all valid and licit. As for the future, brother should, of course, be reappointed by competent authority since it is not certain that the original appointment was valid. The third instance in which the Church supplies domi-native power is that in which there is no doubt either of law or of fact but because of some externally perceptible circumstance a person is commonly believed to be a valid superior when the real truth is that this person is not, Such a condition of affairs is called common error. From the evidence available and in accord with limited knowledge, the community forms the judgment that Sis-ter Lioba was duly elected superior general on February 11, 1958. She proceeds to exercise all the powers granted such a superior in the code and in the constitutions. One day in the summer of 1960 Sister Sophia, one of the gen-eral councilors, is attending a canon law lecture at the end of which she is very disturbed and consults-the lecturer. The consultation reveals the following facts as certain be-yond all doubt. Sister Lioba pronounced her temporary vows on August 17, 1937; she made her perpetual profes-sion on August 15, 1940. During the annual retreat of 1956 something the retreat master said raised the question whether Sister Lioba had valid perpetual vows. The above sets of dates of her professions, in virtue of canon 572, §2 in conjunctibn with canons 574, §1 and 34, §5 which re-quire a full three yea.rs of temporary vows, from date to date, in order to have a valid perpetual profession, clearly prove she was not validly professed of perpetual vows on August 15, 1940. Consequently, on August 15, 1956, with the full reali~zation of the invalidity of the 1940 profession, she pronounced her perpetual vows. At the general chap-ter on February 11, 1958, she was elected superior general. Because sister certainly had perpetual vows then; because it had been almost twenty-one years since sister pro-nounced her first vows; because the casting and counting 3f the ballots had been canonically performed; and be-cause the presiding local ordinary declared the elections met all the requirements of ciin6n law, all the sister's 6f the zommunity concluded that Sister Lioba was their new su-perior general. Sister Sophia's disturbance of mind was caused by a ;tatement of the lecturer that, among other qualifications, a :religious, in order to be a valid superior general, must have been validly professed a minimum of ten years, in-cluding the time of temporary vows (canon 504). Mother Lioba, although in the community since 1935, as of Feb-ruary 11, 1958 had valid vows for only just under four and a half years (August 17, 1937-August 17, 1940; August 15, 1956-February 11, 1958). Therefore, Mother Lioba is not really the superior general. Ignorance of the law on this point, even though it excused from all sin because nobody knew any better, does not prevent the canonical effect of the non-observance of the law, for the reason that canon 504 does not provide for ignorance as excusing from the effects of canon law (canon 16, §1). That is all bad enough. However, since a validly chosen superior is required for valid admission of candidates to the novitiate, to tempo-rary and per.petual' professions, to negotiate contracts of sale or loan, to appoint provincials and local superiors, and so forth, what about the validity of all those admis-fions, contracts, appointments, as well as all other actions whose validity depended on a validly chosen superior? Prior to the 1952 reply, cases like this with their chain reaction of multiple invalidities were something of a night-mare to canonists who in various ways sought to find a legal remedy to prevent' such awful consequences. The ;urest way to take care of such cases was to request from the Holy See what is called a radical sanation (sanatio in radice). Now in virtue of the 1952 reply, in such circum-stances, namely, where common error is had, the Church mpplies the dominative power necessary for the acts ~laced by such a "superior." Consequently, as regards the ictions of Mother Lioba, all those requiring dominative 3ower in order that they be valid, are all valid by supplied iuthority. As in the case of Brother Joachim, so also in :hat of Mother Lioba the status as superior should be vali- ]ated if possible. In the present instance the easiest way ~zould be to petition the Holy See for a radical sanation. These considerations should make for a better under- .tanding and appreciation of religious authority or dotal: ~ative power and especially of the application of certain urisdictional canons to that authority. + 4- + Religious Authority VOLUME 20~ 1961 195 FRANCIS N. KORTH, S.J. Total Dedicatio in the Worl ÷ ÷ ÷ Francis N. Korth, S.J., is professor o[ canon law at St. Mary's Col-lege, St. Marys, Kansas. REVIEW FOR RELIGIOUS ]96 The apostolic constitution, Provida Mater Ecclesia, o February 2, 1947, focused attention upon a new, otficiall~ approved type of totally dedicated life in the world namely, the life in secular institutes. Members of these institutes bind themselves to the practice of evangelica poverty, chastity, and obedience according to their con stitutions for the purposes of personal sanctification and of apostolic work. Secular institutes are the third corn ponent of the juridical state of perfection-to-be-acquired as that state exists at present in the Church; the othei two components are the various kinds of religious insti tutes and of societies of common life. Outside the juridical state of perfection-to-be-acquired, there exist other groups many of them in a stage of development or growth, whose members dedicate themselves totally to an apostolic life and personal sanctification. Religious institutes and societies of common life (ex amples of these latter are the Paulist Fathers, the Mary knoll Missionary Fathers, the Vincentian Fathers) are well established and known in this country. Not so seculaI institutes, since they are a more recent development. Secular Institutes in the United States In an effort to help the growth of this new form ol specially.dedicated life in this country, as well as to make these groups and other similar groups better known and understood, a small number of interestedpersons:met in the summer of 1949 to talk things over. A year later in July, 1950, the first general meeting of such groups with some seventy participants, was held in Washington D.G. From this developed an unofficial national cente, (operating with the knowledge.and approval of ecclesiasti. cal superiors) for the purpose of coordinating activity and~ of collecting and disseminating information. Until 1957 this center was located and serviced at Notre Dame Uni cersity under the able and generous leadership of Father Ioseph Haley, C.S.C. Two other persons who have played mportant roles from the beginning are Father Patrick ~lancy, O.P. and Father Stephen Hartdegen, O.F.M. In lanuary, 1952, a restricted' gathering (seventy-five 'per- .ons attended, however) met at Notre Dame University. Fhe proceedings of both the 1950 Washington meeting ~nd this 1952 meeting at Notre Dame were compiled. In August of that same year, 1952, the first National ,~ongress of Religious in the United States' was held at Notre Dame University; during this Congress two papers were given on secular institutes. About the same time ~ome published materials about secular institutes ap-peared, and some talks were given to various groups about the same subject. In February, 1954, a meeting 3f twenty-six interested priests took place in Chicago. Meanwhile, an informational bulletin was being issued from time to time by the national coordinating center. The interests of the coordinating center had now been extended to include, besides secular institutes, other groups devoted to a life of total dedication in the world. The bulletin received the expanded title of Bulletin on the Dedicated Life in the World and Secular Institutes. In 1955 a workshop for dedicated persons in the world was conducted at Chicago. That same year regional meet-ings were held in San Francisco and New Orleans, fol-lowed by one in Chicago the next year and one in Boston in 1957. The national center's bulletin was now appear-ing under the name of Bulletin of the Life of Total Dedication in the World. In 1957 there was published a ;ymposium, Apostolic Sanctity in the World, edited by Father Haley, C.S.C.; in August of the Same year a ,aational meeting of representatives of the four regional areas was held at Notre Dame University. The Sacred Congregation for Religious had been ac-quainted with these different activities and meetings. ~'or purposes of unifying the activity and of guiding the zfforts of all concerned along proper lines and in con- ~ormity with the Holy See's directives in this matter, the 3acred Congregation urged that all these related activities ,~e now placed under the direction and guidance of the .~onference of Major Superiors of Men's Institutes in :he United States. Father Joseph Haley, c.s.c, had been in charge of zoordinating efforts until 1957, at which date the national ,nformation and coordinating center was shifted to Wash- .ngton, D.C. with Father Stempen Hartdegen, O.F.M. of Holy Name College in that city as the national director tnd president of the newly proposed (but not yet fully tpproved) Conference of the Life of Total Dedication n the World. The plan for this Conference had to be 4- 4. Total Dedication VOLUME 20, 1961 19'/ Francis N. Korth, S.~. REVIEW FOR RELIGIOUS 198 submitted to the Conference of Major Superiors for approval. This approval was obtained (September 29 1959) and 'preparations were then begun for the firs triennial general meeting of the new Conference (here after referred to as the C.L.T.D.W.), Though ~his meeting was projected .for St. Louis in November, 1960, an un foreseen delay caused it to .be held in Washington, D.in January of the following year. The Washington Meeting This first triennial general meeting represented an edu cational effort to make the life of total dedication in world, especially in secular institutes, better known and understood by clergy and laity alike. The program was signed to appeal both to those whose interest in this wa) of life was just beginning and to those whose interest wa~, of long standing. The opening session of the meeting, convened in auditorium of McMahon Hall at The Catholic University on Saturday, January 28, 1961. Chairman of this session was the president of the C.L.T.D.W., Father Hartdegen. O.F.M. More than one hundred and fifty persons (laymen and laywomen, a number of priests, and several brothers and sisters) had registered for the meeting; a fairly large number of visitors, including some clerical students, individual sessions. The first formal paper of the meeting was a review the activities' during the past eleven years in the United States leading up to and culminating in the formation and. official approval of the C.L.T.D.W. This talk, .en-titled "The Conference of the Life of Total Dedication in the World--A Decade of Growth, 1950-1960/' has fur-nished the facts given in the opening part of the present article. Next on the program was a paper with the title, "An Active Lay Apostolate: Condition of Growth of Secular Institutes in the United States." The paper emphasized that an active apostolate and a deep interior life are the conditions for the growth of secular institutes in this coun-try. Secular institutes, the paper continued, are peculiarly suited to the needs of the times; because they are different in their extrinsic elements, they can fulfill the contem-porary apostolate's need of easier access to atheists and sinners; the institutes, accordingly, answer the universal need for an organized secular apostolate and for a deepl interior life. The paper then went on to give a historical and statistical survey of secular institutes, the main point~! of which are summarized below. In 1938.representatives of twenty-five societies or group~" of total dedication in the world came from various part,~ o[ the world to a meeting in Switzerland. Events such these gradually led up to the official, juridical recognition of secular institutes by the Church in 1947. In the United States at the present time there are repre-sentatives of twenty-five known groups of persons spe-cially dedicated to the apostdlat~ in the world;~ fli~se are either secular institutes or other groups which might de-velop into secular institutes. (No figures are available for Canada.) Of these twenty-five groups, twelve are secular institutes (eight are pontifical and four diocesan), seven are canonically approved pious associations, and six are not yet canonically established, but are existing with the approval of the bishop. The eight pontifical secular institutes are divided into six with final approval (Company of .St, Paul, Daughters of the Most Holy and Immaculate Heart of Mary, Mis-sionaries of the Kingship of Christ [women's branch], Opus Dei, Society of the Heart of Jesus, and Teresian In-stitute) and two not yet fully approved but having the de-cree of praise (Caritas Christi Union and the Society of Our Lady of the Way). The four diocesan secular insti-tutes are: Missionary Priests of the Kingship of Christ, Regnum Christi, Schoenstatt Sisters of Mary of the Catho-lic Apostolate, and the Secular Institute of St. Plus X. The seven canonically approved pious associations are.' Caritas; Domus Dominae and Domus Domini (Madonna House); Jesus-Caritas, Fraternity of Fr. de Foucauld; Ob-late Missionaries of the Immaculate; Oblates of St. Joseph; Pax Christi; and Rural Parish Workers of Christ the King. The six groups not yet canonically established are: Daughters of Our Lady of Fatima, Ecclesian Institute of Christian Life, Institute of Blessed Martin de Porres Work-ers, Institute of the Mystical Ghrist, Institute of the Word, and Pro Deo Workers. Not falling into the above categories of specially dedi-cated persons in secular institutes or in groups that might develop into such, but still worthy of mention here under a special listing because of total dedication or noteworthy apostolic work being done by their members are the fol-lowing four groups: International Catholic Auxiliaries; La Paix (Lafayette Associated Professional Apostolate of Individual Christians ); Lay Workers of the Sacred Heart; and the Society of the Daughters of St. Francis de Sales. [Some information about the above-mentioned secular institutes and other groups is available in a pamphlet en-titled Chan:~els, published by the national information center whose address is: C.L.T.D.W., Brookland P.O. Box 4522, Washington 17, D.C. The price of the pamphlet is twenty-five cents.] The above groups exist in. nearly thirty of the states, though the overall representation is small. While it is true that the secular institute movement has developed Total Dedfi:atlon VOLUME 2°0, 1961 199 4. Francis N. Korth, $.]. REVIEW FOR RELIGIOUS 200 fairly rapidly, still ther~ is reason for concern about the slowness of growth in the United States. The principal cause of this is perhaps the lack of realization on the part of many of what the modern apostolate means and re-quires; namely, the Christianization of modern society. Life in Secular Institutes Following the two main talks of the morning, the audi-ence was then divided into fourteen smaller work groups. Each group had a leader and a secretary; items presented in the preceding talks were discussed more fully by each group; and prepared questions to aid discussion were dis-tributed. Any conclusions were noted by the secretaries; summaries of these conclusions were presented at the final general session on the last day. The first afternoon speaker treated the topic of "Secular-ity in the States of Perfection of Secular Institutes." He made the point that the secularity of these new institutes does not imply secularism but rather a stable way of totally dedicated life in the world. The member of a secular in-stitute has the obligation of the three evangelical counsels of poverty, chastity, and obedience and is always subject to the will of God expressed by the constituti6ns and by superiors. Some difficulties encountered are loneliness, being misunderstood, and a lack of some of the things of the world while living and moving in it. The lack of com-munity life and of a common garb is hard for outsiders to understand. In addition, the member of a secular in-stitute is on his own to do the required thing: perhaps to give up a movie or a television program in order to be faithful to spiritual exercises, to do without new clothing because of the poverty professed, to stay away from an office party. There are no bells to direct one's day, no assistance from the example of others, as is had in com-munity life. Mentality, personality, and strength above average are needed to lead this life. A person must be an active, militant apostle, for part of a vocation to a life in secular institutes is to be the leaven in the masses. The second part of this first afternoon was devoted to a panel on "The Evangelical Counsels," the panelists being two priests and three lay persons. The first panelist pre-sented the canonical aspects of this topic, commenting on the nature of the vows or promises and their resultant ob-ligation or bond and on the fact that one binds himself according to his paiticular constitutions, that a member of a secular institute is not a religious, and that such a call-' ing is a special vocation which at times may require rather high intellectual qualifications. Prudence and good judgment are essential in any prospective candidate and, of course, a good moral life. Some inner impulse or desire is found, but not necessarily a liking; in other words, there should be some general appeal and an investigation of that appeal, The second panelist considered the moral aspects of a life of poverty, chastity, and obedience. His remarks may be summed up in the followifi~ ~iy. Poverty~ tile ~dical ownership remains, while the useful ownership is re-stricted according to the constitutions. A very strict ac-count of income and expenditures is required, the account being rendered to the superior usually at the time of the annual retreat.Combined with generosity to the poor, frugality is practiced. Ckastily: all sins against' chastity must be avoided and, moreover, ~easonable means must be taken to preserve the full beauty of this virtue. Members in the strict sense of secular institutes are forbidden to marry. Obedience: superiors are to be obeyed within the limits of the rule and constitutions. A formal command would be given in writing or before two witnesses and with the use of a special formula; this power is not to be used beyond what is found in the rule or statutes or constitu-tions. ',The practical "aspects of living poverty, chastity, and obedience in a secular institute were briefly treated by the three remaining panelists, each of whom considered one of the three evangelical counsels. The first speaker discussed the practical living of poverty, At times, he noted, it is difficult to determine the detailed application of poverty, particularly in the case of persons engaged in individual work or careers~ One should live in the spirit of poverty and pray to understand what: living in that spirit means. In everyday living two methods of practicing poverty are followed: 1) the individual keeps his own budget and sup-plies his own needs, getting the necessary permissions from his superiors; 2) income obtained from work is pooled and the needs of individuals are supplied by Superio[s. from the common fund. At times there might also be some com-bination of both these methods. Practical ~tuestions, de-termined or settled by the Constitutions or the rule of life of each institute, inclUde the following: whether or not to keep a budget, how much may be spent without special permission, how much to give to charity on one's own ini-tiative, how much.to give to the institute. A definite record of revenues and expenses must be~ kept and reported to superiors at stated times, Permission is required to spend any amount; a general permission might cover expendi-tures for medicine, toilet articleS, and so forth; for cloth-ing, by way of example, specific or special permission might be required. The alignment of permissions varies with the occupations of the members. In emergencies one may act and later report the matter. A booby trap in 'prac-ticing poverty could be the accepting of gifts from relatives or friends (though in some groups it is permissible tO ao ÷ ÷ ÷ Total Dedication VOLUME 20, 1961 ÷ ÷ ÷ Francis N. Korth, $.1. REVtEW FOR R~t.tGIOUS 202 cept gifts even of money) or working extra hours to earn more money when the time should be given to the apos-tolate. A monthly financial report might be required. The rule of life of a particular group will flesh out its constitu-tions on these and similar points. It is important to note that the practical living or regulation of poverty varies considerably with different institutes. Though there is a great variety concerning poverty in the const.itutions, some restriction is essential for all. The speaker on the practical living of obedience noted that obedience presupposes a mature mentality which sees that it is from Calvary that. the meaning of obedience be-comes clear. Obedience gives one an assurance of fulfilling God's will and it frees from pride. Just as other things connected with secular institutes have secular character-istics, so too does this obedience. The member of a secular institute is neither alone nor completely dependent: There are no .schedules or other helps as in religious institutes. Secular institute obedience must be active; often the su-perior gives only general directives. For example, the hour of rising in the morning and the hour of retiring at night are indicated; but if some friend or guest is in the house, the member could probably bypass that directive for the sake of charity. The last of ~he five panelists discussed the practical living of chastity. This means no marriage and no sin against chastity; for God, marriage is renounced and per-fect chastity is undertaken. In regard to dances and shows, the me .mber of a secular institute does not make a habit of these diversions but "attendance is permissible if charity or the apostolate requires it, One must be selective in tele~ vision programs; similarly, books and movies, if there is time for them, must be chosen wisely. Women members should wear clothing that is modest and suitable for their apostblate. Jewelry should not be expensive; it should be used as part6f the costume and not for show. As a motive for faithfulness in preserving chastity, a deep love of Christ should be cultivated. A strong devotion to the Blessed Mother will also help, as.also will fidelity to the rule, which was given precisely to be of assistance in this matter. Formation of M'embers of Secular Institutes The evening session feat ~ured another panel whose topic was "Formation for the Life. of Total Dedication in the World." This time, there w~ere four panelists, two priests and two lay persons. The first panelist spoke about spirit~ ual instruction and remarked that the purpose of a pro-gram of spiritual instruction is to give glory to God, to further the work of the Church, and to form apostolic secu-lar ambassadors of God.: For this latter purpose, apostolic virtues, especially as detailed in the particular constitu- tions, are necessary. In general there is need of zeal for souls, prudence, fortitude, and the gifts of the Holy Spirit. In any consideration of method in spiritual instruction, it is important to remember that the spiritual life must be allowed to grow by degrees. 'It ~as,suggested by the~speaker that in the period of formation fundamentals be stressed; a knowledge of secular institutes in general and of the con-stitutions of a particular group must be imparted along with the spirit of that particular group. In the period of temporary incorporatibn, the above areas should be devel-oped more fully, the .person should be acquainted with the apostolate of the institute, and forbearance of the faults of others should be inculcated.In the period of final or definitive incorporation there is need for continued spiritual instruction, for growing simplicity in one's spirit-ual life with no overemphasis on either the active or prayer aspect of secular institute life. Spiritual guidance was discussed by the next speaker. The spiritual director of a secular institute, he said, must realize that he is working with specially dedicated souls. He must teach them the principles of the spiritual, life with emphasis on prayer and mortification. He must also teach them to think with the Church, to have zeal, tO lead a life of self-denial in order to live with Christ. For purposes of guidance, the panelist suggested the following three "p's" as useful: 1) a philosophy of life (= the faith); 2) a pro-gram (for which consult the constitutions, customs, and heritage of the particular group); and 3) "passion" (= en-thusiasm for living total dedication). The means at a di-rector's disposal are conferences, lectures, discussions, di-rected spiritual reading, and especially a mirroring of all he teaches. The two lay participants on this panel discussed "Teach-ing and Living the Rule and Constitutions in Secular Life." For teaching the rule and constitutions, the third panelist stressed the need of starting with humility, since one is to serve when one governs or teaches. Compassion, zeal, pity, and patience are necessary to teach or train young people. The teacher must teach by living and must himself be immersed in prayer. In actually teaching, the person to be instructed must be studied and the amount of training or instruction to be given here and now must be duly measured. If the person should at present be con-fused or somewhat emotionally disturbed, teaching of mental hygiene is indicated. The vocabulary of instruc-tion should be adapted to the capacity of the hearer. The questions that will be asked of a teacher of the way of life in a totally dedicated group will always tend to be the same; hence the teacher must learn to be patient with the questioners. The final speaker of the panel gave some thoughts on ÷ ÷ ÷ Total Dedication VOLUME 20, 1961 203 ÷ ÷ ÷ Francis N. Korth, S.$. REVIEW I:OR RELIGIOUS 204 living the rule and constitutions. To this end the personal touch and a greater initiative in the following of Christ are needed, especially for groups that do not have training of members in common. Perfection is to be sought from the rule which must be taught gradually without any great upheaval or change in the candidate's life. It must be stressed, however, that the life the candidate is contem-plating is a life of total dedication. He should be taught that in day-by-day living decisions must be made by the individual, but later he should check his decision with the superior's judgment. In the realm of poverty, one should have as if he had not; hence there should be a spirit of being ready to turn.over all one's money to the in-stitute. In order to live the rule and constitutions there must be a constant, conscientious, mature completeness in giving. On Sunday, January 29, the second day of the meeting, a low Mass was celebrated in the crypt chapel of the Na-tional Shrine of the Immaculate Conception. The sermon at the Mass was entitled "The Catholic University and Secular Institutes." The hope was expressed that at some later date a planned series of general courses might be given at The Catholic University on basic knowledge about secular institutes and on training and spiritual in-struction fundamental for life in any groups devoted to total dedication. The Apostolate The general sessions were again held in the auditorium of McMahon Hall. The opening morning session pre-sented a panel of lay participants on the overall subject of "The Apostolate." Five speakers successively discussed lay missions (two speakers), social work, nursing, and teaching. The first speaker on lay missions gave some background information on the general idea of missionary work in the Church. The particular role of the lay apostle in mission areas, he said, is to develop an atmosphere of Christianity through the practice of Christian principles. To achieve this purpose, the natives must be educated in Christian principles, perhaps initially through the ministrations of those in some profession such as nursing. To prepare mod-ern young people for such lay missionary work on a life-time basis, spiritual preparation must first of all be stressed. Next, the prospective missionaries are to under. stand that there must be no forcing of American attitudes about government and life on the natives. The basic atti-tude of the missionary should be humility; he must be sympathetic to the customs and culture of the people among whom he is working. To this end a study should be made of the culture, philosophy, and literature of the par-ticular missionary country. The second speaker on lay missionary work pointed out that opportunities for laymen to spend their lives as per-manent missionaries are found in ~ay mission societies. A lay missionary should be imbued with the missiona~ry mys-tique: to give. He is "going~oht'' to help other p0~ential members of the Mystical Body. Emotional balance is neces-sary for a lay missionary. He should be able to accommo-date himself to the culture of. the country in which he works. "Missionary poverty" means giving up one's former way of living and even of thinking. Joy will be found in a sense of fulfillment, in the hope enkindled in men's eyes, in the happiness of the children one meets, and in the friendship of the natives. Hardships will include discour-agement, lack of assimilation by the natives, rigors of cli-mate, and the like. Teams of missionaries, as opposed to free lances, supply mental uplift, coordination of activity, spiritual assistance, and so forth. The third panelist spoke on the apostolate of social work, an apostolate that implies service and sacrifice. So-cial work implies climbing into the stream of human events and adversities to serve a fellow human being who is suffering. This demands a spirit of self-sacrifice and the conviction that no human being is trifling or insignificant. The fourth panelist discussed nursing as an apostolate. Nursing, it was said, is an art and science that deals with the patient in his entire environment. The nurse must be a mature person with a ministry of mercy based on the love of God. The nurse is to see Christ in the patients, for there is a need of "a restoration of nursing in Christ" to counter-act a secularistic and materialistic attitude. The average nurse today seems self-centered instead of Christ-centered. The nurse should try to help patients spiritually and should teach the Gospel message by action; thus, for ex-ample, the nurse should be ready "to go the other mile" whenever the opportunity arises. A nurse truly dedicated to Christ shares His sufferings and also His joys. The fifth panelist on the apostolate considered the area of teaching, pointing out that educational statistics in the United States show that many Catholic students on all levels of training are not in Catholic schools. Some sug-gestions have appeared in various publications to meet the situation; for example, to close the first four or five grades in parochial schools, to have fewer but more excellent Catholic schools, or to sacrifice tremendously to retain the entire system. Whatever be the solution to the prob-lem, it will always remain true that Catholic teachers must endeavor to be at least as professionally competent as non-Catholic teachers. The speaker suggested that a specialized apostolic group of lay teachers is needed in this country. Moreover, the influence and activity of the Cath-÷ ÷ ÷ Total Dedication VOLUME 201 I961 £05 Francis N. Eor~h, $.J. REVIEW FOR RELIGIOUS 206 olic teacher could well be extended into the area of adult education. After the close of the Sunday morning session, a formal group luncheon was held, at which the Very Reverend Celsus Wheeler, O.F.M. of the Conference of Major Su: periors of Men's Institutes in the United States gave a word of encouragement to the work done at the meeting. He told those in attendance that secular institutes and other groups requiring a life of total dedication in the world are in a splendid position to establiSh contact with people for apostolic purposes in places and circumstances where priests and religious often could not make contact. The second speaker at the luncheon was a physician, a member of a professional men's sodality, who spoke on the topic,. "Dedication to t~he Lay Apostolate through the Professions." In his speech he stressed that though the lay apostolate can achieve a vfist amount of good, still consid-ering the number of Catholics in the United States, there is not the'desired impact or influence which might be ex-pected. Many young people today have no concept of how their future work as professional men might be utilized for the apostolate. One must learn to think with the Church and to carry that thinking into one's professional life. A deep interior life must be developed so that this can spill over into apostolic work. As an example of what one group of professional men is doing for the apostolate, a detailed description was given by the speaker of the sodality to which he helorigs, of its course of training, and of some of its apostolic activities; his presentation was both impressive and inspiring, A business meeeting was held in the auditoriu

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Issue 14.3 of the Review for Religious, 1955. ; Review for Religious MAY 15, 1955 Empress of America . c.J. McNaspy The Relicjious Life . Pope Plus Throucjh His Blood . Joseph H. Roh~i.g Community Life . Bernard I. Mullahy Third Mode of Humility. ¯ . . c. A. Heri~st Mary and Joseph Find Jesus . " . . Paul Oent Book Reviews Questions and Answers Summer Schools VOLUME XlV NO. 3 RI Vli::W FOR Ri::LIGIOUS VOLUME XIV MAY, 1955 NUMBER 3 CONTENTS EMPRESS OF AMERICA---C. J. McNaspy, S.J .113 SURSUM CORDA . 122 POPE PIUS XII AND THE RELIGIOUS LIFF_;--doseph F. Gallen, S.d1.23 THROUGH HIS BLOOD~doseph H. Rohling, C.PP.S . 139 COMMUNITY LIFE--Bernard I. Mullahy, C.S.C . 141 TI-IE. THIRD MODE OF HUMILITY---C. A. Herbst, S.3 .1.50 MARY AND dOSEPH FIND dESUS--Paul Dent, S.d .155 BOOK REVIEWS AND ANNOUNCEMENTS-- Editor: Bernard A. Hausman~, S.3. West Baden College West Baden Springs, Indiana . 157 SOME BOOKLETS . 164 QUESTIONS AND ANSWERS-- ll. Dismissal of Novice without Giving Reason .165 12. Novitiate Extended until Regular Profession Ceremonies 165 13. Mental Patients with Temporary Vows . 166 14. Changing Constitutions in regard to Mail . 166 15. Handbook for Sacristans . 167 OUR CONTRIBUTORS . 167 SPECIAL ANNOUNCEMENTS . 168 REVIEW FOR RELIGIOUS, May, 1955. Vol. XIV, No. 3. Published bi- " monthly: ,January, March, May; 3uly~ September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter ,January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Augustine G.Ellard, S.,J., Adam C. Ellis, S.,J., Gerald Kelly, S.3., Francis N. Korth, S.,J. Literary Editor: Edwin F. Falteisek, S.3. Copyright, 1955, by Adam C. Ellis, S.d. Permission is hereby granted for quota-tions of reasonable length, provided due credit be given this review and the author. Subscription price: 3 dollars a year; 50 cents a copy Printed in U. S. A. Before writing to us, please consult notice on inslde back cover. Empress ot: America INTRODUCTION o F the world's favorite Marian shrines it may seem surprising that the oldest is on our own continent. Three centuries before the apparitions at Lourdes, our Lady appeared in America and left her miraculous image in Guadalupe, then a suburb, now part of Mexico City. Every year many Americans join their fellow Catholics of the South in paying homage to Our Lady of Guadalupe. Again and again the Holy Father has joined them in spirit, and ten years ago he proclaimed Our Lady of Guadalupe patroness of America, with the title of "Empress." The outline of the history is familiar to all religious. But not all may realize bow completely reliable and authentic are.our sources, Bishop Schlarman's Mexico Land o# Volcanoes indicates a number of scientific historians who have studied the question. Principal among them are Fathers Bravo Ugarte and Cuevas. In the following pages we present a close English translation of a document that goes back to the very period of the miracle and is accepted as historical. It was written by an Indian, Antonio Valer-iano, a relative of the Aztec Emperor Montezuma. Valeriano com-posed his text in his own language, some ten years after the event (December 12, 1531). It was translated recently into Spanish by Primo Veliano Velazquez, and this translation was made from the Spanish. A word about the style. The original, we are told, is written in the very formal style of the period: the Spanish translator has kept this blend of formality and naivet~. The present translator has tried to preserve some of the charm and simplicity, together with what to us might seem artificiality. But his main effort has been to give a faithful version of the document, even to the point of literalness.--C. J. McNAspY, S.J. ANTHONY'S STORY Herein is told how the ever Virgin Mary, Mother of God, our Queen, most marvelously appeared not long ago in Tepeyac, which is called Guadalupe. First she allowed herself to be seen by a poor Indian whose name was Juan Diego; then her precious image was made manifest before the new bishop, Fray Juan de Zumarr~ga; and then came all the miracles which she has accomplished. 113 EMPRESS OF AMERICA Reoiew [or Religious Te'n years after the capture of the City of Mexico, when war ceased and there was p~ace among the peoples, there began to blos-son the faith and knowledge of the true God by whom we live. In those days, in the year 1531, early in the mon.th of December, it b'appened that tber~ lived a poor Indian, by name Juan Diego, arid as it is related, a native of Cuautitlan, which in m~tt~rs spiritual then belonged to Tlatilolco. Very early on the morning of Sal~ur-day, Juan Diego was coming by in order that be might pay wbrsbip to God 'and perform some errands. He arrived at the hill called Tepeyacac when it was dawn. He heard a singing above the hill, a~ singing which seemed the song.of various precious birds, although at times, when the voices of the singers were silent, it seemed "that the mountain answered them. Their song was very gentle and de-" ligbt,ful, surpassing that of the Coyoltototl and the Tzinizcan and the other beautiful birds that sing. Juan Diego stopped to look and said within himself, Can it be that I am worthy of what I am hearirig? It may be I am dreaming. Did I arise from sleep? Where am I? Am I, perhaps, in the earthly paradise that the ancients, our ancestors, spoke of? Or it may be I am in heaven. 'But as be turned his bead toward the east, above the hill, whence the precious heav-enly song was proceeding, it suddenly ceased; and there was silence; and he l~eard himself called from above the hill, "duanito, duan Dieguito." So he m~de bold to go whither he was called, nor was he fright-ened for a moment; but, on the contrary, happily he climbed the bill to see whence .he was being summoned: and, arriving at the summit, he saw a lady standing there and telling him to come closer. Now wb~n he came inl~o her presence he marveled mU'db bet more than human glory, for her clothes did shine like 'the sun, and the rock on which she stood was struck with splendor and ap-pear. ed like a bracelet of precious stones, and the earth shone like a rainbow. The mezquites, nopals, and other different bushes that are usually there seemed like emeralds, their leaves like fine tur-quoises, and their branches and thorns did shine like gold. Juan bowed down before her and beard bet word, very gentle and polite, as. that of one who is. very attractive and much esteemed. She said to him, "Juanito, thou smallest of my sons, .where art thou going?" He replied, "Lady and my Child,.I .must g9 to thy house of Tlati-lolco to attend to divine matters that our.priests, the delegates of our Lord, give and teach us." Then she spoke to him and told him her holy will~ saying, "Know thou and understand, thou "the least ll~t May, 1955 " EMPRESS OF AMERICA of my sons, that I am the ever Virgin Mary, Mother of the true God, by whom we live; of the Creator by whom all things have their 'being; of the Lord of heaven and of earth. Know thou that it is my strong wish that a church be built here for me, in order that I may manifest and bestow all my love, compassion, aid, and protection; for I am thy loving mother, thine, and .mother of all them that dwell in this land and of those others who love me, call upon me, and trust in me. For it is my will to listen to their cries, grief, and sorrows. Wherefore, in order that I may accomplish this my wish, thou shalt go to the palace of the Bishop of Mexico and relate to him that I send thee to manifest to him this strongest de-sire of mine, that he should build a church for me here; and thou shalt relate to him exactly all that thou hast .seen and admired, and that thou hast heard. And know thou that I will be grateful to thee and will repay.thee, for I will make thee happy and thou wilt deserve much that I should reward the work and trouble by which thou wilt obtain what I ask of thee. Take care that thou hearken to my command, my smallest son. Go and strive with all thy might that thou brin~' it about." He then did reverence before her and said, "My Lady, I go now to fulfill thy command; I leave thee for the present, I thy humble servant." Then he went dowh tO do her command, and he went by the road that leads straight to Mexico. Entering the City, he came straightway to the palace of the Bishop, who was the prelate ~hat had newly arrived and who was called Fray Juan de Zumarraga, being a religious of St. Francis. Scarcely had Juan Diego arrived, when he tried to see the Bishop, asking the servants to go and announce him; who after a good while came to call him, for their Lord Bishop had given order that he should enter. And when he had entered, he bowed and genuflected before the Bishop; immediately he gave him the message of the Lady of Heaven, relating.to him all he had admired, seen, and heard. The Bishop, after he had heard all his words and message, seemed not to believe him, for he ar~swered him thus, "Thou wilt come again, my son, and I shall hear thee more slowly, and I shrill con-sider all from the very beginning and shall ponder the desire and wish with which thou hast come." So Juan went out and grew sad, fbr his message had not been in any way accomplished. Now, on the same day, as Juan returned to the summit of the hill, he came upon the Lady of Heaven, who was awaiting him in the very place where he had seen her the first time. Seeing her, he 115 EMPRESS OF: AMERICA Reoiew for Religious prostrated before her and said, "Lady, thou the smallest of my daughters and my child, I went where thou didst send me to carry out thy cofnmand; with difficulty I entered where the Bishop dwelt; I saw him and presented thy message as thou didst tell me. Sure enough, he received me kindly and listened to me attentively; yet, from what he replied, it appeared to me that be did not believe me. He said, 'Thou wilt come again. I shall listen to thee more slowly. I shall examine from the very beginning the desire and wish with which thou hast come.' I understood perfectly by his manner of answering me that he thinks that it may be I made up myself the story that thou dost wish a church to be built here, and that perhaps it is not thy order. For this reason, I earnestly beg of thee, my Lady and Child, that thou entrust tby message to those who are important, well known, respected, and esteemed, so that he may be believed. For I am dust a little man, a string, a little ladder, jus~ a tail, a leaf, a nobody; and thou, my Child, the small-est of my daughters, Lady, art sending me to a place where I never go. Forgive me for causing thee great sorrow and for falling into thy displeasure, my Lady." The most holy Virgin answered,him, "Listen, my smallest son, and understand that many are my servants and messengers whom I can summon to bring my message and do my will. But it is quite necessary that thou thyself should ask and help, and that my will be carried out by thee. I beg of thee, my smallest son, and I strongly command thee, to go again tomorrow to see the Bishop. In my name tell him my will: that be must build the church that I ask. And remind him that it is I myself, the ever Virgin Mary, Mother of God, who send thee." 3uan Diego rel~li~d, "My Lady and my Child, do not be grieved. I shall gladly go to carry out thy command. I shall not fail in any way to do it, nc,r do I think the way is difficult. I shall go to do thy will; now it may be I shall not be heard agreeably; or if I am heard, it may be I shall not be believed. Yet, tomorrow evening, when the sun is setting, I will come to give an account of tby, message and the Bishop's reply. Now I leave thee, my smallest daughter, my Child and my Lady. Meanwhile, sleep well." And he went to rest in 10is own house. On the following day, which was Sunday, very early in the morning 3uan Diego left his house and came straightway to Tlati-lolc6, that he might be instructed in divine things and there be pres-ent for the roll call, and later go to the prelate. After Mass, the 116 Ma~l, 1955 EMPRESS OF AMERICA roll call having been completed., the people dispersed. Juan Diego immediately went on to the palace of the Lord Bishop. Scarcely had he arrived, when he exerted every effort to see him again, but he saw' him only with much difficulty. Juan knelt at his feet, mourning and weeping as he related the command of the Lady of Heaven. Would that the BiShop would believe his message and the will of the Immaculate One to build her church wh~re she said she wanted it. The Lord Bishop, that he might gather more inl~orma-tion, asked him many things: where Juan had seen her and how it had come to pass; and he told the Lord Bishop everything per-fectly. But though he explained exactly how she had appeared and how mu~h he had seen and admired, and that she had revealed that she was the ever Virgin, the most holy Mother of our Savior and Lord Jesus Christ; nevertheless, the prelate did not believe him,, replying that he would not have it to be done on his word and petition alone, but that some sigma was necessary for him to be able to believe that the very Lady of Heaven was sending Juan' Diego'. Hearing this, Juan Diego replied to the Bishop, "My Lord, think of what must be the sign that thou dost ask, for now I shall go "to ask it of the Lady of Heaven who sent me hither." The Bishop, seeing that Juan held to all things without hesitation and retracted no.thing, dismissed him. 'At the same time he com-missioned some men of his house, in whom he could trust, to follow "Juan and watch whither he might go and whomever he might see and with whom he might speak. And this is what came to pass. Although Juan Diego made his way straight and followed the road, those who came behind him lost track of him, where the ravine passes near the bridge of Tepeyacac, and though they sought him every- 'where, they did not see him. Wherefore they returned, not only because they had grown weary, but also because their purpose had been blocked, and this caused them anger. They went to report to the Lord Bishop, urging him not to believe Juan, and saying that :he was but a deceiver and had made up the story, or that he was only dreaming what he had said and asked. Finally they suggested that if Juan should return, they might take him and punish him severely, so that he would never again lie or deceive another. Meanwhile, Juan Diego was with themost holy Virgin, r~lat-ing to her the answer that he brought from the Lord Bishop. And she, having heard, said, "It is' well, my little son. Thou wilt re-turn here tomorrow to bring the Bishop the sign that he has asked. With this he will believe thee, and about this request he will no longer 117 EMPRESS OF AMERICA "Ret~iew .for Religiou, doubt nor suspect thee. And know, my little sonl that I shall repay thy care and the work and weariness that thou hast undergone for me. Well, then, I shall expect thee here tomorrow." But on the following day, Monday, on which Juan" Diego was to bring a sign in order that he be believed, he did not return. For when he arrived at his house he found that his uncle Juan Bernardino had been taken very ill. Straightway he went to summon a doctor and some help. But there were no free moments now, for the ill-. heSS was indeed great. That night his uncle besought him to leave early in the morning and come to Tlatilolco that he might call a priest to come and hear his confession and make him ready, for he was very certain that it was his timeto die and that he would never arise nor be strong again. Early in the morning, Tuesday, Juan Diego departed from his house for Tlatilolco to summon the priest. When he reached the road that was at the foot of the hill'of Tepeyacac, toward the west, where it was his custom to go by, he said, "If I make my way straight, it may be the Lady will see me and will surely stop me so that I may bring the sign to the Bishop as she told me. First, however, let us care for the trouble in hand; wherefore, I should call the priest quickly, for my poor uncle is-surely waiting for him." Then turning to the hill he climbed it and passed over onto .the other side toward the east, so that he might reach Mexico quickly and that the Lady of Heaven might not cause him delay. For he thought to avoid the eyes of her to whom all things fire present in sight. He saw her descending from the hill and with her gaze fixed upon him before even he had seen her. And she came up to meet him at a side of the hill and said to him, "What is it that troubles thee, my smallest son? Whither art thou going?" He was saddened somewhat, or perhaps ashamed or frightened. He 'bowed before her and saluted her saying, "My Child, the smallest of my daugh-ters, my Lady, I hope thou art happy. How art thou this m.drning? Art thou in good health, my Lady and my Child? For I shall bring thee sorrow. Thou knowest,.my Child, that my uncle, thy poor servant, is exceedingly ill. He is stricken by the plague and is on the point of dying. I am now hastening to thy house in Mexico to call one of the priests loved by our Lord to come and hear his confession and make him ready, for we who are born do all await the hardship of our death. And though I am departing to do this thing, yet will I afterwards return hither and bear thy. message, my Lady and my Child. Forgive me. Be, patient for a while. I EMPRESS OF: AMERICA will not deceive thee, my smallest daughter. Tomorrow I shall come and in great haste." After hearing the words of Juan Diego, the most loving Virgin made her answer, "Listen and understand, my smallest son. That Which troubles and afflicts thee is nothing, Do not let thy heart be saddened. Do not fear this illness nor any other illness or anxiety. Am I not here, thy Mother? Dost thou not stand under my shadow? Am I not thy health? Dost thou not rest on my lap? What else then dost thou need? Let nothing make thee troubled or unhappy. Be not afflicted by thy uncle's illness, for he will not die of it at this time. For know that he is already well." (And then it was that she healed his uncle, as was discovered afterwards.) Now, when Juan Diego had heard these words of the Lady of Heaven, he felt a deep consolation and happiness, and asked that she send him without delay to see the Bishop and bring him some .sign and proof, so that he might believe. Then the Lady of Heaven told him to ascend the summit of the hill where he had seen her before. "Climb up, my smallest son," she said, "to the top of the hill; where thou didst see me and I gave thee orders thou shalt find different flowers. Cut them and gather them. Then come and bring them to me." Juan ,Diego straightway climbed the hill; and, when he reached the top, he was astonished to find that thebe had blossomed before their season so great a number of various exquisite roses of Castille; for at that time of the year the ice was very severe. The roses ~ave off a great fragrance and were filled with the dew of night that seemed like' precious pearls. Forthwith he began to cut them, joining them togdther and putting them into his cloak-fold. Now, the top of the hill was not.a place where any flowers grew, for it had many rocks, thistles, thorns, nopales, and mezquites. And even if there had been little plants, at that time it was the month of December in which the frost eats and spoils everything. He clambered down without delay and brought the Lady of Heaven the various roses that he had gone to cut. When she saw them she gathered them in he~ hand and again placed them in his bosom saying, ~'My sr~all-est son, these roses of various kind are the proof and sign that thou wilt bring the Bishop. Thou wilt tell him in my name to see my will in this sign and to carry it out. Thou art my ambassador, worthy of confidencd. I strictly order thee to unfold thy mantle and show what thou art bringing before the Bishop alone. Thou wilt relate everything. Thou wilt say that I told thee to climb to 119 'EMPRESS OF ~IMERICA Review for R~ligious the stimmit of the hill to cut flowers, and all that thou didst see and admire, that thou mightest persuade the prelate to lend his hand in the building of the church which I have.requested." After the Lady of Heaven had given him her charge, be started on the way that leads straight to Mexico, happy and sure of sucdess, carefully bearing his burden in his bosom, so that notbng would fall from his hands, and enjoying the fragrance of the various kinds of beau-tiful, flowers. When he had arrived at the palace of the Bishop, the majordomo and other servants of the prelate came out to meet him. He asked them to tell the Bishop that he wished to see him. Yet none of them was willing and acted as if they had not heard him, because it was very early; or perchance they had recognized him and thought him a nuisance. .Besides, they had h~ard from their dompanions how they lost sight of him when their had followed him the day before. Hence, Juan Diego was there many hours waiting. Afte~ a time they noted that be bad been there a long time, standing, downcast, doing nothing. Noticing that he seemed to be carrying something in his bosom, they came near t6 see what it was and to satisfy them-selves. Juan Diego saw that he could not hide his burden withou~ their molesting and manhandling or beating him; so he opened his mantle a little and showed that it contained flowers. They, perceiv-ing that there were various kinds of roses of Castille and re~ilizing that it was not then the season for them to bloom, were greatly taken aback, especially because the flowers .were very fresh, in full "bloom, fragrant and precious, They wanted to take some, but when they dared to touch them they met no success; for when their hands drew near, they saw no true flowers but what seemed to have been painted or'engraved or sewed on the mantle. They went thereupon to tell the Bishop what they had seen and that the little Indian who had come so many times now desired to see him and that be bad been w~iting a long time. Hearing this, the ,Bishop thought that this would be the proof to certify a'nd carry out what the Indian asked. Immediately he ordered Juan to come in. When he entered, Juan did reverence before the Bishop as he had done before, and again relating everything that he had seen and admired, he delivered his .message. "My Lord," said he. "I did what thou didst order me. I went to tell my Mistress, the Lady of Heaven, Holy Mary, the precious Mother of God, that thou didst desire a sign that thou mightest be able to believe me before thou were to make the church where she requested it. I told her 120 May, 1955 EMPRESS' OF ,AMERIC,~ besides that I had given thee my word to bring some sign and proof of her will, as thou. didst demand. She received thy message and kindly granted what thou dost ask, a sign and proof that her will be done. Very early this morning she told me to come again to see thee~ I asked for,the, sign so that thou mightest believe me, which she promised she would give. Immediately she fulfilled the promise: she sent me to the summit of the hill, where I had seen her before, to cut various roses of Castille. And after I went to cut them, I brought them down and she gathered them in her hand and .again put them into my bosom for. me to bring to thee in. person. For, although I knew that at t~e top of the hill there is no place where flowers grow, for there are onl~ rocks, thistles, thorns, nopale~, and mezquites, .I did not doubt. And when I had reached the summit, I saw that I was in a paradise where were all the varied and exquisit~ roses of Castille, sparkling with dew, and these I began to cut. She told me to give them to thee. And so I now" do, so that thou mayest see in them the sign that thou askest and mayest carry out her will,. and-so that the" truth of the words of my message may be made manifest. Here they are; do thou receive them." Then he unwrapped his ~¢hite maiatle which held the roses in its fold. As they were scattered on the floor, all these differentroses of Castille, suddenly there appeared drawn on' the mantle the precious image of the ever Virgin Mary, Mother of God, as it,exists and is preserved today in bei- church of Tepeyacac, which is .called Guadalupe. When the Lord'Bisbop bad seen this, be and all w.bo were there knelt down and greatly admired it. And when they arose they were sad and grieved, for they had gaZed upon the image with their whole heart and mind. With tears of sorrow the Lord Bishop earnestly begged pardon for not baying carried out our Lady's will and command. When he had arisen he loosed the garment from 3uan Diego's neck, the mantle on which appea~ed the image of the Lady of Heaven. And taking it he Went' to place it ifi hi~ oratory. 3uan Dieg6, therefore, at the Bishop's command, remained one day more in the Bishop'~ house. The next day the prelate said, "Now show where it is the will of the Lady of Heaven that her church be built." And im-mediately he invited all to take part in the building. '3uan Diego had hardly indicated where the Lady.of~ Heaven had Ordered that her church be built when he asked permission to leave. Hewished now to hasten home and see his uncle 3uan Ber-' nar~tino, who had been very ill when bedeparted for Thtilolco to 121 EMPRESS OF AMERICA call a priest who might hear his confession and make him ready, on that day when the Lady of Heaven told him that he was already made well. Yet the people did not permit 3uan to return alone, but accompanied him to his house. And when they arrived they saw his uncle, who was very cheerful and felt no suffering. He was very much surprised that his nephew arrived surrounded and honored, and he asked him the reason why they were acting so and doing him such reverence. His nephew replied that when he went to call the priest to hear his confession and make him ready, the Lady of Heaven had appeared to him in Tepeyacac, that she told him not to be distressed, for his uncle was alrea~ly well, and that he had felt much consoled. She had sent him to Mexico to see the Lord Bishop in order to have a church built in Tepeyacac. His uncle re-lated that he was certain that it was she who had healed him at the moment, for he had seen her in the same way in which she appeared to his nephew, and had learned from her that she had sent him to Mexico to see the Bishop. Then had the Lady also told Bernardlno that when 3uan went to see the Bishop he should reveal what he had seen and the miraculous way in which she had cured him; and that he should tell the Bishop to call her (for it was fitting that her blessed image be so called) the ever Virgin Holy Mary of Guadalupe. Then they brought 3uan Bernardino into the presence of the Lord Bishop, to come and tell the story and give testimony in his presence. The Bishop received them both as guests iri his house several days, until the church of the Queen was built in Tepeyacac where 3uan Diego had seen her. The Lord Bishop also brought the holy picture of the beloved Lady of Heaven to the principal church, removing it from the oratory of his palace where it had been, so that all the people might see and admire the blessed likeness. The entire city was moved and came to see and admire the pious image and offer prayers. They were astonished that it had appeared by a divine miracle, for no person in this world painted her precious image. SURSUM CORDA Sursurn Corda is a new review for priests and religious, published by the Fran-ciscan Fathers. Its second number (February, 1955) contains the Address of His Excellency the Apostolic Delegate, Archbishop Carboni, to the First Congress of Religious Women of Australia, New Zealand, and Oceania, held at Rose Bay, Sydney, N.S.W., January 18, 1955. The editorial and business address is: 45 Victoria St., Waverly, N.S.W., Australia. 122 ' Pope Plus XII and !:he Religious Lil:e [EDITORS' NOTE: This valuable compilation of papal texts was made by Joseph F. Gallen, S.3. The first installment was published in our January number, pp. 3-11 ; the second in March, pp. 85-92. In his own iintroduction, Father Gallen ex-plained his selection of texts and his methods of reference. To facilitate reading the present installment, it is sufficient to recall that statements preceded by an asterisk were not made directly and ex.plicitly to or of religious and that all paragraphs ex- ¯ cept number 39 are taken from the Acta Apostolicae Sedis, the first number being the volume, the second the year, I~nd the third the page.] IV. THE VOWS 47. Pouertg. "The law of life itself demands the union of the old and the new that life may be ever the same and yet ever vigorous. Therefore, preserve fully and exactly, that form of religious life for whose observance and expression you have arisen in the Church. Certainly that which your glorious predecessors proposed to them-selves and to their" fellow-religious, also of the future, to be guarded with the utmost exertion, was evangelical poverty according to the law and example of the patriarch of Assisi. What an offscouring .of evils has arisen from the accursed thirst for riches! It is thee cause of wars, seditions, hunger, weakening of morals, of destruction. The abnormal disparity between those of excessive, wealth and those wasted by misery and want gives rise to fatal sources of cor-ruption. An admirable remedy for this calamity and corruption is the example of evangelical poverty. This is the attendant from heaven of the precept of labor, the friend of virtue, the teacher of nations, the protection and glory of the Kingdom of Christ, the most faithful preserver of a better hope. Its glorious standard has been entrusted to your hands; preserve it unstained. It is dishonorable to profess poverty in the dissimulation and fallacies of word and to destroy it in fact. Individual religious institutes, due to their growth and increase, may need more and larger houses. It is licit to secure these, but proper moderation and proportion are to be observed. Do not permit the beauty of poverty that is mani~fest in your habit and clothing to be lamentably clouded by sumptuous dwellings and delicate pleasures and comforts of life nor that your conduct contradict your words." Allocution to Fathers of the Order of Friars Minor Capuchin, 40-1948-551, 552. *48. "But even here a 'due measure and discretion' is to be ob- 123 POPE PlUS XlI Religious served, lest it ever .happen that those [seminarians] who must be trained 'tb 's~lf'-d£ni~aF and evangelical virtue live 'in palatial houses and luxurimls ease.and comfort. Apostolic Exhortation, "Menti Nostrae," 42-1950-685. *49. Chastit~l. "The pries.tly office demands from you,'We might say, exceptional sacrifices, and of these the: most outstanding is the complete sacrifice of one's self in al'legian~e to Christ by celibfic}. You must examine yourselves! If any find that they are incapable of:'observing .celi~ac3(,, We beseech them to leave the seminary and to devote themselves to another calling i~. which they will achieve a morally upright and fruitful life, impossible for them in the sanc-tuary without danger to their own eternal salvation and of dishonor for the Church." Address to theStudents o[ the Roman,Serninarie.s, Colleges, and Institutions, 31-1939-249, 250. ,. 50. "In tl~is earthly exile nothing indeed is more b~autiful, nothing more lovable than the immaculate splendor of virginity that shines from the face, the eyes and the affections and gently excites directs others to heavenly 'things. If the flame of divine charit-y is added to the brightness of this unsullied integrity, the resul{ 'i's something .that deeply moves the minds of men, powerfully attract~ their wills and inspires'them to the noble deeds that Christian virtue alone Can effect." Carbonization of B. M. Capitan,'o and C. V. Gerosa, 42-1950-418. '51. "Watchful and attentive care must be taken to make~sur~ that recruits for the sacred militia have great esteem for chastity, love and preserve it, since it. is one of the' main reasons why they have Chosen this.type of life and" persevere ih this vocation. The faci that in the course of human contactS this virtue is exposed to such great dangers demands that in those Who are to take upon them! selves the dignity of the priesthood purity :should "be of long stand'-:" ing anddeeply rooted. Hence, not only should clerics be ~ad~ aware at the proper time of the meaning of priestly celibacy and of tl~e chas~ffy they must practice, as well as of the obligatiotis entails, but they should also be warned of the dangers they ma~ encounter. Seminarians should likewise be urged to avoid from their earliest years all dangers to purity b~" recourse to those method~ of restraining the passions that are recommended by the masters of the spiritual life. Their progress in other virtues and the richnes~ of the fruits of their priestly zeal will be in proportion to the firmness and constancy' of thei'r control of their passions. Should h young 124 Ma~!, 1955 THE RELIGIOUS LIFE cleric prove to have a tendency to evil and be unable to break off his bad habit after a suitable time of trial, he should be obliged to. withdraw from the seminary before receiving sacred orders." Apos-tolic Exhortation, 'Menti Nostrae," 42-1950-690, 691. 52. "Therefore this modesty is not to be construed as equi'valent to perpetual silenc~ on matters of chastity nor to forbid in the train-ing of character that a temperate and pru'dent word be ever spoken on this matter. In these things youths are to be instructed with suitable counsels, they are to be permitted to manifest their' problems, to ask questions freely, they are to be given sound, clear answers and an explanation sufficient to impart both light and confidence." Allocution to Teachers of the Order of Discatced Carmelites, 43- 1951-736. 53. "Chastity and virginity (which implies also the interior re-nunciation of every sensual affection) does not make the soul a stranger to the world. It rather awakens and develops the energies for greater and higher duties that surpass the confines of individual families. There are today many teaching sisters and sister nurses who, in the better sense of the word, are closer to life than the or-dinary persons of the world." Apostolic Exhortation to the Inter-national Conoention of Teaching Sisters, 43-1951-741. 54. "Today We wish to speak only to those, whether priests or laymen, preachers, public speakers and writers, who have not a word of approval or praise for virginity vowed to Christ, who for years past, contrary to the warnings of the Church and in oppo-sition to her thought, have in principle given marriage the prefer-ence over virginity and who have gone so far as to present marriage as the only means capable of assuring its development and natural perfection to the human personality. Those who speak and write iri this manner are to take cognizance of their responsibility before God and the Church. They are largely to blame for.a fact that We can mention to you only with sadness. Today more than ever there are repeated requests for Catholic sisters from the Christian world and from outside it, and one after anothe¢ they must be given a sorrowful refusal; at times even works of long standing, hospitals and educational establishments must be abandoned--all because vocations are not sufficient for the needs." Address to the Congress of Mothers General, 44-1952-825. *55. "Here We must add, as the holy fathers and doctors of the Church have so clearly taught, that virginity is not a Christian 125 POPE PIUS XlI Review for Religious virtue unless embraced 'for the kingdom of heaven,' that is, unless its motive is to devote oneself more readily" to divine things, greater security in the attainmefit of eternal happiness and finally greater freedom for a zealous devotion also to the eternal salvation of others. They cannot claim the honor of Christian virginity who abstain, from marriage from excessive selfishness,, or to escape its obligations . . . or to make a proud and pharisaical boast of the integrity of their bodies, : . . a virgin is not to refrain from mar-riage as something ugly but because of the beauty and sanctity of virginity . Accordingly, this is the primary motive, the principal reason for Christian virginity: to strive only for the things of heaven and to direct the mind and heart to divine things, to please God in everything, to meditate on Him deeply, and to consecrate body and soul to Him entirely . It is evidently the love of Christ that persuades the virgin to flee to the cloisters of the mon-astery and to remain there forever that she may more freely and easily devote herself to the contemplation and love of her Divine Spouse; it is the love of Christ that profoundly moves her to un-dertake with all h~r strength and even to death works of mercy for her neighbor." Enc~tclical Letter on Sacred Vlrginit~t, 46-1954- 164, 165, 167. *56. "Before entering on such a very narrow path, all whose experience has shown them that they are very weak in this matter shall humbly heed the warning of Paul the Apostle: 'But if they do not contain themselves, let them marry. For it is better to marry than to be burnt.' There are many for whom the burden of per-fect chastity would evidently be so onerous that it could not be counselled to them. In the same way, priests who have the serious duty of counselling youths who say that they feel drawn to the priesthood or religious life are to urge them to give the mattercare-ful consideration, lest they enter on a way of life that they cannot hope to travel constantly and successfully to its end. Such priests are to give prudent thought to this suitability and, if judged ex-pedient, shall seek skilled advice. If a serious doubt remains, espe-cially if founded on the facts of their past lives, priests shall oblige such candidates to give up the intention of entering on the state of perfect chastity and forbid them admission to sacred orders or religious profession." Enc!jclical Letter on Sacred Virginit~l, 46- 1954-180, I8i. 57. Obedience. "Another effect will be that your obedience will 126 May, 1955 THE RELIGIOUS LIFE be established on a perpetually unshakeable foundation. Your stan-dard, your glory, your strength is your obedience. This above all must make you completely docile to the will of your superiors, with-out complaints, without murmur, without that reprehensible criti-cism, the disease of our age, which enfeebles the strength of men and renders their apostolic efforts sluggish and fruitless. The heavy burden imposed by your austere obedience will become light if you are motivated by charity. If charity is present, God is present, be-cause 'God is charity.' Therefore; let there be in you 'charity from a pure heart, and a good conscience, and an unfeigned faith.' " Atlocution to the XXIX General Congregation of the Societ~t of desus, 38-1946-383, 384. 58. "Indeed some praise as the real peak of moral perfection, not the surrender of liberty for the love of Christ, but the curbing of such surrender. The norm therefore to be preferred in the forma-tion of a just and holy person would be this: restrict liberty only where necessary; otherwise, give liberty free rein as far as possible. We transmit the question whether this new foundation 6n which some are trying to erect the edifice of sanctity will be as effective and as solid in supporting and augmenting the apostolic work of the Church as was the one which through fifteen hundred years has been provided by that ancient rule of obedience undertaken for love of Christ . No one is obliged to choose for himself the counsel of perfect obedience, which essentially is a rule of life whereby one surrenders the control of his own will . But words must be understood and accepted according to their obvious meaning, and if this norm is compared with the vow of obedience, it surely does not possess the same supreme value, nor is it an expression of the wonderful example recorded in Holy Scripture: 'He humbled Him-self becoming obedient unto death.' Therefore be is deceived him-self and deceives others who, forgetting the propensities of the soul and the inspiration of divine grace, offers as a guide to one seeking advice about entering the religious state only that new norm. Hence if it is clear that the voice of God is calling someone to the heights of evangelical perfection, without any besitatior~ be should be invited for the attainment of this lofty purpose to offer freely the sacrifice of his liberty as the vow of obedience demands, that vow, We proclaim, which the Church through so many centuries has weighed, has put to the test, has properly delineated and has ap-proved. Let no one be compelled to this self-consecration against 127 PoPE PlUS XlI Review ~:or Reliyfous his will; but if be.does will it, let'no one counsel him against it; above all, let no one hold him back." Address to the Genera[ Con-gress or) the States of Pe.rfectfor), 43-1951-31. 59. "It is certainly of supreme importance that supernatural obedi-ence, motivated by an ardent love of God, should be firmly, insist-ently and fervently fostered, and prevail, according to the norm of their laws; in religious houses. Doesn't the solid support of re-ligious discipline and life have its foundation here? Isn't the past or future success of the great undertakings that religious have and will accomplish to be .attributed solely to the un'iOn of tbeir force's by obedience? You must therefore recognize, r~spect and gladly accept the salutary yoke of obedience as the burden of the brave. However, in our day, in which the machine holds universal sway, wben the mechanical arts bare penetrated everywhere, absorb us and fashion everything to their image, superiors are to be careful not to treat their subjects almost as merchandise or parts Of a ma-cbine but they are always to respect the human person." Allocution to Teachers of the Order of Discalced Carmelites', 43-1951 - 736. V. PARTICULAR VIRTUES 60. Necessity of it)terror life. "But this also, as far as you can, you sbould accomplisb. . . tbat all wbom you can reacb are to be taugbt that notbing is preferable, nothing more necessary than that all should adorn their souls with heavenly virtues and especially that they should foster the divine life from which such virtues arise and grow. Whoever neglects this interior and supernatural life, v~hicfi is nourished by divine grace, whoe~'er devotes himself only to ex.- ternals, even if praiseworthy and adapted to the times, sooner or later realizes that he has given himself to a sterile and perishabl~ work. You know that 'every best gift, and every perfect gift, is from above, coming down from the Father of lights'; therefore, everythin~g also appertaining to the apostolate will be vain and empty unless moved b'y the spirit that is from God." Letter ob the Fifth Centenar~t of the Death of St. Colette, 40-1948-105, 106. 61. "With the same devotion that you cherish religious poverty in external matters you are to accumulate the v~ealth of a true in-terior life and to acquire spiritual riches: love of God and your ~aeighbor, real penance, a knowledge of sacred sciences, and a burn-ing desire to extend the Ki.ngdom of Christ. It is your duty to be conspicuous by a simplicity of conduct, a splendor of goodnesS, a brightness of holy joy, in your sacred ministry humbly to serve 128 May, 1955 "~HE RELIGIOUS LIFE the humble, especially the poorer, whom now evil men by so many evil arts strive to bind to themselves, to favor and assist." Allocu-tion to Fathers of the Order of Friars Minor Capuchin, 40-1948-! 552. 62. "The most active zeal can be closely allied with the quest for the riches of the interior life . An eager external activity and the cultivation of the interior life demand more than a bond of fellowship; as far at least as evaluation and willed effort are con-cerned, they demand that they should march along together step by step. With the growth of devotion~ to exterior works therefore, let there shine forth a cor~espdnding increase in faith, in the life of prayer, in zealous consecration of self and talents to God, in spotless purity of conscience, in obedience, in patient endurance of hardship, and in active charity tirelessly expend.ed for God and one's neighbor . The Church insistently demands of you that your external works correspond to your interior life and that these two: maintain a constant balance." Address to the General Con-gress on the States of Perfection, 43-1951-32. *63. Charity. "But legitimate and well-ordered love of our native country should not make us close our eyes to the all-embracing nature of Christian charity, which calls for consideration of others and of their interests in the pacifying light of love." Encyclical Letter, "Sumni Pontit~catus," 31-1939-549. *64. Prayer. Its necessity. "Your divine vocation is to prepare the way in the souls of men for the love and grace of Jesus Christ. This cannot be accomplished unless you yourselves are already im-bued with that love. Enkindle the love of Christ in yourselves by union with Christ in prayer and sacrifice. By uhion, We say, in prayer. If you ask Us what word We have at the beginning of Our pontificate for the priests of the Catholic Church, We reply: pray, pray more ~nd more, and more insistently! By union also in sacri-fice: in the Eucharistic Sacrifice, but not only in the Eucharistic Sacrifice but also in a certain sacrifice of one's self. You realize that one of the effects of the Most Holy Eucharist is to confer strength to sacrifice and deny themselves on those who assist and receive. The various forms of Christian asceticism may continue to differ with regard to many secondary principles but none of them knows any way to the love of God that does not demand sacrifice also of one's self. Christ demanded this of His followers when He said: 'If any man will come after me, let him deny himself, and take up 129 Reuiew for Religious his cross daily, and follow me.' In explicit language He defined the way to the love of God as the observance of the divine ~com-mandments. Finally, especially to His apostles He addressed that wonderful sentence: 'Amen, amen I say to you, unless the grain of wheat failing into the ground die, itself remaineth alone; but if it die, it bringeth forth much fruit.' " Address to the Students of the Roman Seminaries, Colleges, and Institutions, 31-1939-249. *65. "For such a formation of spirit We recommend prayer above everything else, as We have already said to the students of the sanc-tuary in their first gathering before Us. Pray, pray, pray; prayer is the key of the treasures of God; it is the weapon of combat and of victory in every struggle .for good and against evil. What can-not prayer accomplish by adoration, propitiation, petition, thanks-giving?" Address to Italian Catholic Action, 32-1940-368. *66. Necessity of mental pra~ter. "Genuine and real piety, which the Angelic Doctor calls 'devotion,' and which is the principal act of the virtue of religion, that act which correctly relates and properly directs men to God and by which they free!y and spontaneously give themselves to everything pertaining to the worship ~f God, needs meditation on the supernatural realities and spiritual exercises if it is to be nurtured, stimulated, sustained and is to prompt us to a more perfect life . Since our hearts, disturbed as they are at times by the lower appetites, do not always respond to motives of love, it is also extremely helpful to allow consideration and con-templation ~)f the justice of God to excite us on occasion to salutary fear and guide us thence to Christian humility, repentance and amendment." Encyclical Letter, "Mediator Dei," 39-1947-534, 535. *67. "First of all, the Church exhorts us to holy meditation, which elevates the mind to things of heaven, draws our thoughts to the supernatural and, once our soul has been inflamed with the desire of God, directs it to Him along the path of right reason . Now it is absolutely essential that sacred ministers should most diligently reproduce in their own lives these examples from the Gospel and the virtues of our Divine Redeemer. But just as bodily food does not nourish, sustain and increase life unless it is digested and be-comes part of our own substance, so also unless the priest by medi-tation and contemplation on the mysteries of our Divine Redeemer --who indeed is the supreme and absolute Exemplar of perfection and the inexhaustible fountain of holiness--lives the life of this same Redeemer, he cannot gain control over himself ~ind his senses, 130 Mag, 1955 THE RELIGIOUS LIFE purify his soul, strive for virtue as be should, nor lastly discharge his sacred duties faithfully, zealously and fruitfully . Where-fore, in all truth must We assert that the special efficacy attached to meditation cannot be supplied by any other means and conse-quently that nothing else can replace the practice of daily medita-tion." Apostolic Exhortation, 'Menti Nostrae,' 42-1950-672. *68. Efficac~t of private pra~ter. "There are others who deny any impetratory powers to our prayers and spread abroad the idea that prayers offered to God in private are of little value. Public prayers, that are made in the name of the Church, are those that really avail, since they come from the Mystical Body of Jesus Christ. Such an opinion is false; for the Divine Redeemer maintains closest union not only with His Church, which is His beloved Spouse, but also with each and every faithful soul in it, and He longs to speak with them heart to heart, especially after Holy Communion. It is true that public prayers, since they are offered by Mother Church and because of the dignity of the Spouse of Christ, excel any other kind of prayer; but no prayer, even the most private, lacks its own dignity and power, and all prayer is immensely helpful to the en-tire Mystical Body." Enc~tclical Letter, 'Mgstici Corporis," 35- 1943-235, 236. 69. "But here also there can be a sin of excess. There are some whose extravagant praise of the liturgical forms of the ancient ages easily leads them to a confempt of those of the later centuries and to despise private and popular prayers. Liturgy, which means all forms of worship established by ecclesiastical authority, is something last-ing and living that grows through the cefituries. An attraction for the youthful years must not result in a contempt for the older years . The essential thing in divine worship and the care of souls is always that the followers of the Gospel in the innermost depths of a good conscience seek God, reverence the majesty and the law of the celestial Godhead, do penance for their sins, confess their sins with sorrow and wash away their punishment with works of mercy, acquire grace and live rightly that they may live forever and happily. There are some who eat solid food and some are nour-ished on milk." Homil~t on the Fourteenth Centenar~l of the Death of St. Benedict, 39-1947-455,456. *70. Individual inclinations in praver. "Many of the faithful are unable to use the RomanMissal, even in their native language; nor are all capable of understanding correctly the liturgical rites and 131 POPE PIUS XII Review [or Religious formulas. So varied and diverse are me6's talents and temperaments that it is impossible for all to be moved and attracted to the same extent by community prayers, hymns, and liturgical services. More-over, the needs and inclinations of all are not the same nor are they always constant in the same individual." Encyclical Letter,. "Mediator Dei," 39-1947-561. "71. Multiplicity of prayers. "Above all, do not cease to incul-cate into the minds of all that the Christian life does not consist in the multiplicity and variety of prayers and exercises of piety but rather in their helpfulness towards spiritual progress of the faithful and constant growth of the entire ChurCh." Encyclical Letter, "Mediator Dei," 39-1947,587. *72. "But it should be noted that piety and genuine and ardent zeal for prayer are worth more than a mere multiplicity of prayers." Apostolic Exhortation, "Menti Nostrae," 42-1950-673. *73. Spiritual routine. "When young men perform the same exercises of piety according to a practically unchanging daily rou-tine, we can fear that their interior spirit may not be entirely in harmony with the external practices of religion. By force of habit this can happen to them all the more easily and even grow worse when they leave the seminary and are engrossed frequently in the necessary performance of their duties." Apostolic Exhortation, "Menti Nostrae," 42-1950-689. *74. Externalism. "It is not merely a question of recitation or of singing [the divine office] which, however perfect according to norms of music and the sacred rites, only reaches the ear, but it is especially a question of the ascent of the mind and heart to God so that, united with Christ, we may completely dedicate ourselves and all our actions to Him." Encyclical Letter, "Mediator Dei," 39- 1947-574. *75. Ritualism and Formalism. "But the primary element of divine worship must be interior. For we must always "live in Christ and give ourselves to Him completely . This recommendation the liturgy itself is careful to repeat as often as it prescribes an exterior act of worship. Thus we are urged, when there is question of fast-ing, for example, 'to give interior effect to our outward observance.' Otherwise religion clearly amounts to mere ritualism and formal-ism . It should be clear to all, then, that God cannot be honored worthily unless the mind and heart are elevated to Him in quest of 132 May, 1955 THE RELIGIOUS LIFE the perfect life." Encyclical Letter, "Mediator Dei,' 39-1947-531, 532. *76. "Besides, sin~e they [non-liturgical practices of piety] de-velop a deeper spiritual life in the faithful, they prepare the faith-ful to take part in sacred public functions with greater fruit and lessen the danger of liturgical prayers becoming an empty ritual-ism." Encyclical Letter, "Mediator Dei," 39-1947-584. *77. Humility. "Let the priest not trust in his own strength, find undue satisfaction in the contemplation of his talents, go search-ing for the esteem and praise of men or eagerly long for higher positions. Rather let him imitate Christ, who 'has not come to be served but to serve'; let him deny himself according to the law of the Gospel and be not inordinately attached to the things of earth, that he may the more easily and the more readily follow the Divine Master." Apostolic Exhortation, "Menti Nostrae," 42-1950-662. *78. Necessity, motive, and purpose of detachment. "He g~ce himself to God and to souls entirely, forever, with no hesitancy, with no reserve. Here is the secret of his heroic training for the supreme victory. To give himself completely, he renounced every-thing . It would be folly to renounce everything and oneself only to make a desert bf oneself. This is not what is done; no one has the right to do it. The motive of renunciation is a greater and holier love. Of this you must be deeply convinced, beloved sons of the Institute of th~ Foreign Missions: for love of God, for love of souls your fellow-member was detached from everything and from himself. This detachment and motive are evidently com-mon to all true apostles, but such love is of varying degree accord-ing to the temperament, charactgr, and natural and supernatural gifts of each." AItocution on the Beatification of Alberico Cris-citelli, 43-1951-165, 167. 79. Penance and mortification. "Not all, particularly in our day, understand as they should this kind of penitential life. Many to-day consider it either of little value or wearisome and neglect it entirely. However, we are not to forget that the lamentable fall ¯ of Adam has infected all of us with the hereditary blemish and inclines all of us readily to the allurements of sin. Penance, there-fore, is.absolutely necessary for us, according to the words: 'but except you do penance, you shall all likewise perish.' Nothing is of greater force in restraining the disordered passions of the soul and in subjecting the natural appetites to right reason. When we 133 POPE PIUS XII Revieto for Religious emerge victorious from this struggle, even though we must follow constantly in the footsteps of Jesus Christ and in a certain manner crucify our own flesh, we shall even in this life possess those heav-enly joys and delights that surpass the pleasures of earth as much as the soul does the body and heaven the earth. Holy penance and voluntary mortifications have their own heavenly consolation that the perishable and fleeting pleasures of life cannot give." Canoni-zation of Marianna of Jesus of Paredes, 42-1950-611, 612. *80. Correspondence with grace and self-effort. "Very truly the sacraments and the sacrifice of the altar, being Christ's own actions, must be held to be capable in themselves of conveying and dispensing grace from the divine Head to the members of the Mystical Body. But if they are to produce their proper effect, it is. absolutely neces-sary that our hearts be rigbly disposed to receive them . Em~ phatically, therefore, the work of redemption, which in itself is in-dependent of our will, requires a serious interior effort on our part if we are to achieve eternal salvation." Encgc[ica[ Letter, "Mediator Dei," 39-1947-533, 53.4. VI. MISCELLANEOUS "81. Government. Excessive bureaucraqt. "Finally We wish you to consider a thought that should guide and illumine all your pas-toral act, ion. Dedicate yourselves to it with all your souls. Give to all your activity the personal character of your spirit and your heart. We mean by this that you should be on your guard against an excessive bureaucracy in the care of souls. It is true that the proper management of the parochial office is strictly necessary. Your parishioners, however, must always and in all circumstances sense the kindness and paternal affection that beats in the heart of the pastor. Each and every one of your faithful should feel it, should be able to approach you easily and find in you the help and pro-tection that will fulfill the expectation of his trust." Allocution to Roman Pastors and Lenten Preachers, 43-1951-116. 82. Maternal government. "And now, dearest daughters, We pass on to give you two pressing exhortations. ;Fhe first is that of maternal affection in the direction of your sisters. It is undoubt-edly t~ue, as the psychologists maintain, that when in authority it is not as easy for woman as for man to find the exact balance between severity and kindness. This makes it all the more neces-sary to cultivate your maternal sentiments. Remember that for 134 Mar , 1955 THE RELIGIOUS LIFE your sisters as well as for yourselves the vows demand a great sac-rifice. They have renounced their families, the happiness of mar-riage and the intimacy of family life. This is a lofty sacrifice and of decisive importance for the apostolate of the Church, but it is none the less a sacrifice. Sisters of greatness of soul and delicacy of sentiment feel this detachment most keenly. The words of Christ, 'He that putteth his hand to the plough and looketh back is not fit for the kingdom of God,' find their full application here, also today, and without reservation. But the order should replace the family as much as it can, and on you, the mothers general, falls primarily the duty of breathing the warmth of family affection into the common life of the sisters. You must be motherly in your ex-ternal conduct, in your words arid writings, even when this de-mands self-mastery. Above all, be maternal in your inmost thoughts, your judgments and, as far as possible, in your feelings. Beg Mary, the Mother of Jesus and our own Mother, every day to teach you to be maternal." Address to the Congress of Mothers General, 44- 1952-825, 826. 83. Union. Federation of independent houses. "The prolonged actual living and experience of a confederation can convince you of the great wisdom of the Supreme Pontiff, Leo XIII, in procuring that the various Benedictine families, commonly called 'black Bene-dictines,' be united by the bonds of a brotherly confederation, with-out injury to their own institutes or norms. By the realization of this plan, the autonomy or faculty of living according to their own laws, the original norm that g'uided your monasteries, was in fact adapted to modern times in a salutary and provident manner, since it was demanded by the changed circumstances and the common good. In ancient and medieval times, when communications were more confined, the care of the faithful restricted to lesser necessities and the pursuit of. learning less extensive, such autonomy was more consistent. Aren't the very congregations of Benedictine religious that have arisen in the course of centuries an evident argument that a.fraternal union of effort is desired for the strengthening and per-fecting of discipline? Isn't this proved also by the wider associa-tions that were formed, for example, of Cluny and Bursfeld? If the individual monasteries had remained entirely alone, the Maurine Congregation of Benedictines could not have acquired such high renown for advancing sacred sciences, and elsewhere also the luster of your outstanding fictixiity and solid honor would have been dimmed. POPE PlUS XII Review for Religious In this age, the greater facility of communications, the will that is found everywhere more prone to united efforts, the desire for wider learning, for counsel, the instriaments of zeal necessary for priests and also for missionaries to fulfill the expectation placed in them require federations, demand union. If autonomy is unreason-ably retained, there will be found perhaps monasteries that are unequal to their purpose because, of the small number of religious, and the discipline of the observance of rule can also be weakened and even dangers can gradually creep in." Homily on the _Four-teenth Centenar( of the Death of St. Benedict, 39-1947-454, 455. 84. "For the circumstances of our age, with its much greater facility of communication, the increase in the sacred duties and the greater learning required of ministers of the Church seem to de-mand a union of members. Indeed, the J~enedictine Congregations erected in the past are a proof that the progress of the religious life demands that brothers unite their labors with their brothers." Approual and Confirmation of the Constitutions of the Confeder-ation of the Benedictine Monastic Congregations, 44-1952-521. 85. "In view of changed circumstances there are now many con-siderations which make it advisable and sometimes even necessary to confederate monasteries of nuns." Apostolic Constitution, "Sponsa Christi," 43-1951-13. 86. Centralization. "When the number of houses had so in-creased, the discerning superioress perceived clearly that it is most difficult to attain a unity of religious spirit and to preserve for any length of time union between different houses completely subject to the ordinaries of the" individual places. She realized that no small utility would accrue to the entire congregation i~ it were ruled by a common and uniform government, in which the strength of any institute and the life of religious discipline almost consist. For the attainment of this purpose nothing seemed to her more oppor-tune and suitable than to subject all the houses, whether already founded or to be founded in the future, to the house at Angers and to place a mother general over th~ entire congregation. This intention, although approved by the Bishop of Angers and other very prudent men, gave rise to a serious controversy . These dissensions could not but greatly sadden Mary of St. Euphrasia but were powerless to break her spirit or weaken her constancy. ¯ . . The Sacred Congregation of Bishops and Regulars, on Janu-ary 9, 1835 . approved the intention of the servant of God, 136 May, 1955 THE RELIGIOUS LIFE and Pope Gregory XVI, of happy memory, deignedto confirm this decree in all respects . This same Predecessor of Ours, after the matter bad again been subjected to a thorough examination . solemnly confirmed that decree." Decretal Letters of Canonization of St. Mary of St. Euphrasia, 33-194.1-141. 87. Nuns. Introduction of solemn vows. "All monasteries [of nuns] in which only simple vows are taken shall be entitled to ask for the introduction of solemn vows. In fact, unless there are serious reasons to the contrary, they shall take steps to return to the solemn vows." Apostolic Constitution, "Sponsa Christi," 43- 1951-16. 88. Necessity of at least minor papal cloister. "Papal cloister, either major or minor, is to be regarded as a necessary condition not only that solemn vows may be taken but also that those monas-teries in which simple vows are taken may hereafter be considered true monasteries of nuns according to can. 488, 7°." Apostolic Constitution, "Sponsa Christi," 43-1951 - 17. 89. "If however it appears with certainty that in any monas-tery [of nuns] even the minor cloister cannot regularly be ob-served, that monastery is to be converted to a house of either a congregation or a society." Apostolic Constitution, "Sponsa Christi," 43-1951-17. 90. Unity among rebgious institutes. "Harmony and generous agreement between the different religious families can be very favor-able in attaining such a desirable outcome. Mutual knowledge and encouragement, a holy rivalry cannot but be of mutual advantage. Splendid initiatives are already apparent in this respect; it remains only to perfect them." Apqstolic Exhortation to the International Convention of Teaching Sis'ters, 43-1951-743. 91. Praise of Religious Women. "How could the Church in later and more modern times have fully accomplished her mission with-out the work of the hundreds of thousands of religious women per-formed with such great zeal in education and charity? How could she accomplish it in our day? May your dedication, love and sac-rifices, so frequently hidden and unknown but suffered for love of ¯ Christ to benefit youth, produce in the future, as in the past, a hundred-fold of good! May the Lord reward you for it and pour out on you the abundance of His divine favors!" Apostolic Ex-hortation to the International Convention of Teaching Sisters, 43- 1951-739. 137 POPE PIUS 92. Clerical and religious states. "It is a distortion of the truth to say that the clerical state as such and as of divine law demands .either by its very nature or by some postulate of that nature that the evangelical counsels be observed by its members and that for this very reason it must or may be called a state of achieving evan-gelical perfection . So too, the fact that the priests of the Latin rite are bound to observe holy celibacy does not remove or lessen the distinction between the clerical and the religious states. More-over, a member of the regular clergy professes the state and condition of evangelical perfection not inasmuch as he is a cleric but inas-much as he is a religious." Address to the General Congress on the States of Perfection, 43-1951-29. 93. Exemption. "Again, the exemption of religious orders is not contrary to the principles of the constitution given to the Church by God nor does it in any way contradict the law that a priest owes obedience to his bishop. For, according to canon law, exempt religious are subject to the authority of the local bishop so far as the administration of the episcopal office and the well-regulate~d care of souls require. But even putting aside this consideration, in the discussions of the past few decades concerning the question of exemption perhaps too little attention has been paid to the fact that exempt religious, even by the prescriptions of canon law, are always and everywhere subject to the authority of the Roman Pontiff as their supreme superior and that they owe obedience to him precisely in virtue of their vow of obedience . It is there-fore clear that the primary law of God whereby the clergy and the laity are subject to the rule of the bishop is more than sufficiently observed as regards exempt religious, as it is no le~s clear that both branches of the clergy by reason of their parallel services conform to the will and precept of Christ." Address to the General Congress on the States of Perfection, 43-1951-28, 29. *94. Adequate support. "What is more, Venerable Brethren, We heartily commend the plans that you will discuss to insure that priests be provided not only with means to meet their daily needs but also with assurances of assistance for the future--as We are happy to see done in civil society--particularly for cases in Which they may fall ill, be 'afflicted with chronic ill health, or be weakened by old age. Thus you will relieve them of all anxiety for the future." Apostolic Ex-hor. tation,. "Menti Nostrae," 42-1950-698. .138 Through I-lis Blood Joseph H. Robling, C.PP.S. IF variety is the spice of life in general, it is also, in a sense, the spice of our supernatural life. If, for example, we have been considering certain revealed truths from the selfsame aspect so long that they scarcely impress us any more, it is helpful to con-sider them from some other aspect for a while. Many such variations are possible. Among them is the con-sideration of the truths of faith from the aspect of the precious blood of our Lord. This aspect was adopted very notably by St. Gaspar del Bufalo, who was canonized on June 12 of last year. He is called the Apostle of the Precious Blood, not only because he founded the Society of the Precious Blood in Rome in 1815, or because he fostered the pious union of the same name, but also be-cause in his very effective preaching of missions and retreats in the Papal States over a period of more than twenty years before his death in 1837 he frequently focused the attention of his hearers on the precious blood and from that vantage point drove home his message of instruction and exhortation. For this purpose during his sermons he sometimes held a large crucifix portraying the figure of the bleeding Savior and wore on his breast the now familiar mis-sion cross showing our Redeemer in the act of sacrificing even His own blood for sinners. Considering revealed truths from the aspect of the precious blood, we may profitably reflect, for instance, that no grace whatever comes to us independently of the sacrificial blood of Christ; for no grace is given to fallen mankind except that merited for us by the bloody sacrifice of our Redeemer on the cross. This same sacrifice was fore-shadowed and foretold in the Old Testament and is renewed and perpetuated by the holy Mass in the New. Furthermore, since we receive no grace independently of the precious blood, we also would have no means of grace without it--no Church, no priesthood, no sacraments, no sacramentals, no fruitful prayer. Again, since no one can be saved without grace, we can truthfully say that without the precious blood there would be no saint in heaven nor any soul in purgatory, nor even any just man on earth. Without it there would be neither justification nor salvation for any human .person. The blood of Jesus speaks better than the blood.of Abel (Heb. 12:24). It speaks of our Savior's lo,¢e and foFgivenes.s, of the ~13_9 JOSEPH H. ROHLING reality and extent of His sufferings, of the sacrifice He offered and the price He paid, of the tangible evidence and measure of His love for souls, of the mercy and pardon He holds out to repentant sin-ners, and His nourishing of souls in Holy Communion. It teaches the value of an immortal soul, for with St. Paul every human person can say, "He gave himself up for me" (Gal. 2:20), that is, He sacrificed even His own blood for me. And if our own soul., is so valuable in His sight, so is the soul of every other human being. Therefore, it teaches us zeal for souls and forms a powerful motive for missionary undertakings. It also teaches us the value of suffer-ing. If Jesus was willing to go to the extreme limit of shedding His own blood for me, how can I refuse Him the lesser sufferings and inconveniences and sacrifices He asks of me? Modern man tends to regard suffering as the greatest evil. The precious blood, on the other hand, teaches us that sin is a greater evil, because the Son of God was willing to undergo even a bloody death in order that sin might be taken away. The precious blood also supplies us with important motives for contrition and. amendment, for by sin we offend Him "who has loved us and washed us from our sins in hi~ own blood" (Apoc. 1:5). By committing mortal sin we lose all the sanctify-ing grace purchased for us at the price of our Redeemer's blood. Baptism an'd penance cleanse us from sin and punishment insofar as ¯ they infuse sanctifying grace and thus apply the merits of the pre-cious blood. The sacramental anointing with holy oil in confir-mation and 'extreme unction give supernatural strength to the soul because they apply these same merits in their specific way and for their specific purposes. Holy Orders and matrimony give the special graces for which they were.instituted and in'that way apply the merits of the blood of redemption to the recipients to enable them to fulfill the obligations of their respective states of life. The Holy Eucharist nourishes the recipient on the very blood itself that he may have everlasting life and be raised up on the last day (John 6:56). These examples will suffice to illustrate the manner in which 'we can regard the eternal truths from the aspect of the precious blood. For those who have not been using this approach, it may serve as a welcome variation in their prayer and meditation. St. Gaspar del Bufalo used this approach to great advantage. God blessed his efforts. By canonizing him the Church proposes him as a model for all of us. May we benefit by his example! 140 Community Lit:e Bernard I. Mullahy, C.S.C. yOU often hear it said that one of the principal reasons why there are not more vocations to the religious life is that young people find it hard to give up their social life, or that one of the things young women find most difficult in the convent is the lack of social life. Everyone understands What is meant by this, of course; yet, to suggest that in reality the religious life means a denial of social life is to misunderstand either the nature of the religious life or the true meaning of social life or, more fundamen-tally, the nature of the Christian life and its relation to the re-ligious life. The religious life is not something apart from thi~ Christian life, not even something added on to it; it is the Christian life lifted to its maximum dimensions. The religious life is simply a state which provides the best conditions for living the Christian life in the fullness of its perfection and beauty and splendor. Our religious vows are buta fulfillment of our baptismal vows; and perhaps the fact that so many of us have the habit of renewing our religious vows frequently while .hardly ever thinking of renewing our bap-tismal vows is an indication that we do not appreciate clearly and explicitly enough the vital relation between what happened to us on the day of our profession and what happened to us on the day of our baptism. Religious vocation is a flowering of our original vocation to be Christians, and we would surely have a deeper un-derstanding of the implications of our religious life if we had a fuller and clearer appreciation of the meaning of the Christian life. Now the Christian life is essentially a social life. It is a par-ticipation in the communal life of the Trinity and of the Mystical Body. And it goes without saying that this is the most intimate and intense social life conceivable. If then the whole meaning of religious vocation is to lift the Christian life to full perfection, it follows that one of the main purposes of the religiou's life, particu-larly in its cenobitic form, is to enal~le the Christian to live the sociai life of the Mystical Body and of God Himself in the fullness of its intensity and intimacy. This, it would seem, is the inner meaning of our community life. If we are not sufficiently conscious of this inner meaning, the reason may be that we are in the habit of viewing community life 141 BERNARD 1. MULLAHY Revietv {or Religious too much as a purely disciplinary thing, as something which rigor-ously rules out all singularity; every tendency to withdraw from community recreation and other community functions, every infrac-tion of the common life which might offend poverty in any way: we do not view it in the whole context of the Christian life, nor do we trace it back to its doctrinal and sacramental sources. There are three principal aspect~ of the Christian life: doctrine, worship, and moral action; or, in other words, the three C's: creed, cult, and code. In the spirituality characteristic of our times, there has been a tendency to stress code and moral action in isolation from creed and cult, from doctrine and worship. When this is done the Christian life and the religious life are viewed primarily in terms of asceticism, in terms of spiritual practices which are seen less as acts of divine worship than as exercises to perfect the soul. There is a concentration on sanctifying the will by a pattern of ascetical rules without at the same time illumining and enriching the mind with the doctrinal wellsprings of the Christian life. This tends to make the Christian life a kind of ethical and legalistic thing. Perhaps we have been in the habit of thinking of community life too much from this point of view. Perhaps we have seen it too much in terms of code, and not enough in terms of creed and cult; and it might be helpful for us to try to situate it in its proper context of doctrine and worship. To try to get at the doctrinal source of community life is to ask the question, Where is community life lived in its fullest and most perfect form? The answer, as we have already suggested, is: the Blessed Trinity. The life of the Trinity is essentially a com-munity life. G6d not only has community life, He is community life. He is a community of three Persons whose life,consists in an eternal, mutual outpouring of light and love, an outpouring that is so intense and so utterly altruistic that it constitutes the very per-sonality of the members of the community. Here is community life in its perfection: the personality of each of the members consists in being a living relation to the other members, nothing more, nothing less. Here is the common life in its fullest dimensions: none of the members possesses-anything absolute, anything at all, by Himself alone; everything absolute is shared in common. Here, as in a re-ligious community, the common life is founded on poverty, that mysterious, infinitely rich poverty of the three divine Persons which make it impossible to possess anything absolute as belonging to them personally. 142 Mag, 1955 COMMUNITY LIFE Our religious vows meant an entrance into a community life. So also did our baptismal vows. At baptism a real participation in the infinitely altruistic, communal life of the Trinity was put into our souls; and we were caught up in the intense and intimate social intercourse of the three divine Dersons. From then on we were des-tined to live the community life of the Mystical Body of Christ. From then on our vocation was to live not an isolated or insulated or introverted life, but a life of perfect altruism. This meant that our Christian personality would have to have something of the per-sonality of the three divine Persons; we wduld have to become a living relation to others: our joys, our riches, our prayer would have to be theirs; their poverty, their sorrows, their sufferings would have to be ours. The community life of the Mystical Body is a thing of vast proportions, for it embraces the whole Communion of Saints: the Church militant and suffering and triumphant. The proportions are so vast and the states so different that it is difficult for us while in this life to realize its far-reaching implications. Even if we limit our view to the Church militant, the distances are so great, there is such a lack of immediate contact, and there are so many differences of national traits and cultures and backgrounds, so many divisive forces, that it is not easy for us to have the sense of achieving close social intercourse. The parish is, of course, the natural communal unit in the Mystical Body; but here also differences of backgrounds and occupations and many other things seem to put a limit upon the intimacy and intensity of the social relations. The family, too, has its drawbacks, such as the immaturity of the children, for ex-ample. But in the religious community all these limitations dis-appear; and perhaps we may be permitted to think that one of the principal reasons why God brought religious communities into ex-istence was to provide a state which would have the ideal condi-tions for living the communal life of the Blessed Trinity and of the Mystical Body with the fullest intensity with which it is pos-sible for man to live it here on earth. In the religious state ~ire found the most perfect conditions for reflecting the social life of God. Here everyth{ng is possessed in common, and what belongs to one belongs to all. Here the barriers, the divisive influences, and the differences in interests and o.~cupations so often found in the world disappear. All are inspired by the same common purpose; all are governed by the same religious rule; all are formed in the same spiritual life and .participate in the same spir~ BERNARD I. MULLAHY itual exercises. Here we should expect to find the fullest achievement of social life, the highest form of altruism, the most perfect self-lessness, the least degree' of spiritual introversion. Nowhere should social consciousness be more delicate and strong, more sensitive and refined. Here, as in the community life which is God, there should be a constant outpouring of light and love upon others; and, like a reflection of the members of that divine community, each religious should' be a kind of living relation to all the others. In a word, since the Christian life is essentially a social life and since the purpose of the religious state is to bring the Christian life to its full devel-opment, we should expect to find nowhere more than in a religious community the perfect answer to the prayer of Christ after the Last Supper: "That they all may be one even as thou, Father, in me and Iin thee; that they also may be one in us. I in them and thou in me; that they may be perfected in unity." That this ideal is not always fully realized hardly needs to be mentioned. Everyone knows that, even in the extremely favor-able conditions for social life provided by the religious state, social .maladjustments and social tensions can and do exist, that not in-frequently individualism and spiritual introversion are developed to a high degree. There are undoubtedly a good many reasons for this. But may not one of the principal reasons be, as we have already sug-gested, the tendency to stress the code of the religious state in iso-lation from the whole context of the Christian life? When the religious life is viewed principally in terms of asceticism and dis-ciplinary regulations, when more insistence is placed upon the moral virtues than upon the theological virtues, when the various practices which go to make up the spiritual program are viewed more as exer-cises of the spiritual athlete than as acts 0f divine worship, and when there is more insistence upon self-perfection than upon charity as the goal of the spiritual life, it is hardly to be wondered at if some religious succumb to the temptation to turn in upon themselves and to become spiritually introverted. And, when the official prayer life of the Church suffers at the hands of spiritual individualism and private devotions, when the liturgical life is not lived fully by the religious, and when his community life does not find i~s full and natural expression in the communal worship of the Mystical Body, it seems inevitable that the social implications of this community life will not be brought to fulfillment. Since the Christian life is essentially a social life, it is only natural that the official prayer lif~ of the Christian, the liturgy, 144 May, 1955 COMMUNITY LIFE should be essentially a social worship. And, if the purpose of the religious life is to. bring the Christian life to its ~perfection, are we not entitled to expect that, while each religious society will natur-ally want to insist on its own proper spirituality and spirit, the official social worship of the Church will also be brought to ful-fillment in it? May we not be permitted to suspect that one of the purposes God had in mind in raising up religious communities was to bring about the best conditions for communal worship? It seems incongruous and inconsistent to insist on community life without insisting on communal worship. Yet there are religious congregations which make much of community life in all its minute disciplinary details all the way. along the line (and not infrequently in an all too univocal way which confuses unity and uniformity) until it is a question of worship, and then individualism and sub-jectivism take over, at least to a large extent. We even find paradoxical situations in which private prayer is made public and public prayer private. Nothing could be more. personal and intimate than mental prayer. Yet it is not uncommon to find it turned into a kind of public exercise, with the same subject for meditation read out for the entire community the evening before, and all the same points read out in public during the meditation period the next morning. On the other hand, the greatest public act of worship, the Holy Sacrifice of the Mass, is often treated like a private devotion. It seems, therefore, that the community life of religious needs a rich doctrinal source in the dogma of the Church and a rich sacra-mental source in the liturgy of the Church. And, of course, the sun and center of the whole sacramental background of corhmunity life is the Eucharist. The Blessed Sacrament is the basic foundation for the common life because, as St. Thomas Aquinas points out, it contains substantially the common good of the whole Church. The community, life of a religious congregation will depend in lar, ge measure upon the way in which the Mass is understood and loved by the religious and upon the way it is participated in by the com-munity. In a very particular way, community life will depend upon the attitude of the religious towards Communion. In modern times there has been a very paradoxical attitude among Catholics. Some, re-alizing that Communion is not necessary to fulfill the obligation of hearing Mass on Sunday have come to look upon it as a purely external addition to the Mass. Others have made it the focal point 145 BERNARD I. MULLAHY Re~ieu] ~:or Religious of the whole Mass, as though the Mass were a Communion service rather than a Sacrifice. This latter attitude is the more common among religious. Comr~union viewed as an intimate personal union between the individual soul and Christ is made the center of at-tention; and, with the notion ~of sacrifice pushed far into the back-ground, the part of the Mass which precedes Communion is spent in a personal preparation for the reception of Christ; and the part afterwards, in a personal thanksgiving. It has not been unknown for religious communities to receive Communion regularly every morning before Mass so that the religious might spend the entire Mass in making a private act of thanksgiving. Fortunately, this sort of thing is becoming more and more rare. Communion can play its proper role in our community life only when it is viewed in its proper relation to the whole Mass, and the Mass in turn is viewed in its proper relation to the whole liturgical life of the Church. Then Communion xvill be seen as a social, sacrificial banquet in which the members of the Mystical Body corporately share in the Sacrifice and by feeding upon the Victim make of themselves one corporate sacrifice with Him. As Thomas Aquinas and other theologians have insisted, Com-munion does not mean merely a personal, private union between the individual soul and Christ: it also means a union of the mem-bers of the Mystical Body. Its proper effect is not merely something personal and individual, but something social and communal. Its purpose is not simply to give spiritual nourishment to tl~e individual soul, but to strengthen and intensify and revivify the manifold social bonds by which the members of the Mystical Body are made .one in Christ. Communion is directly related to the Christian community as a community. And for the religious, Communion is directly related to living the community life. If, as day follows day, the Communion of the religious is not gradually bringing about greater and more .sensitive social consciousness, a fuller and more perfect participation in community life, a stronger and more delicate exercise of fraternal charity, a more mature forbearance of the faults and failings of others, a greater capacity to cope with the misunder-standings and tensions which tend to creep into even the best com-munities, and a more generous acceptance of the many trying crosses which the common life always involves, something is wrong. Dhily Communion sometimes goes on for years withotit mu~b evidence of that growth in sanctity which would normally be ex-pected from° such frequent and intimate:contact with the source 146 ,~la~, 1955 COMMUNITY LIFE of all sanctity. As we have suggested elsewhere,1 one of the chief reasons for this phenomenon might very well be a lack of proper appreciation of the direct and essential relation between Com-munion and community. Because of this relation, any failure to live community life in its fullness will be an obstacle" to the full effects of Communion in our lives. It is not uncommon to find members of communities who by certain standards are considered excellent religious, and yet who seem never to have realized the social implications of their religious vocation. They are faithful to their rule, but in a very legalistic way. They are meticulous about every disciplinary detail; they are generous and sometimes even heroic in the practice of asceticism; and they are obedient enough when any of the obligations of com-munity life are pointed out to them; yet, intent upon their own spiritual life, the goal of which they conceive to be their own personal perfection rather than charity, they live a very individu~l-istic and insulated life. They never seem to enter fully into com-munity life nor to have any spontaneous contribution to make to it. They are socially cold and unimaginative. Just as demanding With others as they are with themselves, they find it difficult to under-stand and to sympathize with certain weaknesses of their fellow religious. Their fraternal charity is a kind of practised, artificial thing, lacking in warmth and mellowness. They are without social sensitivity and find it hard to enter into the feelings of others, to anticipate their wants. They are not thoughtful: and, when others are in need of help or there is some kind of community project to be taken in hand, they are usually busy with other things. All this may very well be due, at least in large measure, to a failure to understand and appreciate the doctrinal and liturgical background of community life in general, and to a wrong attitude towards Holy Communion in particular. These religious have never been made to understand clearly the social implications of Communion and have habitually viewed it only as a personal experience, an exquisitely close and intimate contact between Christ and their soul. Communion is thus but a part of their whole spirit-ually introverted program. It was the social virtue of fraternal charity that Christ gave as the distinguishing mark of the Christian. And, if the purpose of the. religious life is to bring the Christian to his full stature, in plenitudinern Christi, this social virtue should surely shine forth 1 Cf. "The Common Good," Worship, XXVII, No. 7, 345. 147 BERNARD I. MULLAHY Review ~o~ Religious in religious in all its splendor. This is the whole meaning and pur-pose of their community life. .In a sense, community life makes fraternal charity more difficult.because close living together seems to accentuate the many faults and failings of human nature which are often so hard to put up with; but at the same time it provides the most perfect conditions for living fraternal charity in its fullest dimensions. Religious are often anxious, especially at the time of retreats, to find some norm whereby they may assess their spiritual growth. The measurement of spiritual progress is a very complex and an easily deceptive thing, and it is difficult to find a reliable norm to go by. But insofar as there is any reliable standard at all, it is surely the social virtue of fraternal charity. "By this will all men know that you are my disciples." And it is principally in terms of their social life that religious will be judged at the end. "In the eventide of life," says 3ohn of the Cross, ."they will examine thee in love"; and he is merely paraphrasing Christ's own description of the last judgment in which everything is made to depend upon social life: "I was hungry and you gave me to eat." Rooting the idea of community in its proper doctrinal and liturgical sources will help to avoid some of the misconceptions and excesses which not infrequently accompany the common life. One of the most ordinary of these is the confusion between unity and uniformity. The common life is viewed all too often in a perfectly univocal way and any lack of uniformity even in the smallest de-tails is considered a breach of unit~. There results a kind of lock-step existence; short shrift is made of personal initiative and re-sourcefulness, "and the religious "with ideas" becomes suspect. Even in minutiae the religio~s are expected to do only what their elders have done and are doing, and woe to the one who suggests that there might be a better way. Regulations multiply and accumulate in an attempt to organize the life of the religious down to the slight-est detail. Customs which .once made sense because of special cir-cumstances of time or place but which have long since lost their significance and propriety are held 'as sacred and inviolable. The accumulated weight of regulations and customs crushes and stifles' "the liberty of the children of God" which the religious came to the community to find. Community life becomes top-heavy: all initiative comes from the top; local superiors must get directives from higher superiors even in relatively trivial matters; and within the local house all new ideas, if they are to have any value, must orig- 148 Magl, 1955 COMMUNITY LIFE inate with the superior. Such a program is well calculated to pro-duce a standard product, a religious whose.chief characteristics are neutrality, passivity, and automatism. This description is undoubtedly sbmething of a caricature, but does it not point up a real problem? And is not the only adequate solution that broad and, beautiful vision of the corporateness of. the Mystical Body and of the liturgical life of the Church? Here is the closest and most intimate unity, but at the .same time the greatest variety and flexibility. Here is a structure that is not me-chanical and rigid, but organic and supple. Another difficulty in connection with community life is that it often tends to cut the religious off from participation in a broader communal life and thus, paradoxically, to create a kind of com-munity individualism. To what extent non-cloistered religious can and sbould participate in'the communal Christian life of the parish in which they are stationed is a. question that is too complex and too delicate to be treated here; but it is a question which sbotild be faced. For the most part, the community life of the religious cuts them off and isolates them from corporate parochial life, and perhaps it would not be im13ossible.to find ways and means of enabling them .to partidpate, to some extent at least, in the com-munal worship of the parish, which is, after all, the natural social unit of the Mystical Body. The paradox of community" individualism is also found fre-quently in an exaggerated esprit de corps which develops a kind of sectarian spirit among religious. It is perfectly in order for a re-ligious to be proud of the traditions and the accomplishments of his own congregation and to prefer its characteristic life and spirit to that of any other community. All that is part and parcel of his vocation to that particular sodiety. And there is such a thing as a holy rivalry between communities. But it is also possible for a com-munity spirit to become excessive, to canonize too easily the tra-ditions and methods proper to the congregation, to develop a false pride which in many subtle and implicit ways looks down upon other communities and which closeq the congregation in upon itself and makes it impervious to good influences which might come to it from others. Here, as elsewhere the only remedy is that total view of the communal life of the Church found in its doctrine and its .liturgy. St. Augustine's dream of the reign of Christ's love upon earth which prompted him to say, "And there will be one Christ loving 149 c. A HERBST Review For Religious Himself," should find its fullest realization in the community life of religious. Christ is living in each religious; and, when the com-munity is bound together in fraternal charity, there is but one Christ loving Himself. No one can sing the hymn "Ubf Caritas'" with greater truth and meaning than the religious. "Congregat2it nos in unum Christi amor.--It is the love oL-Christ that has brought us together and made us one." The. Third Mode of blumili :y C. A. Herbst, S.3. EACH master of the spiritual life has certain ideals whic.h are distinctive and which he considers of the utmost importance ~n his plan for achievirig perfection. For St. Ignatius of Loyola, the Third Mode of Humility is one of these. He thus pre-sents it in the Spiritual Exercises: "The third is most perfect hu-mility; namely, when--including the first and second, and the praise and glory of the Divine Majesty being equal--in order to imitate and be more actually like Christ our Lord, I want and choose poverty with Christ poor rather than riches, opprobrium with Christ replete with it rather than honors; and to desire to be rated, as worthless and a fool for Christ, Who first was held as such, rather than wise or prudent in this world." In order right in the beginning to get a better understanding of this, it will be well to present a fuller expression he gives in another place. "They must diligently observe, esteeming it of great import-ance and of the highest moment in the sight of our Creator and Lord, how much it helps and contributes to progress in spiritual life, to abhor wholly and not in part what the world loves and embraces, and to accept and desire with their whole strength what-soever Christ our Lord loved and embraced. For as worldly men, who follow the things of the world, love and with great diligence seek honors, reputation and the credit of a great name upon earth, as the world teaches them, so those who are advancing in spirit and seriously follo'w 'Christ our Lord, love and earnestly desire things which are altogether the contrary; that is, to be clothed with the same garment and with the livery of their Lord for His love and reverence: insomuch that if it could be without offence of the 150 Ma~l, 1955 THE THIRD MODE OF HUMILITY divine Majesty and without sin on the part of their neighbor, they would wish to suffer reproaches, slanders and injuries, and to be treated and accounted as fools (without at the same time giving any occasion for it), because they desire to imitate and resemble in some sort their Creator and Lord Jesus Christ, and to be clothed with His garments and livery; since He clothed Himself with the same for our greater spiritual good, and gave us an example, that in all things, as far as by the assistance of God's grace we can, we may seek to imitate and follow Him, seeing He is the true way that leads men to life." (Examen Generale, IV, 4.) We should know what the other two modes .of humility are in order to understand the third. I have the first when I so subject myself to God that I am ready to give up everything, even life it-self, rather than commit a mortal sin. I have the second when I so subject myself to God that I am indifferent to created things and am ready to give up everything, even life itself, rather than commit a venial sin. Subjection to God is the note common to the three; but the third is so different from the other two that there is a dis-tinction not of degree only, but of kind. The idea behind the third mode of humility is perfect imitation of Christ "Who, having joy set before him, endured the cross, de-spising the shame" (Heb. 12:2). We want to imitate Christ per-fectly. We want what He had, even, especially, the hard things. The early Christians ambitioned, and often attained, actual perse- ¯ cution and death. But, when peace came to the Church in the Ro-man Empire after 312 A. D., they could no longer look forvOard to martyrdom. What were the.y now to ambition as the apex of their spiritual ascent? Thence stemmed the doctrine of bloodless martyrdom in asceticism and the religious life. From this stream of spiritual development, the author of the Spiritual Exercises drew his ideal of self-renouncement for Christ. The driving force in fervent souls is to "get to Christ." We have a splendid example of this in St. Ignatius, martyr and apos-tolic father. His motto was: "My Love is crucified." When on his way to martyrdom he wrote: "I am now beginning to be a disciple; may nothing visible or invisible prevent me from reaching Jesus Christ. Fire and cross and battling with wild beasts, their clawing and tearing, the breaking of bones and mangling of mem-bers, the g~ind!ng of my whole body, the wicked torments of the devil--let 'them all assail me, so long as I get to Jesus Christ." (Ad Romanos~ 5; Father Walsh's translation.) "Ignatius of Loy- 151 C.A HERBST Review for Religious ola sensed, so to speak, his spiritual affinity with this man of the early Church when, in honor of this Saint, he changed his name from Inigo to Ignatius and in one of his letters styled him 'that glorious Saint for whom I have in Our Lord, or wish to have, a very special reverential devotion.' " (Rahner, The Spirituality of St. Ignatius Loyola, 59-60.) We might be inclined to think the third mode of humility as beyond our reach, as heroic. Is it heroic? Perhaps. Surely not in the sense explained by Pope Benedict XIV in his great work on the canonization of saints. But it may be heroic in a general and popularly accepted sense of the word. One who gives his life in a cause is commonly considered to be h~roic. A soldier must be ready tO die for his country. This is expected of every soldier. Yet, if he actually die, he is considered a hero. Sainted martyrs gave their lives rather than offer incense to false gods. In that they did only what they were obliged to do; yet they are considered God's heroes, heroic. At confirmation the bishop gives every Chris-tian a slight blow on the cheek to remind him that he must be ready to suffer anything, even death, for the sake of Christ. This sounds as though it is asking for heroism which, however, is pre-sumably within the reach of all. In the same way the heroism of the third mode of humility might reasonably be expected of those who are professionally travelling the high road of perfection. It almost looks as though a religious in making his profession has deliberately chosen as his way of life the third mode of humility. When he says, "I vow poverty," he says, "I want and choose pov-erty with Christ poor rather than riches." By taking a vow of chastity, he may be calling upon himself the disapproval of "worldly men, who follow the things of the world." By the vow of obedi-enc~ be is laying aside his own will by vcbicb be might push on to wealth, honor, and power. By pronouncing his vows, a re-ligious. has professionally taken on that foolishness of God which is wiser than men and that weakness of God which is stronger than men (I Cot. 1:25). He has/aid himself open "to be rated as worth-less and a fool for Christ, Who first was held as such, rather than wise or prudent in this world." ~The third mode of humility is a habit of mind, an habitual disposition of heart. A" striking act of self-abnegation now and then or even a spurt of fervor occasionally is not sufficient. It must become a way of life with us, a place in which we live. Father Considine puts it well in "A Question as to Ideals" when he says: 152 Mav, 1955 THE THIRD MODE OF HUMILITY "Within this region the Saints . . . have occupied sumptuous man-sions, in central and commanding positions, whereas the modest dwelling of any one of us may be no better than a poor cottage on the outskirts. But, poor as this dwelling may be, it must be within the border." (Woodstock Letters, 1908, 363.) Even of our miserable little hut on this high plateau we might say: "Better is one day in thy courts above thousands. I have chosen to be an abject in the house of my God, rather than to dwell in the taber-nacles of sinners" (Ps. 83:11). How I can come to live there is what should be of great con-cern to me. There is close approach to, or passive practice of, the third mode, if we make "acts of sincere th.ankfulness, as often as any little share of the cross falls to our portion. Even supposing that, on one occasion.or another, we have brought some humiliation on ourselves by our own imprudence, we may, while most heartily regretting the fault or error of judgment, no less heartily thank God that we have at least some opportunity of making up for the fault or error, through the patient endurance of discomfort or even (it may be) the contempt which it has brought on us." (Woodstock Letters, 1908, 372.) We need not search far to find ample matter for living this life with Christ, "despising the shame." "The life of a religious is full of occasions in which he is blamed, or forgotten, or scorned, or ridiculed, or humiliated . We must expect little humiliations that fall upon us at any time and in any place--in the form of failure, lack of consideration, disapproval and small acts of ingrati-tude; we must suffer the offense of angry words, words that hurt, words of ridicule; we must bear outright and thinly veiled refusals; our cross may consist in lack of approval, lack of sympathy, scorn or contempt expressed by a look, a gesture, an attitude, or in being left alone while another is made much of; we may be faced with open or hidden criticism which we surmise or discover by accident ¯ . . our meager talent, our character, our health, our appearance." (Vermeerscb, Miles Christi Jesu, 151, 154.) Thomas ~ Kempis says: "What pleaseth others shall prosper, what is pleasing to thee shall not succeed. What others say shall be harkened to; what thou sayest shall be reckoned as nought. Others shall ask and shall re-ceive; thou shalt ask, and not obtain, Others shall be great in the esteem of men; about thee nothing shall be said. To others this or that shall be committed, but thou shalt be accounted as of no use." (Imitation, III, 49, 4-5.) 153 C. A HERBST Reuiev3 for Religious I offer myself to our Lord for all these things. This m~y be .a general offering of futurables but they may be actuated at any mo-ment. Perhaps I am living with some of them right now. At any rate this offering shows a habitual disposition consonant with the third mode of humility, and there lies hidden in it not a little faith and love. When I am passed over or slighted or snubbed, I hope I may be able to bear it at least patiently. I make a great advance when I come to accept such things willingly and even with love for the love of Him who "loved me and delivered himself for me." Wl'ien I come to accept them with joy and even enthusiasm, glad that the Father has placed me with His Son, I 'have travelled far. This offering of myself for humbling things and the patient, loving, joyous acceptance of them should lead me to have the wish to have the desire for humiliations. "For though I burn not with so great desire as Thy specially devout servants, yet, by Why grace, I have a desire of this same greatly inflamed desire, praying and wishing that I may be made partaker with all such fervent lovers, and be numbered in their holy company." (Imitation, IV, 14, 3.) From the desire of the desire we ought, by God's grace, soon to pass on to "desire to be made little of, neglected, passed over, have little influence, even be regarded as suspect, be criticised, reproved, ridi-culed. We ought to have no desire for first place, for the higher offices . . . association with the more wealthy, the more aristocratic, or the leading men, no desire for the larger cities." (Coemans-Germ-ing, Commentartj, n. 251.) This, in a small way, is "to desire to be rated as worthless and a fool for Christ, Who first was held as such, rather than wise or prudent in this world." No motive but love is strong enough to carry one through to the attainment of so high an ideal. Without love even martyrdom of blood is to no purpose. "And if I should distribute all my goods to feed the poor, and if I should deliver my body to be burned, and have not charity, it profit~th me nothing" (I Cor. 13:3). It is the same with bloodless martyrdom. And it must be a love of imitation and companionship. "With Me," Christ the King invites. "With Christ I am nailed to the Cross" (Gal. 2:19). "In what place soever thou shalt be, my lord, O king, either in death, or in life, there will thy servant be" (II Kings 15:21). Love always finds a way. I surpass desire when I am on the watch for opportunities and actually seek out occasions for practicing the third mode of hu-mility. There are always the humbler tasks to which no one pays 154 Ma~!, 1955 MARY AND JOSEPH FIND ,JESUS' any attention and to which are attached no praise or glory. Others will gladly let me have them. I can deliberately pass by positi6ns of influence and authority. I can accuse myself of my faults in a loud and clear voice. It may be more humbling dutifully to tell another his faults than to be told my own. The dependence ~ind humility implied in ~sking a permission, especially when I may be refused, is precious. It is sometimes all right deliberately to fail to show off my superior knowledge or ability. Letting others have the nicer place or things and allowing them to pass ahead of me is Christlike, too. In confession I can mention circumstances and motives connected with my faults that will be very humiliating. And so on. Love will find many other ways. This is the positive, aggressive, strong, earnest, eager, enthusiastic way "to be clothed with His garments and livery." Mary and ,Joseph Find ,Jesus Paul Dent, S.d. EVEN Mary and Joseph cannot find You when You choose to be hidden from them. But You mercifully choose to let them find You, too, lest I despair of ever seeing You face to face, 0 Jesus. Mary leaves Joseph for the women's court, thinking prayerfully, "Quam dilecta tabernacula tua, Domine. Concupiscit et del~cit anima roea in atriis tuis.'" A mother passes by, followed by her boy. How like Jesus he is! Mary looks around at her side to compare the two, and He is not there! Disappointed, she thinks immediately, "He must have stayed with Joseph this time. How fortunate Joseph is to have Jesus with him! How unworthy I am to have Jesus with me! With all my heart I want Jesus with me, but still I do not want Joseph to be without Him. I shall be patient and spend the day in loving hope of seeing Jesus at the end." Thus the day passes in loving hope, and it ends in disappointment. For Jesus is not with Joseph either, and now they both bare lost Him--neither of whom had ever lost Him before! But Mary loses no time in self-pity, much less in blaming Joseph. For quite simply Joseph would not be careless about Jesus. Mary realizes at once she is confronted with a deliberate act of God, a 155 PAUL DENT mystery she does not now understand but which God will make dear to her when He wills. Meanwhile they must go immediately to look for Jesus, calmly, hopefully, not frantically. They must go prayerfully, too. God guide their footsteps. Then there come three days, and perhaps nights, too, of looking for Jesus; and it is a search that is con[ident. For He knows of it and will reveal Himself to them when God wills. Mary and Joseph seek Jesus humbl: , too, realizing they are not worthy to find Him, much less to keep Him with them in their own home. They are persevering also in their search, for Jesus, for duty and love drive them on continuously. Duty obliges the world's best parents to give the world's best care to the world's best Child. The love driv-ing them on is that of creation's greatest lover--Mary Immaculate! --and that of her all but equal--glorious St. Joseph !--for Jesus Christ Himself, beloved Son of God. "'Nec lingua valet dicere, nec littera exprimere, expertus potest credere quid sit desum diligere." Or, as convert Father Caswall worded it, "Nor tongue nor pen can show the love of Jesus. What it is, none but His loved ones know." So Mary and Joseph, who have experienced more than others what it is to love Jesus, seek Him lovingly, so lovingly that all they think, choose, say, do, or suffer is just one thing--seeking Jesus lost. If all I think, choose, say, do, or suffer is just one thing, the one thing necessary--a seeking of Jesus lost or of Jesus never even heard of amid the dust and turmoil of the incalculable billions of thoughts, choices, words, actions, and sufferings of the innumerable billions of human beings of the past, present, and future--then truly I am in the company of Mary and Joseph; truly we three are seeking Jesus, and truly not only we three, but very many others whom we help, will find Jesus foreveL Then we shall all sing forever with new understanding and inexpressible joy "'quid sit desum diligece--what it be to love Jesus!" And those other words of this great and tender hymn of the Ages of Faith, this "'desu Dulcis Memoria," will resound forever as our arisen and immortal voices sing sweeter than earth's loveliest ~ing-ing, "Quocumque loco fuero JESUM MECUM DESIDERO! Quam laetus cure int;enero! QUAM FELIX CUM TENUERO~.--In whatsoever place I be, Jesus, I want You there with me. When You I find, how happy I! How blessed when I have You by!" 156 THE APOSTOLATE OF CHASTITY. By Ferdinand Valentine, .O.P. P ). 245. The Newman Press,.Westm~nster, Maryland, 1954. $3.25. ; The vow of chastity is a subject which comes in for much dis-cussion in modern ascetical literature. This interest may be con-trasted with an attitude which prevailed in days gone by that the vow of chastity needed no explanation. The need for an explana-tion of the vow of chastity may differ from age to age and place to place; but there is no doubt, I believe, that religious may profit from a thorough and competent treatment of chastity such as Father Valentine offers. The A)ostolat'e of Chastit~l is both broader and narrower in scope than its ~itle would indicate. It is narrower in that it treats only of the apostolate of religious women. It is broader in its con-cern with other aspects of this vocation. The first chapter, for in-stance, deals with the problem of prcJmoting vocations. Superiors will find some very prudent suggestions concerning the pr.oper at-titude to be taken .toward vocations. The second chapter then deals with some problems of psychological fitness. The rest of the first section goes on to discuss the problerfi of religious adaptation tO modern times. The author dbes not take .up the problem 'of chastity proper until the beginning of the second s.ection of the book. He intro-duces this section with a catechetical treatment of the vow and" virtue of chastity,; and then goes on to what appear~ .tO be the heart of the book--a treatment of the apostolic aspqct. "9.f .chastity. The theme of this section ,would seem to be' that 't.,h~ ~orfian will find in virginal chastity "not an asceticism which rFstrains and represses her natural gifts as woman and mother, but rat~er'.their spiritual elevation and fulfillment . " This is certainly a healthy and a positiye attitu,d,e toward chas-tity, and one which it would be well for religious .women to .under-stand clearly. But there is a tendency among.modi~rn authors to justify virginity by try!.ng to make it look as much like ma~rri.age as possible. There is certainly room for analogy" between perpetual chastity and marital chastity, but there is also a danger to be re.ck-oned with. perpetual chastity, from whatever angle you .yiew it, 157 BOOK REVIEWS Review for Religious involves the renunciation of marriage and haarital privileges. There is a certain negative.aspect of religious chastity, then, which cannot be overlooked, and which it would be foolhardy to ignore. There are forces for which the religious life offers no outlet whether direct or by ways of so-called sublimation. Herein lies the sacrifice of the religious. So, while one must condemn the morbid fear of sex and sin which cripples the apostolate of some religious, one must leave room for a healthy fear. This fear will be based on a clear under-standing of the religious renunciation and the difficulty of controll-ing the forces thus held in check. Such fear, far from doing damage, will protect religious chastity and set a safe limit to the love that may be practised in religion. I believe that the author was aware of all this, but it may be that he thought it beyond the scope of his work to stress it. But religious women will find the book inspiring and stimulating, though at times difficult .reading.-~JOHN R.CONNERY, S.J. FATIMA IN THE LIGHT OF HISTORY. By Costa Brochado. Translated and edited by George Boehrer. Pp. 231. The Bruce Publishing Com-pany, Milwaukee, 1954. $4.50. With rare common sense the author of this latest book on the apparitions of Our Lady at Fatima has limited himself to historical analysis, and left supernatural elements to the competence of trained theologians. The translation is lucid and forceful and makes intensely interesting the somewhat tedious chronicle of Portugese history. With inspiring results, the unconquerable Catholic heritage of the country is traced th, rough centuries of political and religious up-heaval. The tragic, yet factual and objective, narration of the havoc initiated by the Marquis of Pombal, and forwarded by the anti-religious iddals of Masonry, reveals a tremendous need for the spir-itual revitalization of Portugal which providentially succeeded the apparitions of Our Lady of the Rosary. Pombal, Mr. Brochado as-serts, was ultimately responsible for shatteiing the religious unity of the country. By such planned offensives as the banishment of the Sbciety of Jesus, severance of relations with the Holy Se~, and open-ing the country to the destructive forces of Protestantism and Latin Masonry, Pombal made it possible for the Triangle to supplant the Cross in Portugal. Assaults on Churches, exile of prelates, state control of religion, secularization of schools, profanations, robber-ies, arson, murder--this is the pitiful picture of the country as it agonized and labored to preserve its Faith against the .enemies of 158 Mag, 1955 BOOK REVIEWS God and all things Catholic. And yet, the influence of the Blessed Virgin was never absent. Two centuries before the definition of the dogma, Portugal had consecrated herself to the Immaculate Conception and had taken a solemn oath to defend and propagate belief in Mary's perpetual sinlessness. Furthermore, the rosary had been for centuries the lead-ing Marian devotion of the portugese people, culminating in a ver-itable "crusade of the Rosary". in the midst of,frightful persecutions immediately preceding the apparitions of 1917. Portugal had not abandoned her patroness in the hour of trial, and our Lady did not forget her heroic fidelity. Since the events of Fatima, the Church's enemies have suffered great defeats in Portugal. The rapid revival of faith and hope in the hearts of the Portugese people is perhaps the surest sign that the Virgin has again triumphed by crushing the head of the serpent. .The reader of this book may feel, however, that Mr. Brochado has taken too local a view of the significance of Fatima. Despite his purpose, as stated in tbe translator's preface, " to "place those events [the apparitions] in their historical setting and to consider their efl:ects on subsequent bistor~l,'" (italics mine) Mr. Brochado barely hints at any world implications. He deliberately avoids all reference to subsequent developments, such as the state-ments of Lucia which involve our Lady's desire for devotion to her Immaculate Heart, the First Saturdays, the conversion of Rus-sia, or the vision of hell with its threat to sinners the world over. Are these developments sufficiently historical to merit mention? The question is admittedly disputed. But inthis reviewer's opinion, the Holy Father's consecration of the world to the Immaculate Heart in 1942 and of Russia in 1952 has far-reaching repercussions, at least implicitly connected with the events of Fatima, which should not be ignored. It is noteworthy that Manoel Cardozo, in his pref-ace to Mr. Brochado's book, also seems to have sensed this lack of perspective: "Fortunately for us, Our Lady did not appear for the exclusive benefit of the Portugese (though they were favored above all others)."--VINCENT J. FORDE, S.J. SO SHORT A DAY. By Sisfer M. Eulalia Teresa, S.N.J.M. Pp. 281. Mc- Mullen Books, Inc., New York, 1954. $3.00. This book is the story of Mother Marie-Rose, the foundress of the Congregation of the Sisters of the Holy Names of Jesus and Mary. Into the texture of this biography is woven the. inseparable 159 BOOK ANNOUNCEMENTS Reuiew for Religious story of the beginnings of the congregation of Mother Marie-Rose and-i~s first.establishment at Longueuil, Quebec. It has been said that the most objective history, and consequently the best, is written by an author who is indifferent to his subject. Obviously, Sister M. Eulalia Teresa is not indifferent to the.subject of her book. (we would be disappointed if she were) ; and it is al-most as obvious that in places she lets her heart supply for his-" torical documentation. This, it seems, is the chief temptation of hagiographers. It must be said, however, that an indifferent author could not have caught the spirit of this foundress, could not have made it come alive as the author does. If the picture is overpainted in places, it is withal a vivid and inspiring picture. If ~he book is slow to take the reader's interest, it could well be due to the character portrayal and absence of conflict in the firs~ sections. The characters, are almost all painted in the same bright superlatives, and the st6ry lags for want of that conflict, internal or external, from which great souls emerge. Patience on the reader's part in waiting for character portrayal of deeper colors and better perspective is well rewarded. There is a new and welcome candor in the descriptions of the young pioneer sisters whom God called to the congregation of Mother Marie-Ros~ in its early days. Neither can it be said that the second part of the book is v~ithout conflict and the impact of drama:" The trials and persecutions to which the nascent coflgregation was subjected and the vibrant faith by which they were met are the heart of a ver~ real drama. So Short a Day makes this drama, enacted over a hundred years. ago, come back to life. The accomplishment of making history live again, of capturirig the pioneer spirit of this congregation and its saintly foundress is to be highly praised. Mother Marie-Rose died on her thirty-eighth, birthday, only six years after her congregation had been born. To:day her spirit. lives on in the 3,725 professed religious of her congregation and the 252 schools which her sisters direct. So short~ a day, so great a legacy.--JOHN POWELL, S.J. BOOK ANNOUNCEMENTS BEAUCHESNE ET SES FILS, 117 Rue de Rennes, Paris. Initiation a. l'Oraison. Par Piere Brunet. His long experience BOOK ANNOUNCEMENTS as ' professor at ,the seminary at Nancy has convince~l the author that most books on prayer do not meet the particular .problems,of seminarians fihd the secular clergy since they are written by and for religious. This book embodies his efforts to remedy that situation. Secular priests should find the book particularly helpful since it is written by one who knows their needs and problems. Pp. 326. THE BRUCE PUBLISHING COMPANY, Milwaukee 1, Wisconsin. The Catholic Church and You. By William 3. Grace, S.d. 7Fhe Inquiry Forum at the 3esuit Church in Milwauk'ee, begun in 1945, has attained something of an international reputation for the large mea

Issue 41.3 of the Review for Religious, May/June 1982. ; REVIEW FOR REI.IGIOUS (ISSN 0034-639X), published every two months, is edited in collaboration with the faculty members of the Department of Theological Studies of St. Louis University. The editorial offices are located at Room 428; 3601 Lindell Blvd.: St. Louis, MO 63108. REVIEW FOR REI.IGIOUS is owned by the Missouri Province Educational Institute of the Society of Jesus, St. Louis, MO. © 1982 by REVIEW FOR RELIGIOUS. Composed, printed and manufactured in U.S.A. Second class postage paid at St. Louis, MO. Single copies: $2.50. Subscription U.S.A.: $9.00 a year; $17.00 ~'or two years. Other countries: $10.00 a year; $19.00 for two years. For subscription orders or change of address, write: REVIEW FOR RELIGIOUS; P.O. Box 6070; Duluth, MN 55806. Daniel F. X. Meenan, S.J. Dolores Greeley, R.S.M. Daniel T. Costello, S.J. Joseph F. Gallen, S.J. Jean Read Editor Associate Editor Book Editor Questions and Answers Editor Assistant Editor May/June, 1982 Volume 41 Number 3 Manuscripts, books for review and correspondence with the editor should be sent to REVIEW FOR RELIGIOUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. Questions for answering should be sent to Joseph ~. Gallen, S.J.; Jesuit Community; St. Joseph's University; City Avenue at 54th St.; Philadelphia, PA 19131. Back issues and reprints should be ordered from RE~:IEW FOR RELIGIOUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. "Out of print" issues and articles not published as reprints are available from University Microfilms International; 300 N. Zeeb Rd.; Ann Arbor, MI 48106. Laborem Exercens: Themes and Theses Robert F. Morneau Bishop Morneau has commented in this s~me format on two earlier encyclicals: Redemptor Hominis (March, 1980) and Dives in Misericordia (September, 1981). Together with his service as Auxiliary Bishop of Green Bay, Bishop Morneau also serves through the Ministry to Priests Program where he may be addressed: 1016 N. Broadway: De Pere, Wl 54115. Several years ago Studs Terkel published a series of masterfully conducted interviews under the title of Working. People from various fields of life reflected candidly on the meaning or lack of meaning that work had in their lives. What fascinates the reader is the blatant honesty of'those interviewed; they told it the way they experienced it. With deep feeling and perceptive observation, the work-ing people revealed the movement~ of their mind and heart. On September 14, 1981, Pope John Paul II shared his third encyclical letter, Laborem Exercens, with the world. This papal document focuses on the topic of work, that human activity at once so universally experienced and yet so frequently devoid of meaning. What Terkel did on the experiential level, the Holy Father does on the reflective level. We do not find personal interviews with the rank and file but, from a scriptural and faith point of view, a description of the theological underpinning of our obligation to work. Within this perspective he discusses many questions: the nature and meaning of work; the relationship of work to the person, family and society; how work is influenced by various ideologies; the duty and rights of the worker; a spirituality of work. Rather than delineate detailed and specific policies, the encyclical is concerned with articulating certain principles and guidelines to govern the formation of policy for specific situations. When these principles are adequately and properly applied, work helps to build up the world community and becomes a means of safeguarding the humanity of all. These reflections of the Holy Father are extremely relevant. In an age when technology can so easily control the course of history we must hear over and over 322/ Review for Religious, May-June, 1982 again the principle that people have primacy ox)er things. In a period of history that takes for granted exploitation and manipulation as acceptable life-styles, we must have confirmation that persons are ends and not means. In our rapidly moving century that gives low priority to quiet and reflective times, it is healthy to have our attention drawn to an awareness of the importance of rest within the spirituality of work. Written on the ninetieth anniversary of Leo XlIl's Rerum Novarum, this present encyclical continues to remind us of the importance of these social questions and the function that the Church plays in their solution in public life. Theme 1: The Meaning and Dignity of Work Thesis: Work is an active process by which creative and productive persons gain dominion over the earth and achieve fullness as human beings. Understood as a process whereby man and the human race subdue the earth, work corres-ponds to this basic biblical concept only when throughout the process man manifests himself and confirms himself as the one who "dominates" (6). Work is a good thing for man--a good thing for his humanity--because throughout work man not only transforms nature, adapting it to his own needs, but he also achieves fulfillment as a human being and indeed, in a sense, becomes ~more a human being" (9). Man must work, both because th~ Creator has commanded it and because of his humanity. which requires work in order to be maintained and developed. Man must work out of regard for others, especially his own family, but also for the society he belongs to. the country of which he is a member, since he is the heir to the work of generations and at the same time a sharer in building the future of those who will come after him in the succession of history (16). The farmer gazes out on newly acquired property and perceives the rocks, tree stumps and weeds; a year later that same farmer, after much labor, rejoices in an autumn harvest of grain. The artist sits before a small mound of clay: many hours later a finely crafted vessel receives the accolades of admiring friends. The steel worker feeds the furnace kno.wing that when the final product is completed, beams of steel will be available for buildings and bridges. The human person, taking the many resources of the world, fashions them into useful and beautiful objects in the meeting of human needs. This process, both creative and productive, brings order out of chaos. The newly won unity fills the human spirit with a sense of meaning, peace and joy. A radical call to all of us is the call to become human persons. Within that universal vocation work plays a necessary and significant part. Only when we thoughtfully expend the energy given to us do we develop our potential and actualize our gifts. Work and growth demand that we participate in this venture of becoming human. Gifts unemployed atrophy. Needs unmet cause suffering. Lack of human development means boredom and despair. Emerson knew the value of work and its effect on human growth: I hear, therefore, with joy whatever'is beginning to be said of dignity and necessity of labor to every citizen. There is virtue yet in the hoe and the spade; for learned as well as for the Laborem Exercens: Themes and Theses / 323 unlearned hands.* This labor must be balanced and rational, respecting individuals and allowing for personal fulfillment. History provides evidence that when certain forms of work do not have these qualities human beings are dehumanized and even destroyed. In his perceptive' and challenging philosophical treatise, Leisure, the Basis of Culture, the neo-Thomist Josef Pieper describes "workism" as an attitude and ideology that disregards the essential natureof work. Pieper's argument is that work is meaningful only when the human person's dignity is fully appreciated and when the activity of work is complemented by a certain receptivity towards life which is called contemplation. The present encyclical also protects this balance and perspective. Theme 2: The Subjective and Objective Dimensions of Work Thesis: The subjective dimension of work (the dignity of the human person)always has priority over the objective dimension (productivity). The very process of "subduing the earth," that is to say work. is marked in the course of history, and especially in recent centuries; by an immense development of technological means. This is an advantageous and positive phenomenon, on condition that the objective dimension of work does not gain the upper hand over the subjective dimension, depriving man of his dignity and inalienable rights or reducing them (10). ¯. man's dominion over the earth is achieved in and by means of work. There thus emerges the meaning of work in an objective sense, which finds expression in the various epochs of culture and civilization. Man dominates the earth by the very fact of domesticating animals, rearing them and obtaining from them food and clothing he needs, arid by the fact of being able to extract various natural resources from the earth and the seas (5). As a person, man is therefore the subject of work. As a person he works, he performs various actions belonging to the work process: independently of their objective content, these actions must all serve to realize his humanity, to fulfill the calling to be a person that ig'his by reason of his very humanity (6). Work always involves a person, a process and a product. The language of the encyclical refers to the person as the subject of Work (the subjective dimension) while the product is the object of work (the objective dimension). This distinction is important: a product does not have interiority, nor is it a center of thought and love. On the other hand, the human person is spiritual, immortal and called to fullness of life in God. The process of work can take such a direction so as to make a person play the role of a mere tool (cog in the machine). The focus is on productivity. Such a procedure, used in the work world dehumanizes the person and negates the Christian meaning of work. Unfortunately, hi~tory records too many years of such abuse. The Holy Father's analysis of work contains an implicit anthropology, one ~'The American Scholar," in The Selected Writings of Ralph Waldo Emerson. ed. Brooks Atkinson (New York: The Modern Library, 1940), p. 55. ~124 / Review for Religious, May-June, 1982 that has the highest regard for the fullness of human life. Every person has both an inner and outer agenda. Meister Eckhart describes it this way: There are people who squander the strength of their souls in the ouiward man. These are the people, all of whose desires and thoughts turn on transient goods, since they are unaware of the inner person. Sometimes a good man robs his outward person of all the soul's agents, in o'rder to dispatch them on some higher enterprise; so. conversely animal people rob the inner person of the soul's agents and assign them to the outward man. A man may be ever so active outwardly and still leave the inner man unmoved and passive.-~ Both the outer and inner dimensions of work need protection and a sensitive balance. Each has its own unique value. If they are not integrated, a person either "sells his soul to the company store" or falls into a type of narcissism which destroys communal responsibility. Persons have dignity which must not be denied; the work process must be respected as part of God's plan; human life is impossible without those products which meet essential needs. Proper priority and balance in reference to the subjective and objective dimen-sions of work are maintained when reverence is present amongpeople. Only when we stand in awe of every person, only when we hold sacred the gifts of air, water and land, only when we carefully consider the inner dynamism and value of the creative process will we truly appreciate work. Goethe reminds us: "The shudder of ,awe is humanity's highest faculty." This papal docume.nt contains that "shudder of awe.'" Whenever we encounter the handiwork of God, human or otherwise, we bow before the Creator's reflection. The person, the imago Dei, the creative pro-cess and end product of our work demand appropriate respect. Theme 3: The Value Scale of Work Thesis: Work involves three spheres of values: 1)a personal value bringing dignity to the individual; 2) a family value forming the foundation of communal life; and 3) a societal value enriching the common good. It (workJ is not only good in the sense that it is useful or something to enjoy; it is also good as being someth!ng worthy, that is to say, something that corresponds to man's dignity, that expresses this dignity and increases it. If one wishes to define more clearly the ethical meaning of work. it is this truth that one must particularly keep in mind Work constitutes a foundation for the formation of family life. which is a natural right and something that man is called to . In a way, work is a condition for making it possible to found a family, since the family requires the means of subsistence which man normally gains through work. Work and industriousness also influence the whole process of education in the family, for the very reason that everyone "becomes a human being" through, among other things, work. and becoming a human being is precisely the main purpose of the whole process of education (10). ¯. it (society) is also a great historical and social incarnation of the work of all generations. All of this brings it about that man combines his deepest human identity with membership of a nation, and intends his work also to increase the common good developed together with his '-Meister Eckhart, trans. Raymond B. Blakncy (Ne~' York: Harper Torchbooks). p. 87. Laborem Exercens: Themes and Theses compatriots, thus realizing that in this way work serves to add to the heritage of the whole human family, of all the people living in the world (10). The valuing process determines life. Values lead to an internal judgment which in turn dictates actions. The degree of worth we assign to individuals and things has far-reaching consequences. Within the complex va.luing system, work plays a major role since it touches personal lives, family life, and even national and international communities. The value assigned to work in these three areas will affect, for good or ill, the course of history. Family life remains a pivotal force in society, That life is threatened by an increasing number of divorces, the current mobility and the impact of the mass media. Unemployment is another threat which can lead to "social disaster" (18). Further, inadequate wages deprive the family of essential goods; lack of proper benefits increase anxiety; dissatisfaction with one's job has an impact on spouse and children. Work has a wider circle than just family life--it influences all of society. When people are given proper.job opportunities the common good is served and society is healthy. When work fosters a sense of cooperation among employees and employers, a new spirit of solidarity is felt in the wide? society. When work is done so that future generations will be served and helped by conserving our resources and protecting our, environment, society ,is being given responsible models. We have reached a point where this type of social consciousness can no longer remain merely a hope; if it does not become a fact, our society may well be doomed. Few people can grow interiorly without a sense of achievement. When work is done well, confidence and a sense of self-worth increase. Further, in fulfilling the commandment of God that we do work, we contribute to God's plan. The brick we add has eternal significance; no one else can do the work assigned to us. A prayer attributed to Cardinal Newman conveys the importance and the enigma of each person's work: ~ God has created me to do him some definite service: he has committed some work to me which he has not committed to another. I have my mission--I may never know it in this life. but I shall be told it in the next. 1 am a link in a chain, a bond of connection between persons. He has not created me for naught. I shall do good, I shall do his work. I shall be an angel of peace, a preacher of truth in my own place while not intending it--if I do but keep his commandments. Therefore 1 will trust him. Whatever. wherever I am. I can never be thrown away. If I am in sickness, my sickness may serve him: in perplexity, my perplexity may serve him: if I am in sorrow, my sorrow may serve him. He does nothing in vain. He knows what he is about. He may take away my friends. He may throw me among strangers. He may hide my future from me--still he knows what he is about. Theme 4: Work and the Mystery of Creation Thesis: Work is inextricably bound up with the mystery of God's creative activity: each person shares in the wonder of creation through work. The knowledge that by means of work man shares in the work of creation constitutes the 326 / Review for Religious, May-June, 1982 most profound motive for undertaking it in various sectors 125). In every phase of the development of his work man comes up against the leading role of the gift made by '*nature." that is. in the final analysis, by the Creator. At the beginning of man's work is the mystery of creation. This affirmation, already indicated as my starling point, is the guiding thread of this document (12). The word of God's revelation is profoundly marked by the fundamen~'al truth that man, created in the image of God, shares by his work in the activity of the Creator and that, within the limits of his own human capabilities, man in a sense continues to develop that activity, and perfects it as he advances further and further in the discovery of the resources and values contained in the whole of creation (25). Two qualities identify our humanness: depende~nce and creativity. All is gift and we have an absolut~ dependence on our Creator. Humble acceptance of these faith facts sets us free. Through the creative process order is extracted from chaos, unity is chiseled out of diversity, beauty is captured in stone, word or canvass. As Ge,rald Vann remarks: The so-called industrial revolution ran its course: and ende.d by depriving the mass of men of a fundamental right, of that without which the personality is doomed to sterility and despair: the, creativity which is the counterpart of creatureliness.3 Within these two qualities of our humanness are the duty and right of work. Cooperation can be a most thrilling human experience. God longs for us to work with him in the fulfillment of the plan of salvation. Our very activity is an essential ingredient in the building of the earth and of the kingdom! The dignity of such a mission is immeasurabli~. Yet that is precisely what our scriptural and theological understanding of work indicates: the people of God continue to share in the work of creation.i The Vatican I1 document Gaudium et Spes drives home the reality that we are a Church in the modern world, an "in" that means involve-ment. Any mentality that either despises history or refuses to invest time and energy in improvement of the world goes contrary to the Scriptures and the teaching of the Church. Participation in the mystery of creation is threatened in our time. The buildup of armaments, sufficient now to many times over destroy our planet, leads many to an attitude of pessimism if not despair. Such a consciousness causes paralysis and the mission of work goes unaccomplished. The land is not tilled, book,,are not written, songs are not sung, families are not raised, conflicts are not resolved, resources are exploited. Why not? Annihilation is not only possible but likely! Suspicion is abroad: our times are less creative because of an annihilation attitude. Perhaps we can learn a lesson from Anne Frank. With bombs dropping near her hideout and with death a constant threat, she continued to study her history lesson. Life goes on! Christian faith calls us to our creative work regardless of the dark clouds that surround us. And, of course, one of the most urgent creative 3Gerald Vann, St. Thomas Aquinas (New York: Benziger Bros., 1947), p. 27. Laborem Exercens: Themes and Theses works is peace. Our work must bring about a world in which war becomes impossible. Theme 5: A Spirituality of Work Thesis." Work is a means by which persons grow in union with God and participate in the paschal m.vster.v. She (the Church) sees it as her particular duty to form a spirit.uality of work which will help all people to come closer, through work. to God. the Creator and Redeemer, to participate in his salvific plan for man and the world and to deepen their friendship with Christ in their lives by accepting, through faith, a living participation in his threefold mission as Priest. Prophet and King. as the Second Vatican Council so eloquently teaches (24). This Christian spirituality should be a heritage shared by all. Especially in the modern age. the spirituality of work should show the maturity called for by the tensions and restlessness of mind and heart (25). Since work in its subjective aspect is always a personal action, an actus personae, it follows that the whole person, body and spirit, participates in it, whether it is manual or intellectual work. It is also to the whole person that the word of the living God is directed, the evangelical message of salvation, in which we find many points which concern human work and which throw particular light on it. These points need to be properly assimilated: an inner effort on the part of the human spirit, guided by faith, hope and charity, is needed in order that through these points, the work of the individual human tSeing may be given the meaning which it has in the eyes of God and by means of which work enters into the salvation process on a par with the other ordinary yet particularly important components of its texture (24). The farmer brings the seeds of the field to Eucharist for a special blessing on rural life day, thereby exercising an act of faith in God as creator of the seed and provider for its growth. The newspaper editor cries out against the injustices toward the elderly, thereby fulfilling his prophetic role of denouncing all that infringes upon human dignity and freedom. The president of a country, through policies that properly distribute funds, insures that the poor and needy have their due. The people of God are scattered throughout every profession and work situation and it is precisely in that context that they exercise their spirituality. Union with God is achieved not only through liturgical worship and the celebra-tion of the sacrament. Holiness is gained as well by finding Christ in our brothers and sisters, in the working of the land, in the artistic and intellectual achievements. All of life, permeated by God's presence and love, becomes a grace opportunity and can further the process of salvation. A spirituality of work demands three things: vision, grace and commitment. An abiding vision of the divine presence is a gift of faith. Work is not restricted to the narrow sensate culture (limiting work to the confines of time/space) nor to a humanistic betterment of the world, important as that is. Rather, faith vision situates our work as an integral part of God's salvific will. Grace, the free gift of God's self-giving which transforms our minds and hearts, is the heartbeat of a spirituality for work. Empowered by the Spirit, our work has a certain quality and tonality that makes everything different. There is a freshness, newness and sense of possibility in what is done. Eventually the work will incarnate that grace as 321~ / Review for Religious, May-June, 1982 another sign of God's favor. Further, commitment to the person of Christ by sharing in his life, death and resurrection undergirds all Christian spirituality. The paschal mystery draws us into the dying/rising process of Christian existence. Work constantly involves dying and rising; done in union wiih Christ it allows us to become the person God calls us to be. In Zorba the Greek, Nikos Kazantzakis has one of the characters describe his experience, "I at last realized that eating was a spiritual function and that meat, bread and wine were the raw materials from which the mind is made.TM No longer is there a harsh dichotomy between the secular and the sacred, the flesh and the spirit, heaven and earth. A false dualism is rejected and the unity of existence maintained. Work and worship are not mutually exclusive; they are meant to complement and enrich one another. For some workers their highest moments of prayerful praise and thanksgiving are in the midst of their work experience. A mother caring for her child, the artist sharing the masterpiece, the nurse weeping with the terminally ill, the scientist discovering a new atomic particle, the scholar articulating an insight: nurturing, creating, caring, wondering, discovering, sharing --moments of work, grounded in sacrifice, discipline and great effort, and moments of grace. All of this contributes.to a spirituality of work because to live in God's presence with sensitivity, awareness and love is to live a spiritual life. Theme 6: Work and Questions of Justice Thesis: Work plays a significant function in the justice question: there can be no justice unless work~ is available to people in such a way that basic rights and duties are protected and promoted. In order to achieve social justice in the various parts of the world, in the various countries, and in the relationships betwyen them, there is need for ever new movements of solidarity of the workers and with the workers. This solidarity must be present whenever it is called for by the social degrading of the subject of work, by exploitation of the workers, and by the growing areas of poverty and hunger (8). It must be stressed that the constitutive element in this progress and also the most adequate way to verify it in a spirit of justice and peace, which the Church proclaims and for which she does not cease to pray to the Father of all individuals' and of all peoples, is the continual reappraisal of man's work, both in the aspect of its objective finality and in the aspect of the dignity of the subject of all work, that is to say, man. The progress in question must be made through man and for man and it must produce its fruit in man. A test of this progress will be the increasingly mature recognition of the purpose of wbrk and increasingly universal respect for the rights inherent in work in conformity with the dignity of man, the subject of work (18). While work, in all its ~any senses, is an obligation, that is to say a duty, it is also a source of rights on the part of the worker. These rights must be examined in the broad context of human rights as a whole, which are connatural with man, and many of which are proclaimed by various international organizations and increasingly guaranteed by the individual States for their citizens. Respect for this broad range of human rights constitutes the fundamental condition for peace in the modern world (16). 4Nikos Ka~,antzakis, Zorba the Greek (New York: Simon and Schuster, 1952), p. 79. Laborem Exercens: Themes and Theses Whenever relationships are established, certain issues of justice automatically arise. By its very definition the work relationship between employer and employee presents a mutuality of duties and rights. The encyclical addresses itself primarily to threatened rights of the employee, giving little attention to the dutie.s of the employee toward the employer. Employees' rights are numerous: the right to a just wage, the right to social benefits that ensure life and health, the right to rest, the right to pension and insurance, the right to suitable working environments, the right to strike under certain circumstances, the right to form voluntary associa-tions, the right of the disabled to productive activity suited to them, the right to emigrate in search of work. The correlative list would include the duties that come to the employer or society because of these rights. This area of justice is specific and measurable; much honesty, dialogue and planning are necessary if the ideals is to be achieved. The linkage between justice and peace is dearly articulated: Commitment to justice must be closely linked with commitment to peace in the modern world (2). Respect for this broad range of human rights constitutes the fundamental condition for peace in the modern world (16). Whenever rights are denied or duties neglected,,a profound disturbance shakes the life of individuals and society at large. Theologically we call this sin, ethically we call it injustice, sociologically we call it alienation. Regardless of the language system, the experience and its consequences are clear: the order of God's plan is broken and until reconciliation comes about, until justice is done, the fragmenta-tion continues and peace is not found in the land. Mere absence of war or conflict is not peace; rather, it is an ontological state of being, experienced when relation-ships~ are properly ordered. If charity begins at home, all the more so justice. Thus the Church as an institution must constantly strive for justice and peace within her own immediate membership. The fact that the above rights reside in her own personnel imposes an obligation on the Church as employer. This "beginning at home" is significant since authenticity of teaching and preaching constantly seeks verification in prac-tice. When the Church both teaches justice and lives it, the world has a model which affirms that the realities of justice and peace are truly possible. Theme 7: Work and Various ideologies Thesis: Work demands a meaning and various interpretations are offered by Liberalism, Marxism and Christian theology. The Marxist program, based on the philosophy of Marx and Engels, sees in class struggle the only way to eliminate class injustices in society and to eliminate the classes themselves. Putting this program into practice presupposes the collectivization of the means of production so that, through the transfer of these means from private hands to the collectivity, human labor will be preserved from exploitation (11). This consistent image, in which the principle of the primacy of person over things is strictly preserved, was broken up in human thought, sometimes after a long period of incubation in practical living. The break occurred in such a way that labor was separated from capital and 33{~ Review for Religious, May-June, 1982 set m opposition to it, and capital was set in oppositioh to labor, as though they were two impersonal forces, two production factors juxtaposed in the same "economistic" perspective. This way of stating the issue contained a fundamental error, what we call the error of economism, that of considering human labor solely according to its economic purpose. This fundamental error of thought must be called an error Of materialism, in that economism directly or indirectly ~ncludes a conviction of the primary and superiority of the material, and directly or indirectly places the spiritual and the personal (man's activity, moral values and such matters) in a position of subordination to material reality (13). The only chance there seems to be for radically overcoming this error (primitive capitalism and liberalism) is through adequate changes both in theory and in practice, changes in line with the definite conviction of the primacy of the person over things, and of human labor over capital as a whole collection of means of production (13). Absolutizing is that radical instinct in thought and behavior that makes one idea or value the only idea or value. The label we attach to such a tendency is "isms": e.g., secularism holds that all reality is limited to this world--there is no transcendence; humanism measures all of life in the light of the human person-- God finds no home here; rationalism restricts valid knowledge to that gained by reason--faith vision is excluded; workism so prizes achievement and productivity that leisure (receptivity-contemplation) is meaningless if not downright evil. The encyclical deals with this proclivity to absolutize and firmly rejects certain specific "isms" that surround work. Anathema sit: Marxism that seeks a collectivism of means of production so as to infringe upon the right to private property; liberalism that fails to take into account the common good in its worship of primitive capitalism; economism that views human labor solely in terms of its economic purposes; materialism that subordinates the spiritual/personal aspects of life to material reality. Christian theology consistently seeks a balanced position that protects moral and personal and spiritual values. Thus private property is a basic' right, though the common good will severely limit this right or even exclude it under very restricted circumstances. Economic profit is necessary and justifiable but never at the expense of human dignity. Matter is part of God's creation but is subordinated to the value of the human person. The insights of Scripture and tradition are brought to bear upon the complex reality of the work world. Basic principles are articulated through careful theological reflection which provides a theory that will hopefully inform our action. The Church is not reluctant to speak out with a strong prophetic voice whenever there is encroachment upon the rights of people, be that encroachment by employer or employee. Jacob Bronowski states that "without astronomy it is really not possible to find your way over great distances, or even to have a theory about the shape of the earth and the land and sea oh it."~ Part of the Church's mission is to provide a theologicalastronomy by which the complex components of life can be assessed and prudently judged. The present papal document serves a timely purpose: it ~Jacob Bronowski, The Ascent of Man (Boston: Little, Brown and Company, 1973), p. 190. Laborem Exercens: Themes and Theses articulates a theology and a spirituality from which to observe and practice the command of God that we work, thereby building up a more human community and furthering the growth of the kingdom. Such an astronomy is no luxury, it is an absolute necessity. Theme 8: Work and its Abuse Thesis: Work, which is meant to humanize and develop persons, can become destructive when means become ends. ¯. it {the anlinomy between labor and capital) originated in the whole of the economic and social practice of that time, the time of the birth and rapid development of industrialiTation, in which what was mainly seen was the possibility of vastly increasing material wealth, means while the end, that is to say, man, who should be served by the means, was ignored (13). The primary basis of the value of work is man himself, who is its subject. This leads imme-diately to a very important conclusion of an ethical nature: however true it may be that man is destined for work and called to it, in the first place work is "for man"and not man "for work" (6}. The very process of "subduing the earth." that is to say work. is marked in the course of history and especially in recent centuries, by an immense development of technological means. This is an advantageous and positive phenomenon, on condition that the objective dimension of work does not gain the upper hand over the subjective dimension, depriving man of his dignity and inalienable rights or reducing them (i0). A gospel question focuses our attention: is man made for the Sabbath or the Sabbath for man? Jesus had to deal with the means/end question and there is nothing unclear about his answer: the Sabbath is .made for man. Ambiguity characterizes some contemporary questions arising from the world of work: What is the relationship between technology and the human person? What status does the individual have in large multinational corporations? When transfers are made, what "considerations are given to the worker's family? If profits will be less but the work situation is more humanizing, what kinds of decisions are made? Is man made for work or work for man? Historically the document states that certain means have usurped the prerogatives of the end; technology (means) has become the master and the human person (end), the slave. At this juncture, justice and peace are no more. The whole order is overturned, human freedom is lost. Simone Weil, a strong prophetic voice for the ~,alue of work in the first half of this century, worked in factories so as to experientially learn the workers' situation. Her experience was not a happy one: workers were dehumanized because they were treated simply as cogs in a large, productive m~chine. Upon reading Homer's Iliad, she extracts a universal truth about evil that applies to our present discussion: Thus in this ancient and wonderful poem there already appeared the essential evil besetting humanity, the substitution of means for ends.6 ~The Simone Weil Reader. ed, George A. Panichas (New York: David McKay Company, Inc., 1977), p. 138. 3~12 / Review for Religious, Ma.v-June, 1982 What is so horrendous is that often this process of evil is unconscious and unin-tended. The means we use for produiztivity are happily introduced. Suddenly we wake up one morning and come to realize, that we are controlled by the very process we devised. The underlying question is one of freedom, a freedom that protects our humanity and a freedom to use tools of production wisely. Such a freedom comes only from hard-won knowledge: we cannot make prudent choices when ignorant of facts and circumstances. Education is of greatest importance here. All people involved in the working community must maintain a high level of attentiveness to attitudes, means of production, societal tendencies, subtle shifts in values. The means/end dilemma must not be blurred. Melville, in his classic Moby Dick, comments that "ignorance is the parent of fear."7 Societal fears often arise because we are ignorant of the proper relationship between means and end. With increased knowledge we are hopeful that fear will be dissipated and our freedom regained. Theme 9: Work and the Common Good Thesis: Work, through the use of natural and personal resources, is an essential force to achieve the common good. ¯. society--even when it has not yet taken on the mature form of a nation--is not only the great ~educator" of every man, even though an indirect one (because each individual absorbs within the family the contents and values that go to make up the culture of a given nation): it is also a great historical and social incarnation of the work of all generations. All of this brings it about that man combines his deepest human identity with membership of a nation, and intends his work also to increase the cor~mon good developed together with his compatriots, thus realizing that in this way work serves to add to the heritage of the whole human family, of all the people living in the world (16). Rational planning and the proper organization of human labor in keeping with individual societies and States should also facilitate the discovery of the right proportions between the different kinds of employment: work on the land. in industry, in the various services, white-collar work and scientific or artistic work, in accordance with the capacities of individuals: and for the common good of each society and of the whole of mankind (18). Here we must return once more to the first principle of the whole ethical and social order. namely, the principle of the common use of goods. In every system, regardless of the funda-mental relationships within it between capital and labor, wages, that is to say remuneration for work, are still a practical means whereby the vast majority of people have access to those goods which are intended for common use: both the good of nature and manufactured goods (19). In the document Gaudium et Spes, the fathers of the Second Vatican Council described the common good in these terms: Now. the common good embraces the sum of those conditions of social life by which individuals, families and groups can achieve their own fulfillment in a relatively thorough and ready way (74). 7Herman Melville, Moby Dick (New York: The Literary Guild of America, Inc., 1949), p. 17. Laborem Exercens: Themes and Theses / 333 Although somewhat nebulous in the abstract, the common good is extremely concrete and pragmatic in experience. Yet certain cultural attitudes towards pri-vate goods and vested self-interest make it difficult for the relationship between work and the common good to be properly understood. One such attitude regards comm~on good items (parks, public buildings, and so forth) as areas of exploita-tion, with no sense of personal responsibility for their upkeep or cleanliness. A mentality of privatized ownership threatens the realization of the common good. Through work 1 will take as much as 1 can without any thought of.making my contribution to the commonweal. Various writers8 are beginning to articulate a public theology and notions of a church which help to provide a vision for the protection of the common good through responsible work and concern. Several years ago there was a global experience that had the potentiality to develop social consciousness for the common good. For the first time in history, through the technology of cameras, we saw ourselves, the planet earth, from the moon. Hurling through space, like people on a small raft, brought us a realization that we are all in this together. The activity of one affects the activity of all. Responsible Work and sharing enriches the human family; failure to do so dimin-ishes and deprives people of quality life. Perhaps the moon photograph has been blurred already and the strong sense of interdependence to which we are called has been obscured by innate avariciousness. Is work done primarily for profit and personal gain? Have we forgotten the common good or disregarded it as some utopian dream? Two types of people have been known throughout history as truly human and noble: people of compassion and people of hospitality. The former have a heart that is moved deeply by the joys and sufferings of others. A'basic affinity with human experience resides deep within the being of compassionate people. Hospi-tality, that gracious welcoming of the stranger-into personal space and time, creates an environment in which the common good is realized. Regardless of.one's employment, the work~ of compassion and hospitality are universal vocations and only when they are exercised, thus producing the common good, do individual goods have any value whatever. The paradox of the gospel grain of wheat is lived again. Theme I0: Work and Communily Thesis: Work builds community by uniting people into a powerful solidarity. In fact. the family is simultaneously a community made possible by work and the first school of work, within the home, for every person (10). The call to solidarity and common action addressed to the worker--especially to those engaged in narrowly specialized, monotonous and depersonalized work in industrial plants, when the machine tends to dominate man--was important and eloquent from the point of sSee Martin E. Marty's The Public Church (New York: Crossroad, 1981)and Parker J. Palmer's The Company o.f Strangers (New York: Crossroad. 198 I). 334 / Review for Religious, Ma.v-June, 1982 view of social ethics. It was the reaction against the degradation of man as the subject of work, and against the unheard-of accompanying exploitation in the fields of wages, working condi-tions and social security for the worker. This reaction united the working world in a commu-nity marked by great solidarity (8). It is characteristic of work that it first and foremost unites people. In this consists its social power: the power to build a community. In the final analysis, both those who work and those who manage the means of production or who own them must in some way be united in this community 120). Communities are formed when there is a common sense of identity, when there is a commitment to a specific value system, when lives are shared by mutual experience. Many work situations have these three qualities. A good schobl faculty know who they are, are committed to truth and its various expressions, and share lives professionally and, to some degree, socially. A professional sports team working together for several years establishes a strong communal bond. Work has the potential to unite people and form community, i.e., a style of work that is balanced and. person centered. What is intriguing is that often the bond of com-munity happens without conscious planning; it is a side effect of deep c6operation. Human life is complex. Like a spider's web, there are many intersecting lines in our relationships and in our multiple communities, e.g., The community to which I belong is, of course, not a static one. Sometimes it is the commu-nity of my wife and myself and my family: at other times that of my relations, of my friends, of my work colleagues, of my city or nation or international grouping. My task in each different community varies according to the particular community I am being consciously part of at any time. In some communities, I am a key figure: in others, of lesser or minimal importance. But in all of them I have a function, a duty and a responsibility and I believe I will be judged on my performance of these at the end of my time. Often I do not know exactly what that function is--but I know that basically it is to be a harmonizing influence, a peacemaker, a go-between, a catalyst, a bringer-out of good qualities in others for the sake of a group.'~ This vision of community and work depicts the range of groupings in one's life and the specific functions that we are to play. The notion of facilitator may accurately describe "the work" (the process of life itself) that will build any community. We facilitate relationships by bringing love and concern which, in turn, bring about peace and oneness. The Gospel of John states that God is always working. Jesus presents himself as the waiter, serving at table those who come for life-giving food. The thrust behind this work is community, to build and complete the Fi~ther's kingdom. Thus the dignity of the vocation of work becomes clear: as co-worker with the Lord we participate in the process of reconciliation, bringing all creation back to the Father. Whatever our task in life, however sublime or humble, we lovingly accept the charge given us and contribute to the realization of the Father's plan. Adveniat regnum ! ~On the Run: Spirituality for the Seventies, ed. by Michael F. McCauley (Chicago: The Thomas More Association. 1974). p. 138. Reflections on Leadership in the Spirit of Jesus Cecilia Murphy, R.S.M. Sister Cecilia Murphy is the President of the Sisters of Mercy of Pittsburgh. In the issue of January, 1976, Sister shared her reflections on the chapter experience of her community. In the present article, a talk given at their congregational meeting of March, 1982, she reflects on her experience of leadership in her community. Sister Cecilia resides at 3333 Fifth AveA Pittsburgh, PA 15213. Living leadership in the spirit of Jesus is a challenge to every Christian. Each follower of Jesus is called to "come after Jesus" and to show others the way. Those called to leadership in a religious congregation of Mercy bear a special responsibil-ity in this matter. How can anyone fulfill this task? My reflections on this topic are a result of trying to "bone it'--trying to dig into the essential and offer some thoughts on what is necessary for leadership in Jesus' spirit. We know Jesus through faith--faith in God's word and sacraments; faith in our personal experiences of Jesus. We know from Scripture that Jesus poured himself out for our sakes and that he taught us how to live. The commitment of our lives and our personal prayer have helped us know experientially who Jesus is, how he loves, what he asks of us: Faith, then, is the first essential for leadership. Things are not always clear and efisy, and the felt presence of the Lord is a special and temporary gift. So, the leader needs to pray for a strong faith-life, to make acts of faith, and to live in faith, believing in God's love and fidelity. Sorting out and probing the purpose of life, religious life, and its values are essential to leaders. These exercises focus leaders on "the one thing necessary." They help to keep clear the purpose of religious community and enable leaders to be conscious of the motives, fears, and choices that are operative in life. Jesus probed the meaning of life by withdrawing from others and praying to his Father in secret. Exposure to solitude and openness to God's ways are integral parts of searching. These opportunities enable leaders to be like the violinist who carefully 335 ~136 / Review for Religious, May-June, 1982 tunes the instrument before a symphony. Reflection enables the leader to "be in tune" with the divine pitch. Without confidence in God, religious leadership is impossible. The counsel that Catherine McAuley took to heart, to pray as if everything depended on God and act as if everything depended on us, was not only common sense, it was an inspired statement. As Jesus was ever conscious of his Father's power, so must a leader be! All works concerned with the human spirit are beyond human control. Leaders cannot change another pers6n; God reserves that to himself. Yet a leader is called to use all her human potential to create the best environment, and also to pray in confidence, knowing that God's work is ultimately carried out by God-- sometimes through her. Belief in the value of suffering is an essential for a religious leader. Jesus suffered and died. Our congregation was founded on Calvary; there are no easy roads to Mount Tabor. In each human life suffering is present, but Christians are challenged to "take up the cross." Leaders must attempt to follow the Master to Calvary. The particular kinds of suffering which best make an individual an image of Jesus are known only to the Lord. For the leader, however, many of these have something to do with various kinds of poverty. One form 6f poverty is that of spirit, "Why me, Lord?" the leader asks. "There are others holier, more insightful, more loving, more intelligent, more capable, Why me?" And'the Lord replies, "It was not because you are great but because I am great and want to use your nothingness. Don't question my choice--just cooperate." There is the poverty of unfulfilled expectations--those of the leader and those of other members. Unconsciously, leaders sometimes set expectations for them-selves which could not be fulfilled by five people, let alone one. Consider, then, the 335 members of our congregation, multiply by five, and you will have a sense of the number of expectations placed on a leader. The sense of poverty in facing all these unfulfilled expectations is a cause of great suffering. Dealing in realms beyond one's experience and capabilities creates a sense of poverty. Learning about finances, management, interacting with corporate leaders can cause a sense of being entirely out of one's element. Like Ruth, the leader must try to adapt to alien lands, to grow in new knowledge and allow the pinch of human limitations to be felt. There is the poverty of being in an "iceberg ministry." When 1 ask myself what 1 do, it is very hard to define. So much of a leader's ministry is confidential or invisible to others and sometimes to herself. Members of the congregation may wonder why all the paper communications keep filtering into a small community and exclaim, "Another paper from the Mount!" However, some leader may have worked hours trying to simplify and clarify ideas so that they could be shared with (he membership. Dialogue and interaction with members are an important part of leadership but they, too, are invisible parts of the iceberg. Leaders need. to laugh. Although the gospels do not record Jesus as laughing, we can be sure, since we are made in his image, that Jesus did enjoy life. He had Reflections on Leadership special friends, the disciples. He went off with them, shared special meals with them. Without doubt he must have often suppressed a laugh as he experienced their human condition. Leaders, too, need to relax, to have friends, to take time to unwind and be "at home" with family. Rest is a requirement for all human persons and so must leaders be renewed and refreshed. Refreshment help~ one maintain balance--an essential for leadership. Our "Government Synthesis Statement" makes explicit a tension that is inherent in leadership, the tension between internal and external concerns. How does one balance the call to broader church and civic leadership with the need to provide for the growth and development of the membership? There is no answer to that question, only the ongoing struggle to live authentically in that tension. As Jesus lived the tension of the Agony in the Garden, he prayed for the accomplishment of the Father's will. He prayed for courage to fulfill his mission. Leaders need courage, a courage which is strengthened by conviction; made more difficult by uncertainty. In relating to individuals and the total congregation, the leader needs courage to risk--risk to be wrong even when acting in good faith. Leaders can make mistakes and they need courage to face mistakes honestly. Tomorrow's leaders will also need courage to fulfill our "Government Synthe-sis Statement" which calls them to use our corporate power on behalf of the poor. This challenge will take courage and wisdom on the part of the leaders and generosity and willingness for conversion on the part of the membership. As Jesus listened to Nicodemus, so a leader must listen to God, the members, the Church, the world. Jesus was a sensitive listener when he attempted to deal with the needs of others. In Jesus the leader has the perfect model of attentive listening and response to others. Leadership in religious congregations requires a deep realization of the divine help that comes from the prayers of the sisters. Likewise it calls forth a daily prayer: "Glory to him whose power working in me can do infinitely more than 1 can ask or imagine!" Tedium and Burnout in Religious Life Mary Elizabeth Kenel Dr. K(nel, as well as maintaining a private practice in Washington, is a field supervisor in the pastoral counseling program of Loyola College in Baltimore. She may be addressed at 901 Perry Place, N.E.: Washington; DC 20017. In recent years mu~ch of the research in the area of social psychology has focused on the phenomena of tedium and burnout, primarily as these apply to the workers in the human services fields. These phenomena are by no means limited to members of these groups, however, and researchers are investigating burnout at various phases of the life cycle: the tedium experienced by college students, burn-out in marriage and parenting, and that demonstrated in the mid-life and mid-career crises. Everyone at some time or another is vulnerable to the stresses of tedium and burnout and religious are no exception. Indeed, the very qualities that are com-mon to those aspiring to religious life and a ministry of service tend to render religious as a group vulnerable to the burnout syndrome. The term "burnout" was first introduced by Herbert J. Freudenberger~ in his articles on staff burnout in the help-giving inst.itutions. Since that time a number of other authors have made use of the term and have given it various definitions. Edelwich2 defines burnout as a progressive loss of idealism, energy, and purpose experienced by people in the helping professions as a result of the conditions of their work. Pines and Aronson3 define tedium as the experience of physical, ~ Freudenberger, H. J. "Staff Burn-out," Journal of Social Issues, 1974, 30(I) pp. 159-165. 2Edelwich, J., Burn-Out, Stages of Disillusionment in the Helping Professions. Human Sciences Press, New York, 1980. p. 14. ~Pines, A. M. and Aronson, E., Burnout, From Tedium to Personal Growth, The Free Press, New York. 1981. p. 15. 338 Tedium and Burnout in Religious Life emotional and mental exhaustion characterized by emotional and physical deple-tion and by the negation of one's self, one's environment, one's work, and even one's life. They consider burnout to be identical to tedium in definition and symptoms but apply the term particularly to those who work with people in situations that are emotionally demanding. While both tedium and burnout are accompanied by a constellation of symp-toms that include fatigue, lack of enthusiasm, and feelings of helplessness and hopelessness, burnout may be thought of as a state of mind that afflicts those individuals whose work requires that they pour in much more than they get in return, be that return from clients, patients, students, superiors or peers. The dedicatory nature of the vows can set the stage for burnout. Take, for example, a motto instilled during a novitiate instruction: "Chastity loves without seeking a return." A literal interpretation and acceptance of such an ideal can readily lead to burnout as the religious' energies are depleted over time. One of the biggest difficulties with the concept of burnout, however, is that it has become fashionable, a new item in the evergrowing dictionary of psychobab-ble. Burnout as such has no formal psychiatric status and, indeed, many would see it as depression. The literature, however, tends more and more to distinguish between the two concepts and relates burnout to the environmental stresses under which a person works rather than to intrapsychic forces. The onset of tedium/burnout is rarely the result of a single traumatic or disillusioning event. More typically it is the result of a gradual erosion of strength and spirit. Edelwich,4 for example, recognizes a series.of stages that range from idealistic enthusiasm to apathy. The victims of burnout tend to be those who had once been amoiag the most idealistic and ardent, those who at one time were most enthusiastic and joyful. This is hardly surprising, for nearly every author in the field has noted that in order to burn out one must have been on fire at some point. It is the intent of the remainder of this article to examine the antecedents to burnout and tedium as well as to examine the stages of development that lead fr9m enthusiasm to apathy. To the extent that individual religious and communi-ties can recognize and anticipate burnout they will be better able to avoid the ineffectual, wishful remedies that are often practiced and seek more realistic coping mechanisms. A positive ~pproach to the problems of tedium and burnout, then, will not be based on the hope of total prevention which is almost impossible to achieve, but on the realization that it will happen, even repeatedly, and must be dealt with on an ongbing basis. As with any other life crisis, burnout can be turned to advantage in that it can energize a person to break out of a rut. Creative use of frustration can become a stimulus to the kind of enthusiasm it generally erodes. Antecedents to Burnout Research5 on the phenomenon of burnout as it applies to human service 4Edelwich, J. op. cir. pp. 28-29. 5Pines, A. M., and Aronson, E. op cir., pp. 48-54. 3tll~ / Review for Religious, May-June, 1982 workers has identified three common antecedents that would apply equally well to religious. 1. Work That Is Emotionally Demanding In the human serVice professions people work with others in situations that are emotionally draining over long periods of time, during which they are exposed to their clients' physical, social, and psychological problems and are expected to be both skillful and concerned. A similar expectation is placed on priests, brothers and sisters in virtue of their religious profession, in addition, members of religious groups are frequently actively engaged in human service occupations such as teaching, nursing, and counseling. Think, for example then, of the emotional toll of working with the terminally ill, with the mentally ill, with those who have lost loved ones--especially when one's religious profession means one is also expected to explain "God's Will" in these situations. 2. Characteristics of the Professionals Themselves Pines and Aronson6 note that in the human services the occupational task acts as a screening device that attracts people with particular types of personal attrib-utes. The same is true of religious life. Think of the adjectives used to describe priests and religious in terms of the concept of mirfistry. Words such as dedicated, service, and other-oriented are frequently mentioned. 3. Client-Centered Orientation As is the case for members of human services teams, religious focus on people receiving their service. The role of provider of help, understanding, and support is defined by the client's needs with relatively little attention paid to the needs of the professional or the religious. A strictly client-centered orientation does not permit a symmetrical relationship of mutual give and take. Instead a complementary relationship is set up in which the religious or human service worker is expected to give while the client receives. Common to both situations is a dedicatory ethic that elevates service motives and presents work not merely as a "job" but as a "voca-tion" or "calling" in which the reward is supposed to be inherent in the giving. The Prayer of Saint Francis captures this thought: "It is in giving that we receive . 4. Other Antecedents to Burnout In addition to those areas delineated by Pines and Aronson there are a number of other antecedents to burnout that need to be considered. One is that of a lack of criteria for measuring one's accomplishment. There is sufficient difficulty in attempting to define accomplishments in the therapeutic field. How much more so in th6 religious life. How does one define one's success as nPines, A. M. and Aronson. E. ibid., pp. 51-52. Tedium and Burnout in Religious Ltfe 311"1 a "religious"? Does one play the "numbers game"---how many converts, baptisms, hours of donated service? And if there are no hard-and-fast criteria for success, how then does one set standards for reviewing one's life and work? Another source of difficulty lies in the area of career advancement. Far too often the religious who has entered upon a particular form of active ministry because of a desire to work with people is "promoted" to an administrative posi-tion that. while enlarging his or her sphere of influence, many times results in loss of client contact and ultimately in loss of job satisfaction. Antecedents to Tedium While religious life itself is a form of other-oriented profession in which many members actually do work in the human services area, it also has a bureaucratic and hierarchical structure and as such shares many of the antecedents of tedium found in business or government organizations. The literature describes organizational structure as a major determinant of job performance, satisfaction, and tedium.7 Pines and Aronson8 identified three major antecedents of tedium. 1. Overload Overload is a key concept in studies of job stress and its effect on health and can be viewed as having objective/,su.bjective and quantitative/quali!ative dimen-sions. Objective overload refers to the actual volume of work to be processed per unit of time while subjective overload refers to the person's feeling that there is too much work to be done or that it is too hard. Quantitative overload implies that one actually has more real work than can be handled per unit time. Qualitative overload, on the other hand, indicates that the work load demands skills, knowl-edge or training exceeding that of the person assigned a given task. That objective, quantitative overlo.ad is part and parcel of the daily life of most religious hardly needs mentioning. Schedules tend to be full to overflowing and many a prayer has been offered for a few extra hours in the day as well as another pair of hands. Qualitative overload, however, may be even more stressful in the long run and more likely to induce tedium. In a situation of qualitative overload unrealistic ex, pectations are placed on an individual or group who must then deal not merely with the realities of the workload but with a sense of inadequacy and personal failure when it becomes impossible to live up to those "great expecta-. tions." Fortunately, in more recent years superiors and formation personnel have attempted to see to it that people are trained prior to placement in a specific position. With personnel shortages, however, it is tempting to appeal to the per- 7Armstrong. K. 1. "'How Can We Avoid Burnout. Child Abuse and Neglect: Issues in Innovation and Implementation." DHEW Publication #(OHDS) 78-30148. 2(1978). pp. 230-238. ~Pines. A. M. and Aronson. E. op cir. pp. 67-72. 3t12 / Review for Religious, May-June, 1982 son's "generosity and sense of mission" and propel him or her into a position for which he or she is unprepared and in which he or she expends tremendous energy simply to "stay afloat." 2: I~ek of Autonomy In any area of life, lack of control over one's environment is a highly stressful experience and frequently enough leads to the learned helplessness phenomenon observed by Seligman.9 In this depressed state the person tends !o attribute success to "luck" or "chance" or other forces outside his or her control while accepting full responsibility for failures. A perceived lack of autonomy and the frustration resulting from such a lack is a common cause of tedium in organizations of all types, .for job satisfaction declines as the individual is more burdened by unnecessary rules and red tape and lacks voice in decisions that affect the job and his or her life. Lack of autonomy can also be aggravated by a communication gap between superiors and those further down the organizational hierarchy. This gap may be due to the inherent inefficiencies of communication in large organizations or to differing perspectives among superiors and those actively engaged in a given work. It is necessary then to attempt to build organizational structures that will avoid, to some extent, these pitfalls. The problem of autonomy is a thorny one for religious. Balance must be achieved between a legitimate need for autonomy that is part and parcel of healthy adult functioning and the demand of religious obedience that is, perhaps, the very heart of the religious commitment. To some extent community structures have always made some provision for autonomy, for example, those having perpetual vows might vo~e for the superior, serve as councilors, or in other ways voice an ~pinion on community matters. The proverbial "planting cabbages upside down" type of blind obedience is also a.thing of the past. More recent changes in community life have attempted to address this need for autonomy. For example, the matter of annual assignments is now often handled on ~ consultative basis with the individual religiot~s I~a~'ing more input into the decision than was previously the case. Community meetings 6n the local, regional, and national/international levels also serve to keep the lines of communi-cation open and flowing upward, not merely downward. Nevertheless, the fact remains that the religious, by virtue of the vow of obedience, does surrender much personal autonomy. This surrender is often felt most keenly n.ot'in the early years but later as one must deal with one's own growth and developmeht as a ]'esponsi-ble adult. Much of the "mid-life crisis" seen in religious life centers around the issue of autonomy, the need for personal space and the integration of such concepts as 9Seligman. M. E. Helplessness: On De.pression Development and Death, San Francisco: Freeman Press. 1979. Tedium and Burnout in Religious Ltfe / 343 ob¢dience, choice, power, accountability, and responsibility. Perhaps one of the ways to resolve this conflict is to keep some progressive vision of what the com-munity (small group or larger organization) might accomplish and nurture the scope and consciousness of discretionary behavior. In most life situations things usually are more flexible than they might initially appear. Evaluating the possibili-ties for positive change and focusing one's energies in the realm of the possible enhance one's sense of legitimate power and control. The religious who can be attentive to authority, who can blend personal goals with community goals, and who recognizes both the extent and limit of his or her discretionary power is not as likely to suffer the lack of autonomy that leads to tedium. 3. Lack of Rewards It is indeed unfortunate that most organizations are inefficient in the distribution of rewards, appreciation and recognition, as this contributes to dis-couragement and demoralization among the members and can eventually lead to tedium. It is surprising that better use is not made of the power of positive reinforcement, for common sense would suggest, and research has confirmed, that people are far more able to tolerate considerable stress in situations in which they feel appreciated and their efforts recognized than in those in which they feel the rewards are not commensurate with their efforts. Religious are definitely not exempt from the need for rewards and recognition. Indeed, the absence of high levels of financial remuneration make it imperative that social rewards be given. It is all well and good to appeal to altruistic and spiritual motives, but positive feedback has tremendous reinforcement value that is far too often ignored. As a result, the religious who is.often enough already unpaid or underpaid is deprived of the satisfaction derived from well-earned recognition. Another aspect that frequently causes pain is the fact that the religious may be appreciated by those with whom he or she serves yet get little or no recognition from within the community. It remains true today "there is no respect for a ¯ prophet in his own country" Jn 4:44. While it is true that one should not rely solely on one's superiors for praise there is a need for ~ecognition by one's peers that is often lacking. It is frequently the presence or lack of support at the local level that can make the difference between a vital, contributing team member and a "burnt-out case." Stages of Disillusionment Edelwicht0 defines five stages in the process of disillusionment. Stage one, that of initial enthusiasm, is that period of high hopes, high energy and unrealistic expectaiions when one does not know what the job is all about. In religious life this would typically correspond to the novitiate and formation period as well as the early years of active ministry. 1 recall hearing a novice describe with great anima- I°Edelwich. J., op. cit. pp. 28-29. 344 / Review for Religious, May-June, 1982 tion the ceremony of initial profession of another sister. The formula of vows, written by the sister, concluded with the words "Surprise me, Jesus!" An older priest seated next to me turned to me, smiled ruefully, and said sotto voce "He will." The second stage is that of stagnation. It is at this point that one's ministry is no longer so satisfying as to substitute for everything else in life. "Is that all there is?" seems to sum up the feelings of this stage. There is a shift in emphasis at this point from meeting the needs of others to meeting one's own needs. For the religious formed in an other-oriented tradition this shift in emphasis can often be accompanied by feelings of guilt and loss of self-esteem as he or she senses that the fervor which marked the early days of religious life has diminished, Edelwich~ calls his third stage that of frustration. It is at this point that one tends to question not merely one's own effectiveness in the ministry but the value of religious life and ministry itself. Frequently emotional, physical and behavioral problems emerge at this stage. The fourth stage, that of apathy, sets in when a person is chronically frustrated. Apathy as such is a typical defense mechanism that occurs after repeated frustra-tion and is analogous to the learned-helplessness phenomenon mentioned earlier. At this point no new challenges are undertaken and one seems to "go through the motions," doing the minimum required to avoid censure. The stage of intervention is defined as whatever is done in response to or in anticipation of the four preceding stages. Intervention attempts to break the cyc!e. It may involve a restructuring of relationships to clients, family, friends and com-munity. It may mean seeking advanced training and new areas of apostolic work. It may, in some instances, mean leaving the ministry and religious life altogether. The Special Problems of Women Religious The antecedents of burnout and tedium mentioned here apply equally well to both male and female religious. The literature has noted, however, that profes-sional women bear a special burden not shared by men. For example, the conflict between career and home demands is more sharply delineated for a woman who, in the effort to balance both, may seek to become a "Superwoman." This sort of role conflict would also appear to be more keenly felt by women religious than by men. Communities of women seem to place more stress on creating a homelike atmosphere in which there is a fairly high level of mutual interaction and group activity. While such a structure has the potential for providing a great deal of warmth and support, the time needed to foster and maintain these community relationships may cause tension if community activities are seen as competing with the demands of one's ministry. Another major contribution to the burnout of women is sexism. As Edelwich~-' ~qbid. p. 29. Tedium and Burnout in Religious 13fe / ~4~3 notes, in the business and professional world large numbers of women are employed in positions of structured inferiority. Sexual stereotyping influences job assignments, allocation of responsibilities and standards of conduct. Sexual polar-ization commonly reinforces polarization by rank and status. This same pattern of sexual discrimination is found within the Church. The hierarchical structure is male dominated and its influence pervades the entire area of religious life and ministry. There is no need even to enter upon a discussion of ordination of women. Think at a more everyday level of the small put-downs, the questions regarding competence, the paternalism that is found all too frequently. How often does "the pastor" win his point by sheer weight of authority rather than by the merits of the case? How many male religious are comfortable dealing with attractive, educated women as peers? How often has a sister's name been reduced to a diminutive form ¯. in jest, of course? How does the treatment afforded male and female faculty members compare--or differ? Needless to say, the additional burden of dealing with one's femaleness takes its toll, for if a woman is sensitive, the professional struggles can be more frustrating. If she is empathic, the suffering she encounters is felt more sharply. If she knew herself as a caring person and a dedicated religious, recognition that she is no longer moved by the needs of others is more crushing. Coping Strategies Once aware of the potential for the development 6f tedium and burnout, what coping strategies can be introduced? This selection will attempt to present coping mechanisms at three levels:, the organizational, the interpersonal, and the intrapersonal. At the organizational level one can seek to reduce tedium and burnout by reducing the overload, making alternative forms of service available to the reli-gious, and by limiting the hours of stressful work. Community-based pre-retirement programs have already begun to make use of these concepts. By extending them to a broader range of personnel, severe forms of burnout may be prevented or at least reduced. Training, of course, is essential, not merely the initial formal education that would prepare the religious for his or her chosen field but continuing education where the !~eligious is given an opportunity to examine the pressures of the ministry, clarify goals and priorities, consider coping mechanisms and develop new skills. In the initial phases of formation training, the interventions appropriate to the stage of idealistic enthusiasm~3 should be taught. Novices or professed in temporary vows should be made aware of the discrepancy between expectations and reality and learn to moderate their enthusiasms before they become bogged down in the stage of stagnation. During this phase of formation the young religious should be taught to examine their motives for entering on ~21bid. p. 18. ~-~lbid. pp. 212-220. 3116/ Review for Religious, May-June, 1982 certain modes of ministry. The need to be needed is a powerful one as is the need to exert control, a motive that one tends to find if one scratches the surface of altruism. With awareness of their own motives religious can use their emotional investment in the ministry as the basis for insight rather than an acting out of their own needs at the expense of those they set out to serve. In an effort to avoid or at least reduce tedium and burnout, thought should also be given to providing positive work conditions that are suited to the needs of the individual and to assisting the religious to gain a sense of work significance. To achieve this end, as far as possible set clear organizationa| objectives, provide feedback and give the individual appreciation for his or her efforts and accomplishments. On the interpersonal level the development of social support systems is essen-tial. Although the conflicting or ambiguous demands of various systems can lead to burnout, on the whole the efficient and creative use of a social support system is one of ttie most effective ways of coping with the burnout syndrome. Social support systems may be defined as lasting interpersonal ties to groups of people who can be counted on to provide emotional sustenance, assistance, and resources in periods of need and stress, who provide feedback, both positive and negative, and who share standards and values. Ideally, one would belong to several supportive groups: community, family, work, recreational, and avocational. William Glasser~4 in his book, Reality Ther-apy, speaks of the dangers of the "small world." In such a situation, one group, for example, the community or work group, becomes the center of one's entire life and the source of all one's emotional and psychological support. Pines and Aronson~5 list six functions of a social support system, namely: listening, technical support, technical challenge, emotional support, emotional challenge, and the providing of social reality. Rather than expect that'one person or one set of people meet each of these needs, it is helpful to the religious to differentiate the support functions one can get from a given source and seek fulfillment of other needs from other groups. Not to do so places a tremendous burdbn on the sole source of support and leads to disappointment and anger when one's needs are not met. A number of coping strategies that would serve to reduce the likelihood of burnout are open to the individual religious. Among the variables that reduce the severity of burnout are learning, meaning and significance, success and achieve-ment, and variety.~6 Learning and understanding and a healthy curiosity are basic motivators. In the stage of stagnation new learning can open the door to new aspects of one's work and prevent the sort of burnout that accompanies one's perception of being at a dead end. Learning need not involve formal instruction; an attitude of open- V~Glasser, W., Reality Therapy. New York: Harper Colophon Books, 1975, p. 30. ~SPines. A. M., and Aronson, E., op. cir., p. 124." ~Pines, A. M., and Aronson. E., ibid., pp. 143-144. Tedium and Burnout in l~eligious Ltfe/ 347 n~ss to new experience can serve to keep one interested and alert. ~, Finding or creating meaning and significance in one's work and life is essential. Without these ingredients one becomes apathetic, alienated from oneself and others. Viktor Franklt7 recognized this and incorporated the struggle of the mature person to find, meaning in life into his work Man's Search For Meaning. "Nothing succeeds like success" goes the old maxim and nothing can eliminate burnout more effectively than the acknowledgment of one's achievements. Reli-gious, perhaps more than others, need to learn to acknowledge and enjoy their own successes before pushing on to new challenges. Certainly the drive for success can be self-destructive if one becomes obsessed with competing and pushes for "success" in the absence of other rewards. Nevertheless the religious needs to learn to define areas of accomplishment in which he/she can take justifiable pride. Monotonous activities lead to tedium whether they be found in a work or a non-work situation. A sense of variety and interest, on the other hand, originating largely with the person can susiain one in the ministerial field. Variety need not be a matter of outside stimulation, although that is certainly useful, but can be achieved by an openness to the uniqueness of the people with whom one works or whom one serves. Other ways of seeking variety include job changes within one's field or more total changes that involve seeking a new path. The career changes taking place more and more often at mid-life reflect this desire for variety. One coping mechanism mentioned by Pines and Aronson~8 was the develop-ment of an attitude of detached concern, which they defined as a stance in which the empathic professional (or religious) is sufficiently detached or objective in his attitudes toward the client to exercise sound judgment and keep his/her equanim-ity, yet also have enough concern for the client to give sensitive, understanding service. To attempt such a stance requires a delicate sense of balance. It is a process phenomenon, not a static entity that once achieved is dever lost. The religious needs to discern the level of emotional involvement proper for each person/situa-tion he or she encounters, avoiding a draining, ineffectual overinvolvement on the one hand and a clinical coldness that dehumanizes on the other. Compartmentalization~ is another way suggested by Pines and Aronson~9 to keep a balance between energy invested in the work sphere and the energy invested in life outside of work. This is one area that may prove problematic as there are still many community situations in 'which the religious both work and live together. Situations such as these tend to foster the creation of the "small world" mentioned earlier, and negative feelings generated in one sphere tend to carry over into the other. Newer community structures have attempted to alleviate these difficulties by establishing residences that are not identified with one particular ~TFrankl, V. Man's Search.for Meaning. Boston: Beacon Press. 1963. ~Pines. A. M. and Aronson, E., op. cir., pp. 54-55. ¯ ~91bid., p. 164. ~1411 / Review for Religious, May-June, 1982 form of ministry. The residents work at a variety of jobs and in'several differe~at locations and "come home" when their workday is ended. While no single living arrangement is perfect, one such as this does provide the individual religious with an opportunity to separate work demands from other aspects of his/her life. Perhaps the most important of the coping mechanisms open to the individual religious is that of "being good to oneself" or "doing to oneself as you have done to your client." Committed religious tend to burn out because they take on too much for too long and with too much intensity. To reduce the likelihood of burnout one needs an awareness of work stresses and a recognition of the danger signs. One also needs to acknowledge areas of vulnerability and put reasonable limits on one's work for there will always be more that could be done. in addition, one needs to set realistic goals, both long-term and short-term, and be willing to provide for one's own needs, treating oneself as a person with legitimate needs, taking time for prayer and pleasure and nourishing oneself so that there will be strength available to continue the service to which one is called, that with St. Paul one can state: ". my life is already being poured away as a libation . 1 have fought the good fight, 1 have run the race to the finish, I have kept the faith" (2 Tm 4:6-7). Weeping may endure for a night but joy cometh in the morning Ps 30:5. Morning Cometh A Quotella Weeping that weeps me far away May bring the night and end the day. Endure: For the human heart is a finite flask, A bottle whose meager store of tears Night and pain may cause to flow. But even as the last tear falls Joy, as the light, lifts my heart and so, Cometh the dawn. In balance must all things lie. The source of nighttime tears allow Morning to come at last somehow. C. Dell Turney 4108 Little Fairfield Eureka, CA 95501 Prayer As an Act of Justice Mary Lou Theisen, 1. H. M. Since September, Sister Mary Lou has been involved in the Active Spirituality program, located in Seton Hall of Mount St. Joseph College, Mount St. Joseph, OH 45051. This is what Yahweh asks of you: only this, to act justly. to love tenderly. to walk humbly with your God (Mi 6:8). In this simple statement uttered through the mouth of the prophet Micah, God reveals to us for all times the essence of religion. Religion, in the purity of its meaning, is not an ethic nor a multiplication of actions, but a way of life--an integral act lived out in the intggrity of one's being. In this single act there is no dichotomy between acting justly, loving tenderly or walking humbly before God: one element flows from and feeds into the others, finding its true mehning only in conjunction with them. The purpose of this article is to show how true prayer (walking humbly with God), entered into in the integrity of our being, not only leads to actions of justice, but is in itself an act of justice. In his Dictionary of the Bible,~ John McKenzie points out that the Hebrew word sedek, which we translate as justice, is a very complex term embracing the concepts of judgment and righteousness. It is sometimes translated as integrity and implies a right balance born of fidelity to the truth of what something or someone is supposed to be. To be just or to act justly in the biblical sense, therefore, is first of all to be judged righteous or to be justified by God. To seek justice is to seek salvation or justification in truth. To seek justice is to seek God. To act justly is to tMcKenzie, John L., Dictionary of the Btble (Milwaukee: Bruce Publishing CO. 1965). 349 351~ / Review for Religious, May-June, 1982 act out of the truth of who we and others are in the authenticity of our being. This truth is discovered ~nd entered into in times of solitude, in times of walking humbly with God, when we are unable to hide behind our actions, our words, or any of the multiple walls we so often build around our true self. It is in solitude that we are forced to come face to face with our sinfulness and inability to save ourself. In solitude we also experience God's willingness to forgive, his power and desire to save (justify) us and all people. Let us reflect for a while on Jesus, to see this reality present in his prayer/life. In Hebrews 5:7-9 we read: During his life on earth, he offered up prayer and entreaty, aloud and in silent tears to the one who alone had the power to save him from death, and he submitted so humbly that his prayer was heard. Although he ~vas son. he learned obedience through suffering: but having been made perfect, he became for all who obey him the source of eternal salvation and was acclaimed by God with the title of high priest of the order of Melchizedek. St. Paul is here indicating that it was du.ring his time spent in intimate com-munion with his Father, in the solitude of the desert or on the hilltop, that Jesus came to realize and to accept who he was, to realize and to accept his call as the Messiah, the "Beloved Son," with all that this call meant for himself and for others. During these times of reflecting on what was happening in his own life in the light of the words of the prophets and psalms, Jesus came to the truth of his human condition as one destined for misunderstanding, betrayal, suffering, and a death from which he was unable to save himself: This is what I meant when I said, while 1 was still with you, that everything written about me in the law of Moses. in the prophets and in the Psalms has to be fulfilled. He then opened their minds to understand the Scriptures and he said to them: So you see hoffit was written that the Christ would suffer and on the third day rise from the dead (Lk 24:44-47). More importantly, however, through his own reflections on Scripture, Jesus came to know and to trust in the truth of God's faithfulness which alone could and would justify him, and through him, all people: But now. thus says Yahweh: Do not be afraid, for I have redeemed you: 1 have called you by your name. you are mine. Should you pass through the sea. 1 will be with you, or through rivers, they will not swallow you up. Should you walk through fire, you will not be scorched and the flames will not burn you. For 1 am Yahweh. your God, the Holy One of Israel, your Savior (Is 43: I-3). He said to me, You are my servant in whom I shall be glorified: while I was thinking, I have toiled in vain, I have exhausted myself for nothing: and all the while my cause was with Yahweh. my God was my strength. And now Yahweh has spoken, he who formed me to be his servant, to bring Jacob back to him. to gather Israel to him (Is 49:3-5). This inner realization of who he was in truth and of the power of God's faithfulness working in and through him formed Jesus as an authentic person of justice, both in the biblical sense of one who receives his justification from God, and in practice. Being convinced in the core of his being that it was his Father's love and faithfulness which saved and justified him, Jesus could only act justly Prayer as an Act of Justice / 35"1 toward others for he knew that this gift of God's saving love was not meant for him alone: It is not enough for you to be my servant. 1 will make you the light of nations so my salvation may reach the ends of the earth (Is 50:6). I. Yahweh. have called you to serve the cause of right: I have taken you by the hand and formed you: I have appointed you as covenant of the people and light of the nations, to open the eyes of the blind, to free captives from prison and those who walk in darkness from the dungeon (Is 42:6-7). As Donald Senior states so well in his insightful book Jesus--a Gospel Por-trait2 (p. 138): "From his intimate life of prayer with his Father and from a powerful searching of Scriptures, Jesus had forged the basic convictions that animated his life and ministry. Basic convictions about God as loving Father and about love as fundamental bond of human relationships were joined to an unshakable integrity that translated principle into action.~ The gospels tell us that this action at times took the form of speaking out against the social injustices of his day. He especially denounced the so-called religious leaders, not as much for their smugness and legalistic interpretation of religion as for their inability to recognize God as a God of love and their own lack of love and compassion: "But alas for you pharisees! You who pay your tithe of mint and rue and all sorts of garden herbs and overlook justice and the love of God" (Lk i 1:42). Jesus' conviction, born of his own reflection on Scripture and his own expe-rience, that God was a God of love whose love and salvation was gratuitously given to all--the just and the unjust, the clean and the unclean, the poor and the rich, the sinners and the outcasts as well as the good and self-righteous--led him not only to denounce the systemic injustices of his time, but more especially to live out of his conviction in his own daily encounters with others. He associated with the sinners, the outcasts, the sick, the poor, as well as with the rich and the righteous, showing by his very presence to them his acceptance and respect of them as individuals. By his gentleness, love and compassion for each one he offered them the experience of God's liberating and compassionate love for them, while always respecting their own integrity as persons and never forcing his vision on them (e.g., the rich you'ng man). It was precisely this attitude of Jesus toward others, his acceptance of sinner and righteous alike, which was the greatest affront to the religious leaders of his day for it contradicted their notion of religion: that one was saved by his own actions, by his minute observance of the law. Consequently, opposition toward Jesus and his teachings grew among the leaders. Jesus, well aware of this increas-ing hostility, was compelled to rely more and more on his Father's faithfulness to save him: Now my soul is troubled. What shall I say: Father. save me from this hour? But it was for this :Senior. Donald, C.P. Jesus, a Gospel Portrait (Dayton: Pflaum. 1975). 359 / Review for Religious, May-June 1982 very reason that I have come to this hour. Father, glorify your name (Jn 12:27-28)! Jesus' human struggle to accept his salvation from God and not from his own actions reached its peak in the garden when he pi'ayed in agony, "Father, if it is possible let this chalice pass. Nevertheless, let your will be done, not mine." This total surrender of his person to God's saving plan for him brought Jesus then to his ultimate moment of prayer--his death on the cross. At the moment of death, when, we are told, one's entire life passes before one's eyes and the dying person often speaks a.word which expresses not only what is being experienced at that moment, but which somehow summarizes an entire lifetime, it was not surprising that Jesus spoke from his heart the opening words of Psalm 22. This psalm, which must have been one on which Jesus meditated often during his life and especially at the end when he knew his death was imminent, truly summarizes his life and death experiences. Although spoken in a moment of extreme agony and intense feeling of being abandoned by God, the psalm is not one of despair, but one of ultimate trust in God's power and willingness to save him as his ancestors who had trusted in God had been saved: Yet. Holy One. you who make your home in the praises of Israel. in you our fathers put their trust. they trusted and you rescued them: they called to you for help and they were saved. they never trusted you in vaifi (3-5). It is a psalm of praise to the God who is already saving him in spite of all the evidence to the contrary: Do not stand aside, Yahweh. O my strength, come quickly to my help . Then I will proclaim your name to my brothers, praise you in the full assembly: you who fear Yahweh. praise him! Entire race of Jacob, glorify him! Entire race of Israel, revere him! For he has not despised or disdained the poor man in his poverty, has not hidden his face from him, but has answered him when he called ( 19, 22-24). In this moment of abandonment to the mercy of God who is already saving him in his faithfulness, Jesus is very aware that the meaning of his life and death is not only for his own justification but for that of all peoples: You are the theme of my praise in the Great Assembly. I perform my vows in the presence of those Who ~ar him. The poor will receive as much as they want to eat. Those who seek Yahweh will praise him. Long life to their hearts. The whole earth from end to end. will remember Prayer as an Act of Justice / 353 and come back to Yahweh: All the families of the nations will bow down before him. For Yahweh reigns, the ruler of nations! Before him all the prosperous of the earth will bow down, And my soul will live for him. my children will serve him: Men will proclaim the Lord to generations still to come, His righteousness (justice, salvation) to a people yet unborn. All this he has done (25-31)! Thus Jesus' greatest act of justice in the biblical, as well as the practical, sense occurred at the moment of his death. In that very act of surrender of all that he was to God's saving plan for him, he became justified himself and by that same act won justification for all peoples: Altho.ugh he was son, he learnt to obey through suffering, but having been made perfect, he became for all who obey him the source of eternal salvation (Heb 5:8-9). ¯. in whom, through his blood, we gain our freedom, the forgiveness of our sins (Ep 1:7). What does this reflection on the prayer/life of Jesus have to say to us today as we strive to live an integrated life of prayer and justice? It means, first of all, that like Jesus we must learn to seek our own justification and that of others from God and not from our own actions, and to trust in his faithfulness to save us. Like Jesus, we must take time apart to reflect on our !ife in the light of Scripture and learn who we truly are and to what we have been called. In these times of quiet aloneness with God we will come to know ourselves in all of our weakness, sinfulness, and inability to save ourselves or anyone else. But, more importantly, we will also come to know who God is and in this light to know our true self as one already loved, forgiven, called and empowered by God through the blood of Jesus. As with Jesus, this inner conviction of who we are in truth and of the power of God's faithfulness working in and through us will form us as authentic persons of justici~ in the core of our being. Convinced of God's love and faithfulness which has already justified us by gratuitously forgiving our sinfulness in the blood of Jesus, we will be moved to act justly toward others. As with Jesus, this conviction will at times take the form of speaking out against the injustices of our day, of working to bring about a more just social order, and of supporting others who do this. In our daily life, it will affect ourattitude toward others, moving us to accept and affirm the integrity of each individual we encounter, for each has already been loved, forgiven and called to salvation by God. What greater act. of justice can we extend to another than to allow that person the space to discover and act out of his/her own authenticity as Jesus did with those he encountered', instead of forcing our vision on that person? Animated with the Spirit of Jesus we will, then, become."doers" of justice, of liberation in our world, each according to the call experienced in his/her honest encounter with God in prayer. However, like Jesus, in this very act of prayer itself, we will have .already entered into an act of justice. In coming before God in prayer we are acknowledg-ing our own inability~to save burselves and our need to be justified by God. In the 354 / Review for Religious, May-June, 1982 act of surrendering ourselves in openness to God's power to save us, we enter into the death of Jesus, crying out as he did from our own emptiness for God's saving opresence in our life, while at the same time gratefully accepting the justification we have already received through God's faithftilness to Jesus on the cross. Since through our baptism, as St. Paul tells us, we have been baptized into this death of Jesus, our prayers of surrender, of praise, of trust and gratitude, our prayers for mercy--entered into in the integrity of who we are and of who God is--are an integral part of the prayer of Jesus on the cross. Our prayers are the prayers of the Just One who came to bring justice and truth to all people, and who continues to do so in and through each person who accepts salvation from God. The greatest articulation of this prayer is, of course, the Eucharist. Here we actually participate, with gratitude (Eucharist--thanksgiving), in the eternal act of justification won by Jesus on the cross and reenacted each day "for the glory of God's name, for our own good and for the good of all the world." Moreover, because this death of Jesus into which we have been baptized was for the justification of all people for all time, every prayer of a baptized person affects the whole world for it can never be said in isolation. "A final thing that needs to be said about prayer is that it is always corporate. We often distinguish between private and public prayer, and to an extent this distinction is valid. But whether private or public, Christian prayer is always common, communal, corpo-rate. All Christian prayer is to our Father. in prayer we are united with our brothers and sisters, whether we are alone in our closet or together in our com-munity: we are united to the whole church. The prayer of the community is not a collection of individual prayers: it is common prayer out of our common plight to our common Lord in our common hope. We pray as part of the communion of saints, joining the whole people of God in all history and around the globe."3 Thus, as a person baptized into the death and resurrection of Jesus, and who has experienced in one's own life the love and saving power of God, the Christian is able to come before God in Jesus' name to offer to God in his/her own person all of the love and gratitude, the care, concern and work toward the establishment ¯ of the kingdom which is being experienced and lived out, knowingly or unknow-ingly, by every person in the world. As a person who experiences in one's own being sinfulness, selfishness, anger, frustration, fear and oppression of others, the baptized person can come before God as Jesus did on the cross, in behalf of the sinfulness of the world and cry out for mercy and forgiveness of sin for all people. As a person who experiences, even in times of prayer itself, emptiness, a search for meaning, boredom, ignorance, a feeling of rejection, a lack of faith and trust, the Christian can unite his/her own emptiness and need with the sufferings, the hunger and search for love and meaning, which exist among all people and, with them, accept his/her human condition and beg for salvation from God as Jesus did on 3Jen"nings. Theodore W., Jr., "Prayer, The Call for God." The Christian CentuG'. April 15, 1981, pp. 410-414. Prayer as an Act of Justice / 355 the cross. A baptized person can pray in this way, for in Jesus' Spirit we are all one before God. A call to pray in this posture is a call to be truly present in solidarity with all of humanity and all of creation which "still retains the hope of being freed, like us, from its slavery to decadence, to enjoy the same freedom and glory as the children of God" (Rm 8:21). It is a call to become one with the joys, sorrows, struggles and sufferings of all people and to accept in faith the saving love of God, "our freedom, the forgiveness of our sins" (Ep 1:7), so as to constantly offer to God the thanksgiv-ing and praise due him in justice. A call to stand before God in this manner of prayer in the authenticity of one's being is then, in a very real sense, an act of justice on behalf of the whole world, for it is a sharing in the surrendering love of Jesus. who throughout his life and especially in his death accepted his justification and that of all people from God who alone can save us from death and bring us into the kingdom of truth and justice. An Apostolic Spirituality for the Ministry of Social Justice by Max Oliva, S.J. Price: $.50 per copy, plu~ postage. Address: Review for Religious Rm 428 3601 Lindell Blvd. St. Louis, Missouri 63108 St. Ambrose's Theology of the Consecrated Virgin George E. Saint-Laurent Doctor Saint-Laurent, of the Department ~f Religious Studies at California State University (Fuller-ton). presented the content of this article as a paper to the American Academy of Religion. He may be addressed at the university. Fullerton. CA 92634. Occasionally we may observe that an individual was ahead of his or her time. More often we are scandalized that an earlier generation could have been so deaf to its prophets and so blind to its evils. The history of Christian thought discloses at least two persistent phenomena which have accompanied its dialectical development. First, when we human beings confront a dipolar aspect of the Christian mys-tery, we are almost irresistibly tempted to assume an either/or stance and opt for one extreme to the neglect of the other. We find it difficult to bear a truth which cannot be pressed into our neat categories but finds itself in a creative tension between two poles. And yet it is invariably in that delicate both/and position that Christian "catholicism" or "orthodoxy" has discovered its authentic home: both the divine and the human in both Christ and the Church, with full attention both to grace and to nature, both to faith and to reason, both to spirit and to matter. Second, since our very existence is historical, contextual, and societal, we human beings are predictably limited and conditioned by the foreshortened hori-zons of our own cultural world. As we attempt to interpret our experience in terms of Christ and make it intelligible, we find our perceptions to be prejudicial in their foci and linguistically determined in their expression. And yet the Christian believes that Christ, the subject of his or her faith, is uniquely and eternally one. We who come later can only sympathize with the giants of Christian antiquity, who, being human~ were incapable.of seeing every facet of the total Christian commitment in undistorted vision. Every Cho~stian (hinke,r risks the occupational St. Ambrose's Theology of the Virgin / 357 hazards of his enterprise: the unconscious bias, the unintentional obscurantism, the unnoticed dislocation of values, the quite innocent use of outrageously sexist, racist, or bigoted language, the accidental imbalance which is far more indebted to his or her concrete situation in this place at this time in the face of this crisis than it is to the actual data of Revelation. The purpose of this essay, is to investigate St. Ambrose's~ theglogy of the consecrated virgin, insofar as it emerges from his liturgical hymns and sermons. It is a view remarkably balanced and far less a victim of negative historical condition-ing than the portraits of his contemporaries 'in the Western Church. His was an era when Platonism, with its flight of the soul from the body, and Manichaeism, with its rejection of the human body and its sexuality as evil, were still significant intellectual currents, predisposing Christians to opt for spirit over (rather than with) matter. No less than a Jerome2 could exceed all bounds of good taste and propriety in his zealous promotion of virginity at the expense of female sexuality, marriage, and motherhood: No less than an Augustine3 could be so haunted by his own sexual confusion that he could grudgingly accept sex within marriage only if procreation were both physically possible and explicitly intended. Yet Ambrose, bishop of Mila'n, was able to nurture the highest esteem for consecrated virginity without denigrating the human body, disparaging females, or detracting from the goodness of Christian marriage.4 Unlike the vitriolic Jerome, torn as he was between a melancholic misogynism and an irrepressible delight in feminine companionship, Ambrose was able to insert into the Christian tradition a more humanistic appreciation of woman and her role. Unlike the self-alienated Augustine, torn as he was between an admira-tion for his mother Monica and a theological pessimism compounded by personal tragedy in his own sexual history, Ambrose was able to pass on a more integral and positive perspective. G. Tavard 'writes: "Ambrose was not only an enthusiastic promoter of the virginal life; he had also put forward what may well constitute the only profound theology of womanhood in the Latin world.~ ~For a life of St. Ambrose, see F. H. Dudden, The Ltfe and Times of St. Ambrose. 2 Vols. (Oxford: 1935): and A. Paredi, St. Ambrose: His L~fe and 7~mes. Tr. M. Costelloe (Notre Dame: 1964). 2On St. Jerome, see F: Murphy, Ed., A Monument to Saint Jerome (New York: 1952); and D. Wiesen, St. Jerome as a Satyrist (Ithaca: 1964). 3The literature on St. Augustine is vast. See, for instance, P. Brown, Augustine of Hippo (Berkeley: 1967); and G. Bonner, St. Augustine of Hippo: L~fe and Controversies (New York: 1963). 4This subject has been much studied in recent years. See, for example, R. Ruether, "Mothers of the Church: Ascetic Women in the Late Patristic Age," Women of Spirit: Female Leadership in the Jewish and Christian Traditions. Ed. R. Ruether and E. McLaughlin (New York: 1979) 72-98: and eadem, "Virginal Feminism in the Fathers of the Church." Religion and Sexism, Ed. R. Ruether (New York: 1974) pp. 150-183: M, Maxey, "Beyond Eve and Mary," Religion for a New Generation. 2d Ed., Ed. J. Needleman, et al. (New York: 1977) 264-277: D. Carmody, Women and Worm Religions (Nashville: 1979) 113-123: E. Clark and H. Richardson, Ed., Women and Religion: A Feminist Sourcebook of Christian Thought (New York: 1977), pp. 53-77. 5Tavard, Women in the Christian Tradition (Notre Dame: 1973), p. I00. 358 / Review for Religious, May-June, 1982 It is important to realize just how critical the fourth century was in Church history. It was a period of transition from the. status of a despised and proscribed minority to that of a state religion professed and promoted by the Emperor himself and by most of his s.ubjects. During the era of persecution, only persons of heroic courage, high moral aspirations, and deep faith had been willing to embrace Christianity with its concomitant risk to life and property. Now, however, it had become a distinct advantage socially, economically, and politically to convert, and masses of "average" human beings sought admission. The inevitable consequence was a cooling of fervor, with a compromised commitment to the full implications of the Gospel. ~ in order to forestall unworthy "conversions," the Church instituted a lengthy catechumenate for testing and training candidates before their baptism at the Easter Vigil. In order to preserve her credibility as "The Holy Church," the author-ities created an even more exhaustive and lengthy system of "canonical penance" for the rehabilitation of public sinners who repented. But there was also a more private and individual response in the extraordinary development of asceticism. Previously it had been the martyrs who had constituted the ideal of Christian perfection. Because of their bloody sacrifice, they had been idealized as the perfect disciples who had mystically died in the Lord and could therd'ore anticipate a glorious resurrection in the same Lord. Now it had become the ascetics who achieved a "white" or spiritual martyrdom by their lives of seclusion, self-discipline, and consecrated celibacy. Women as well as men pursued the new ideal. One could retreat into the wilderness (either literally or figu.ratively), and, far from the scandalous vanity and corruption of urban life, die to oneself daily through prayer, fasts, vigils, and the consecration of one's personhood in celibacy. There were the eremitical and semi-eremiticai structures of Anthony as well as the fully cenobitical communities of Pachomius, Eustathios, and Basil the Great.6 There was the growing pressure upon priests to live celibately.7 And there were the convents for women associated with the names of Paula, Eustochium, the Melanias, and Macrina.8 On the other hand, some cohsecrated virgins simply lived privately with their parents or in their own homes or even in the homes of clergymen, although the latter practice was continuously deplored and condemned by ecclesiastical authori-ties. 9 The celebrated sister of Ambrose, Marcellina, for instance, lived with her 6See D. Chitty, The Desert a Ot)' (Oxford: 1960): C. Frazee, "Anatolian Asceticism in the Fourth Century: Eustathios of Sebastea and Basil of Caesarea," The Catholic Historical Review66(1980), pp. 16-33; G. Saint-Laurent, "St. Basil of Caesarea and the Rule of St. Benedict," Diakonia 16 (1981), pp. 71-79. 7See C. Frazee, "The Origins of Clerical Celibacy in the Western Church. Church Histor.v 41 (1972). pp. 149-167. 8See, for example, Gregory of Nyssa, Life of St. Macrina, Ed. V. Callahan. Vol, 8 in W. Jaeger (Ed.), Works (Leiden: 1952). 9See D. Bailey, The Man-Woman Relation in Christian Thought (London: 1959), p. 33. St. Ambrose's Theology of the Virgin / 359 mother and a companion in Rome. Since no convents appear to have been available at Milan, the virgins in Ambrose's care must have resided with their parents. Ambrose himself implies that the native Milanese virgins were relatively few in number, whereas young women came to Milan from Piacenza, Bologna, i~nd Mauritania to celebrate the-rite of consecration. A maiden would solemnly vow her chastity as a bride of Christ in the church before a bishop, with a ritual closely paralleling that of earthly marriage. Accord-ing to Roman custom, a bride was to wear the stola (a long outer garment), receive a fiery-coloredflammeum (her bridal veil) from the priest, and vow her fidelity to h~r bridegroom in the presence of witnesses. A virgin enteri.ng into mystical espousal with Christ also wore a stola and received the flammeum Christi to betoken her new state of life, but both were of somber color. She also pronounced her vow before witnesses, who in her case were the whole community publicly assembled to voice their approving "Amen." We do not know the actual formula of consecration invoked within the Mila-nese liturgy, but we may suppose that it would closely resemble the long preface of consecration to be found in the Gelasian Sacramentary, whose provenance is from Rome about a century later.~° Drawing upon several incidental references in the writings of Ambrose and others, F. H. Dudden reconstructs the general shape of the ceremony thus:' The congregation, at which the bishop himself was the officiating minister, was solemnized with much pomp on one of the great festivals--in the case of Marcellina on the Feast of Epiphany: more usually, however, at Easter, when it was attended by the newly baptized wearing their white robes and carrying lighted tapers. The bishop delivered an address to the' virgin, and offered a solemn prayer. The girl then publicly pledged herself to a life of chastity. Next the bishop took the veil, which had been lying on the altar, and placed it over her head, with the words, q wish to present you as a chastg virgin to Christ.' A benediction was then recited, to which the congregation responded 'Amen." At some point in the service Psalm xlv was chan!ed, and possibly some hymns in praise of virginity were sung." By virtue of her consecration, the "bride of Christ" became a special responsi-bility of her bishop, who was required to visit her regularly, open the Scriptures to her, and impart instructions to her about her duties of state. Although she was separated from the other women in the asseinbly by a screen, she was still believed to,possess a place of honor. Women would sometimes draw near to the enclosure in order to request the kiss of peace from consecrated virgins. As bishop of Milan, Ambrose fulfilled many roles which proved decisive for the later history of the Western Church. Defender of Nicene orthodoxy, champion of the Church's freedom from imperial control, channel of eastern theology to the ~0See I. Mohlberg. Ed. Liber Sacramentorum Romanae Aeclesiae Ordinis Anni Circufi (Sacramenta-rium Gelasianum). Rerum Ecclesiasticarum Documenta Series Major. Fontes IV (Rome: 1960). pp. 124-128. On the consecration of virgins, see P. Camelot. "Virginity." New Catholic Encyclopedia 14 (1967). pp. 702-703. ~tDudden. op. cir. p. 151. ~0 / Review for Religious, May-June, 1982 Latin world,!2 creator and reformer of public worship,Is spiritual father of the great Augustine: Ambrose was all of these and much more as one of the Four Great Latin Fathers.14 But the special object of Ambrose's pastoral concern throughout his years of episcopal service was the consecrated life. Ambrose has been called "The Father of Latin Hymnody.''1S Of the nineteen liturgical hymns which may be ascribed to him with greater or less certitude, five are directly pertinent to our subject, while a sixth holds.indirect interest. Since it is primarily through the sacred liturgy that Catholic and Orthodox Christians have always appropriated their beliefs and values, we may very well be confronting here effectual channels of Ambrosian thought far more significant on the popular level than any discourse could ever have been. Our first three hymns extol Mary, the Mother of Jesus, as the perpetually virginal woman who was nonetheless made marvelously fruitful by the interven-tion of God. A fourth hymn glorifies a popular virgin martyr. A fifth hymn praises Christ, the Spouse of virgins. Finally, our sixth hymn expresses the fundamental spirituality of the consecrated women. Ambrose is remembered as an enthusiastic admirer of the Blessed' Virgin, and he holds a preeminent place in the development of Mariolggy. In lain surgit hora tertia,16 a hymn composed for the liturgical hour of Terce, our poet recalls how Christ entrusted his mother to the Apostle John. The strophes pertinent to our investigation, together with this writer's English translation, are as follows: celso triumphi uertice matri Ioquebatur suae: en f!lius, mater, tuus, apostole, en mater tua. praetenta nuptae foedera alto docens mysterio, ne uirginis partus sacer matris pudorem laederet. From lofty pillar of triumph ¯ He was speaking to his mother: Mother, behold thy son, Apostle. behold thy. mother. Covenants of marriage pretended Taught he with deep mystery, Lest the sacred bearing of a virgin Cast hurt upon a mother's honor. The hymn Intende, qui regis Israel17 was intended "for the Christmas liturgy, and it was an ideal opportunity for Ambrose to blend two of his favorite themes: the glories of the Word Incarnate and the wonders of Christ's virginal conception and birth through Mary. Jesus and Mary are praised together from the second stanza through the fifth. The text, together with this writer's translation, follows: ~2See Saint-Laurent, "St. Ambrose and the Eastern Fathers," Diakonia 15 (1980), pp. 23-31. t3See idem. "St. Ambrose as Channel of Eastern Liturgical Customs to the West," Diakonia 13 (1978), pp. 101-110. t4Together with Jerome, Augustine, and Gregory the Great. tSFor example, see M. McGuire, "Ambrose. St.," New Catholic Encyclopedia I (1967). p. 375; R. Trench, Sacred Latin Poetry (London: 1874), pp. 87-88: F. Raby, A Histoo, of Christian Latin Poetry 2d. Ed. (Oxford: 1953). pp. 32-36. ~rFor a critical text, see W. Bulst, Ed., Hymni latiniantiquissimi." LXXV Psalmi II (Heidelberg: 1956), p. 41. ~TFor a ~ritical text, see ibid., p. 43. St. Ambrose's Theology of the Virgin / 361 uenL redemptor gentium. ostende partum uirginis, miretur omne saeculum, tails decet partus deo. non ex uirili semine, sed mystico spiramine uerbum dei faetum est earo fructusque uentris floruit. aluus tumescit uirginis, claustrum pudoris permanet, uexilla uirtutum micam, uersatur in templo deus, proeedat e thalamo suoo pudoris aula regia, geminae gigans substantiae, ¯ alacris oecurrat uiam. Come, redeemer of the nations, Demonstrate a virgin's bearing, Let all the world be moved with wonder, So great a bearing befits our God. Not from human instigation, But from mystic inspiration Word of God did flesh become And fruit of womb did flower. Swollen grows a virgin's womb, Door of chastity remains, Virtues' beacons glitter forth, Engaged is God within his temple. ¯ Springs forth he from nuptial chamber, Royal palace of chaste modesty Giant of twofold nature he, Speedily runs he his course. The claustrum pudoris permanet of the fourth strophe is strikingly similar to phrases in Ambrose's De institutione virginis,~8 and expresses a doctrinal concern important to him: the virginity of Mary before, during, and after the birth of Jesus. Ambrose refers to the womb of Mary as aula regali uteri virginalis in that same work,!9 and g~es on to state: "Aula regialis is the virgin, who is subject not to man but to God alone." The hymn Inluminans altissimus2° is a hymn written for the observance of Epiphany, with its threefold orientation towards Jesus' baptism in the Jordan, his manifestation to the Magi, and his first miracle at Cana. Our immediate interest is focused upon the third stanza, the text of which follows, together with the present writer's translation: seu stella partum uirginis caelo micans signauerit et hoc adoratum die praesepe magos duxerit, A star shining from heaven Will have shown a virgin's giving birth And on this day will have led The Magi to adore the crib. Christ, "the most high Enlightener," has beenborn of a virgin, and so a radiant star in turn becomes a sign, bathing the crib in its light for the Magi to see. From the preceding three passages it is evident that Ambrose d~lights in dwelling upon Mary's perpetual, yet fruitful, virginity. Mary is the womanly model of the consecrated virgin par excellence, and her miraculous conception of Jesus by the power of. the Holy Spirit constitutes a quasi-paradigmatic event. The consecrated virgin, may approach the regal dignity of Mary through her own state of life, and so become spiritually in her own body a royal palace for God. The divine maternity is a privilege unique to Mary, of course, yet her self-donation to ~Ambrose. De institutione virginis 8.52 (PL 16.320). ~91bid. 12.79 (PL 16.324). 20For a critical text. see Bulst. op. cit. p. 45. 362 / Review for Religious, May-June 1982 God is imitable. Ambrose suggests that the Word can mystically enter into union with the consecrated Virgin for spiritual fruitfulness in the service of others. Our fourth hymn, Agnes beatae uirginis,2t was composed especially for a litur-gical celebration of the Feast of St. Agnes (January 21). It is effectively a poetic paraphrase of a sermon of Ambrose wherein he recounts the martyrdom, of this famous young maiden, a homily which he actually preached for that feast and which is found in his De virginibus.2~ The bishop's basic theme is praise for the valor of a maiden who willingly died as a witness to her faith in Christ. In the first stanza, Ambrose announces that it is the feastday of Agnes, who consecrated her virginity through martyrdom. In the second stanza, our author marvels'that such a child, too young for marriage, should nonetheless be suffi-ciently mature to give her life in testimony--and that at a time when even adults were wavering in the" face of persecution. In succeeding stanzas, Ambrose narrates the story which his audience knew so well. Agnes deliberately sought out martyr-dom, and presented herself as a bride about to meet her Heavenly Bridegroom, her mystic dowry being her very blood. When commanded to offer idolatrous wor-ship, she condemned the altar-fire and promise, d to exiinguish it with her blood. In concluding stanzas, our poet dwells upon Agnes' dignity upon the deathblow, as she drew her garments about herself in chaste modesty. The entire hymn is significant for our purpose, and so all eight'strophes, together with this writer's translation, are here reproduced: Agnes beatae uirginis natalis est, quo spiritum caelo refudit deb#um pio sacrata sanguine. matura maro,rio fuit matura nondum nuptiis, nutabat in uiris fides, cedebat e.ffessus senes. metu parentes territi claustrum pudoris auxeram soluit fores custodiae .tides teneri nescia. prodire quis nuptum putet, sic laeta uultu ducitur, nouas uiro.ferens opes dotata censu sanguinis. aras ~fandi numinis adolere taedis cogitur, respond#: baud tales faces sumpsere Christi uirgines. hic ignis extinguit fidem, Of the blessed virgin Agnes It is the bi~'thday, on which she Poured back her spirit owed to heaven ' Consecrated b~ her faithful blood. Mature was she for martyrdom ' Though for marriage not yet mature, Faith was faltering among men, Conceding old men to be weak. Terrified by fear her parents Had provided a prison of shame Faith dissolved the gates of custody Not knowing how to be,restrained. One might think her advancing to wed So~,joyful in countenance is she led Bringing new wealth to her bridegroom With dowry of her blood endowed. Altars of a devilish god by Tortures she is pressed to worship, Answers she: Not such fires Have Christ's virgins chosen. This flame blots out the faith, For a critical text, see ibid., p. 46. -'~Ambrose, De virginibus 1.25-29 (PI. 16.-189-190). ~ St. Ambrose's Theology of the Virgin / 363 haec flamma lumen eripit. hic hic ferite, ut profluo eruore restinguam focos. percussa quam pompam tulit ham ueste se Iolam lege?ls curare pudoris praestitit, ne quis retectam cerneret. in morte uiuebat pudor uultumque texerat manu, terram genu flexo petit lapsu uerecundo cadens. This fire extinguishes the light. Here destroy me, here, that with Spilt blood I may quench the flames. Struck down what splendor she showed For covering her total person She displayed her care for modesty Lest anyone should see her unclothed. In her death, chastity was living As with hand she veiled her face, With bent knee she besought the earth Falling forward with modest movement. Ambrose was resolutely incarnational, not only in his doctrinal convictions, but also in his pastoral instincts. For him, the cult of the martyrs--like the cult of the virgin--was but an obvious implicate of any sound and balanced Christology. Grace could transfigure the material, the earthy, and the human into a sacramental epiphany of the spiritual, the. heavenly, and the divine. It was inevitable that Ambrose shot~ld exploit the

Issue 41.4 of the Review for Religious, July/August 1982. ; REVIEW FOR RELIGIOUS (ISSN 0034-639X), published every two months, is edited in collaboration with the faculty members of the Department of Theological Studies of St. Louis University. The editorial offices are located at Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. REVIEW FOR RELIGIOUS is owned by the Missouri Province Educational Institute of the Society of Jesus, St. Louis, MO. © 1982 by REviEw FOR RELIGIOUS. Composed, printed and manufactured in, U.S.A. Second class postage paid at St. Louis, MO. Single copies: $2.50. Subscription U.S.A.: $9.00 a year; $17.00 for two years. Other countries: $10.00 a year; $19.00 for two years. For subscription orders or change of address, write: REVtEW FOR RELIGtOUS; P.O. Box 6070; Duluth, MN 55806. Daniel F. X. Meenan, S.J. Dolores Greeley, R.S.M. Daniel T. Costello, S.J. Joseph F. Gallen, S.J. Jean Read Editor Associate Editor Book Editor Questions and Answers Editor Assistant Editor July/August, 1982 Volume 41 Number 4 Manuscripts, books for review and correspondence with the editor should be sent to REVIF:W FOR RV:HG~OUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. Questions for answering should be sent to Joseph F. Gallen, S.J.; Jesuit Community; St. Joseph's University; City Avenue at 54th St.; Philadelphia, PA 19131. Back issues and reprints should be ordered from RF:VlF:W F'OR RF:IaG~OUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. "Out of print" issues and articles not published as reprints are available from University Microfilms International; 300 N. Zeeb Rd.; Ann Arbor, MI 48106. Familiaris Consortio: Themes and Theses Robert F. Morneau Bishop Morneau continues his commentaries on papal documents with this present article which, though not directly concerned with religious life, has much to say about being Christian. Bishop Morneau, Auxiliary Bishop of the Green Bay diocese, continues his work with the Ministry to Priests Program, and may be addressed at that office: 1016 N. Broadway; De Pere, WI 54115. On November 22, 1981, Pope John Paul I1 issued an apostolic exhortation Familiaris Consortio.~ This document on the family followed the Synod of Bishops n~eeting that dealt at length with issues of family life. A vast range of topics was discussed: I) the role of the family--its identity and mission. The centraliky of love was stressed with great clarity. 2) The meaning of human sexual-ity, meaning which can be found only when sexuality is perceived in relationship to the whole person and to the plan of God. 3) The call to the family to participate in the development of society. This challenge prevents a narrow parochialism and urges a social consciousness that is inclusive. 4) The character of rights for the family. Without justice there will be no peace in the home or among nations. 5) Concern for the hurting. Compassion demands that we reach out to the families that are broken and experiencing loss of any kind. Documents such as this exhortation serve a most important purpose in life, i.e., the sharing of a vision. Parker J. Palmer writes of the need for vision: Finally, we need to seek and find the grounds of Christian hope in the midst of our public crisis. Those grounds are to be found in God's promise of reconciliation and God's faithful-ness to that promise. We will touch that ground and root ourselves in it through prayer and ~'Apostolic Exhortati~, Familiaris Consortio, of His H~liness Pope John Paul II to the Episcopate, to the Clergy and the Faithful of the whole Catholic Church regarding the Role of the Christian Family in the Modern World (Rome: Vatican Polyglot Press, Nov. 22, 1981, pp. 176). 481 till2 / Review for Religious, July-August, 1982 contemplation--not as an isolated individual act, but as directed and disciplined within the community of faith. Just as private and public life are halves of a larger whole, so private prayer and public worship are meant to be as one. In all these ways the Church can help renew that vision without which the people perish!2 In a society that is pluralistic, in a world ajar with great changes, in a Church undergoing rapid development, the vision of the family is bound to be obscured. Whatever can help clarify the basic elements of family life and its interdependence with the Church and society is invaluable in daily decision making. Familiaris Consortio provides a vision from which to evaluate and plan. Unfortunately, because of its length, this document may well find its way to the shelf unmarked and unread, suffering the same fate as Pacem in Terris, Laborem Exercens, and Redemptor Hominis. If this happens, th~ vision remains at a certain level of leadership but never gets into the minds and the hearts of the people. The problem is one of communication. This article attempts to give a general overview of the central themes of the document; its aim is to attract the reader to the primary source itself. Theme 1: Family T~esis: The Christian Family is a community of persons committed to self-giving and fidelity. The family, which is founded and given life by love, is a community of persons: of husband and wife, of parents and children, of relatives, Its first task is to live with fidelity the reality of communion in a constant effort to develop an authentic community of persons (18). The family is the first and fundamental school of social living: as a community of love, it finds in self-giving the law that guides it and makes it grow. The self-giving that inspires the love of husband and wife for each other is the model and norm for the self-giving that must be practiced in the relationships between brothers and sisters and the different generations living together in the family. And the communion and sharing that are part of everyday life in the home at times of joy and at times of difficulty are the most concrete and effective pedagogy for the active, responsible and fruitful inclusion of the children in the wider horizon of society (37). Loving the family means being able to appreciate its values and capabilities, fostering them always. Loving the family means identifying the dangers and the evils that menace it, in order to overcome them. Loving the family means endeavoring to create for it an environment favorable for its development (86). In his strong and sensitive novel A Death in the Family, James Agee writes of the delicate bonds of family life. Those bonds were ruptured when the father of the family was killed in a car accident. His son Rufus cries out to his mother: "Hide 'n Seek's just a game,just a game. God doesn't fool around playing games, does He, Mama! Does He! Does He!" The story paints the intersecting lines of relatives and friends offering sympathy and advice, raising questions and sharing consolation. A community of persons dealing with life and death, faith and doubt, joy and sorrow. A family at once imbued with love and yet wrenched with selfishness. 2Parker J. Palmer, The Company of Strangers iNew York: Crossroad, 1981), p. 33. Familiaris Consortio 483 Agee masterfully tells of people striving to sustain relationships in adverse orcum-stances, striving to comprehend life in the face of death. This finely tuned story provides an example of family life; the apostolic exhortation addresses itself to such a community and offers a faith perspective for dealing with life's questions. The backbone of family life is community. When a group of people lives out a common value system in which each individual is deeply loved and challenged, a oneness is formed which we call community. It ismore a process than a state of being. Its organic nature means that things never remain the same. This constant flux is not to be understood negatively. Rather, this positive change is called growth, the development which underlies every healthy family. The values are constant, their implementation and application continue to vary. Community happens when people truly care and share. The central act of the family and community is self-giving: the ability to be with and for others in a loving and compassionate way. This act is not without its risks. While it can and often does lead to acceptance, such sharing can also lead to rejection. Relationships demand trust, that invisible elixir, which creates an atmosphere in which dialogue and revelation can happen. Where do we find authentic family life? Where self-giving, trust, sharing and love abide! The prophets of the Hebrew scriptures confronted the people with the sin that destroyed the family of Israel: infidelit!! Hosea would say: "My people are dis-eased through their disloyalty" (Ho 11:7). The haunting motto semperfidelis must not be ignored. Family life and community depend upon depth commitment that is able to withstand the fierce testing of crises and weaknesses. Much grace is needed, especially in a culture that accepts infidelity as being "only human." Humorously, if sadly, we speak about a dog as being man's best friend--yet the fidelity of a dog does at times outrun human commitment. Often the apostolic document draws our attention to the power, necessity and beauty of fidelity. Theme 2: Sacrament of Marriage Thesis: The sacrament of marriage is God's special grace enlightening a couple to see their true vocation and empowering them to five it. The gift of the sacrament is at the same time a vocation and commandment for the Christian spouses, that they may remain faithful to each other forever, beyond every trial and difficulty, in generous obedience to the holy will of the Lord: "What therefore God has joined together. let not man put asunder" (20). A vivid and attentive awareness of the mission that they have received with the sacrament of marriage will help Christian parents to place themselves at the service of their children's education with great serenity and trustfulness, and also with a sense of responsibility before God, who calls them and gives them the mission of building up the Church in their children. Thus in the case of baptized people, the family, called together by word and .sacrament as the Church of the home. is both teacher and mother, the same as the worldwide Church (38). The social role that belongs to every family pertains by a new and original right to the Christian family, which is based on the sacrament of marriage. By taking up the human reality of the love between husband and wife in all its implications, the sacrament gives to Christian couples and parents a power and commitment to live their vocation as lay people and therefore to "seek the kingdom of God by engaging in temporal affairs and by ordering them 4~ltl / Review for Religious, July-August, 1982 according to the plan of God" (47). The sacrament of marriage is the specific source and original means of sanctification for Christian married couples and families. It takes up again and makes specific the sanctifying . grace of baptism (56). God is love! In divine self-giving we receive that love which we call grace. Faith allows us to experience the mystery that God has made his home in our hearts, that we are indeed temples of the Spirit. As blood flows through our systems providing life and energy, so grace flows through life affording participation in the Divine Reality. Freely given, it must be freely accepted and exercised. Such gifted-ness does impose serious demands on the individual and the community. Because of this there is a tendency to resist the reception of God's love and to opt for that "cheap grace" which seemingly makes no demands. Such a choice is fatal because it is a lie. Grace will always remain true to its essence: love calling out to love. Once received it must be shared lest one's very integrity be shattered. Grace comes to married life and love through the sacrament of marriage in a very special way. This visible sign of God's incomprehensible love brings about what it signifies: union and holiness. Such is the vocation for all people. God provides specific help to couples who have special demands in the nurturing and sustaining of unique relationships. The sacrament has two sides: invitation and imperative. By means of the invitation each couple builds up the Church and by fulfilling the imperative they participate in the work of salvation. In order that this be known and deeply sensed, the apostolic exhortation stresses the significance of adequate preparation. An understanding of the meaning of grace, as well as the invitation and imperative that underlie it, is crucial to successful married life. Proper disposition makes possible a full response. Here, as in most situations, ignorance is not bliss. Anwar eI-Sadat, in his autobiography In Search of Identity, reflects on a central question of life, one's vocation: Without a vocation, man's existence would be meaningless. We have been created to bear the responsibility God has entrusted us with. Though different, each man should .fulfill his specific vocation and shoulder his individual responsibility? Marriage is a vocation, one sanctified by a sacrament. God's calling is accompan-ied by the necessary help enabling an adequate response in the light of one's gifts and talents. A sense of identity enriches family life and interpersonal relationships. Without this self-awareness, the inner poverty of relationships results in destructive deprivation. Only a sense of one's vocation allows for the proper ordering of life's many demands. Marriage as a basic vocation claims centrality: work, play and social engagements all take a secondary role. A constant challenge in life is to get in touch with one's vocation and to maintain an abiding awareness of this mystery. Theme 3: Mission/Task of the Family Thesis: Christian families are called to receive and share the divine graces of life and love. Looking at it in such a way as to reach its very roots we must say that the essence and role of Familiaris Consortio / the family are in the final analysis specified by love. Hence the family has the mission to guard, reveal and communicate love, and this is a living reflection of and a real sharing in God's love for humanity and the love of Christ the Lord for the Church his bride (17). Thus. with love as its point of departure and making constant reference to it, the recent Synod emphasized four general tasks for the family: I) forming a community of persons: 2) serving life: 3) participating in the development of society; 4) sharing in the life and mission of the Church (17). Therefore love and life constitute the nucleus of the saving mission of the Christian family in the Church and for the Church (50). A movie, novel, or a walk through Disneyland often offer a moment of escape from the harsher realities of life. In the film Raiders of the Lost Ark impossible missions are pulled off one after another. Sheer enjoyment, totally unreal. After such moments we reenter the real world: the world of work, the world of interna-tional conflict, the world of the family. Missions here seem impossible as well: to bring about justice, to foster peace, to live love. Indeed, without grace and great personal effort, the task is overwhelming, if not impossible: with discipline and divine assistance the ideals of justice, peace and love become historical realities. Authors from various disciplines have constantly commented on the task and mission of the family: love and life. A father did not visit his son, nor the son his father. Charity was dead? I've always been intense about relationships. At times, my love overwhelms people. And it puzzles me. My business is to IoveP ¯. and Alyosha's heart could not endure uncertainty because his love was always of an active character. He was incapable of passive love. If he loved any one. he set to work at once to love him? Thus writes Barbara Tuchman in her excellent study A Distant Mirror; in The Belle of Amherst playwright William Luce puts words into the mouth of Emily Dickinson; Dostoevsky too ponders the movements and the mystery of love in his character Alyosha. There is a certain messiness in the mission. Oftentimes motives are mixed in trying to love. Grace faces blockage and detours at every turn. Infrequent success and daily failures can be discouraging. 'Yet the moments of concern, care, respect and love--the central vocation of the human heart--are breakthroughs of healing redemptive life. The exhortation strikes dead center in urging families to guard love from every danger, to reveal love in trust and openness, to communicate love through honest dialogue. The mission is realized by means of such activity. Four specific tasks are delineated for the family: 1) The mission of forming 3Anwar eI-Sadat, In Search of Identity (New York: Harper Colophon Books, 1977), p. 82. aBarbara Tuchman, A Distant Mirror (New York: Alfred A. Knopf, Inc., 1978), p. 97. 5William l,uce, The Belle of A~nherst (Boston: Houghton Mifflin Company, 1976), p. 30. ~'Fyodor Dostoevsky. The Brothers Karamazov (New York: International Collectors Library, 1941), p. 171. 111~6 / Review for Religious, July-August, 1982 interpersonal relationships, of building community. Such formation demands time and self-giving; it is endangered by loss of identity and ambiguity about central values. 2) The mission of serving life by protecting the procreative and unitive functions of married love. Education and ongoing training are also tasks of par-ents. 3) The mission of participating in societal and political changes of society. Reaching out to the larger community prevents a destructive individualism. 4) The mission of becoming church. Through love, Christ is made present in our homes and in our world. Theme 4: Love Thesis: The heartbeat and central principle of family life is love. God is love and in himself he lives a mystery of personal loving communion. Creating the human race in his own image and continually keeping it in being, God inscribed in the humanity of man and woman the vocation, and thus the capacity and responsibility, of love and communion. Love is therefore the fundamental and innate vocation of every human being ( I I ). The inner principle of that task (to develop an authentic community of persons), its perma-nent power and its final goal is love: without love the family is not a community of persons and, in the same way, without love the family cannot live. grow and perfect itself as a community of persons (I 8). It cannot be forgotten that the most basic element, so basic that it qualifies the educational role of parents, is parental love. which finds fulfillment in the task of education as it completes and perfects its service of life: as well as being a source, the parent's love is also the animating principle and therefore the norm inspiring and guiding all concrete educational activity, enriching it with the values of kindness, constancy, goodness, service, disinterestedness, and self-sacrifice that are the most precious fruits of love (36). Vocation is a mystery. Who can explain exactly how a call comes into our lives and what makes it possible to respond? Faith offers some reflections on this matter and the Second Vatican Council clearly states that all people are called to holiness. The present document says the same thing but in a different way: the intrinsic calling of every person is love. How this universal vocation is lived out is deter-mined by the specific path an individual chooses: single life, married life, religious life. In a sense there is both freedom and determination here. We are free to choose our unique path, we are not free not to be loving and still retain our humanity. Romano Guardini understood well the process involved in discerning one's vocation: A vocation is no label marked "chosen" which can be fixed to a hum~in existence once and forever. It is a living intention of God, efficacy of his love in the chosen one. Only through the action taken by that person can it become reality.7 The family is inextricably involved in the vocation question. The pragmatic "how" question arises in the search for love and community within the family circle. Many forces that tend to block love and concern must be dealt with. How 7Roma~ao Guardini, The Lord (Chica~o: Henry Regnery Company, 1954), p. 94. Familiaris Consortio / 4117 can we live simple and fruitful lives in a culture characterized by chaos and violence? The good news of the Gospel draws our attention to the person of Jesus in whom we find love incarnate. The basic command is not merely a verbal communication--it is a lived reality. Before preaching, Jesus so often heals, frees, forgives--only then does he explain in word what has taken place. Such self-giving is the model for the family, the domestic church. Jesus shares with that church his Spirit that enables its members to fulfill the perfect command to be loving, forgiv-ing people. And within all this is a paradox: "Jesus' authentic power is revealed in his frailty and importance.'~ The power of powerlessness lies at the heart of love, at the heart of the family. Roots determine fruits. Where authentic parental love exists as the source of family life, then the possibility of various virtues finding expression in the lives of its members is probable. The apostolic exhortation lists six: I) Kindness: that attitude and action that affirms and strengthens one another: 2) Constancy: that rich fidelity fostering trust; 3) Goodness: love incarnate in a small word, gracious deed; 4) Service: awareness of and response to the needs of others; 5) Disinterested-ness: that unique self-forgetfulness in being for and with others: 6) Self-sacrifice: that realism that all love involves a cross. The vocation to love and to be loved is fulfilled only in grace. Theme 5: Sexuality Thesis: Sexuality finds its full meaning only when seen in the context of the human person, God's plan and love. Consequently, sexuality, by means of which man and woman give themselves to one another through the acts which are proper and exclusive to spouses, is by no means something purely biological, but concerns the innermost being of the human person as such. It is realized in a truly human way only if it is an integral part of the love by which a man and a woman commit themselves totally to one another until death. The total physical self-giving would be a lie if it were not the sign and fruit of a total personal self-giving, in which the whole person, including the temporal dimension, is present: if the person were to withhold something or reserve the possibility of deciding otherwise in the future, by this very fact he or she would not be giving totally (I I). In the context of a culture which seriously distorts or entirely misinterprets the true meaning of human sexuality, because it separates it from its essential reference to the person, the Church more urgently feels how irreplaceable is her mission of presenting sexuality as a value and task of the whole person, created male and female in the image of God (32). Education in love as self-giving is also the indispensable premise for parents called to give their children a clear and delicate sex education. Faced with a culture that largely reduces human sexuality to the level of something commonplace, since it interprets and lives it in a reductive and impoverished way by linking it solely with the body and with selfish pleasure, the educational service of parents must aim firmly at a training in the area of sex that is truly and fully personal: for sexuality is an enrichment of the whole person--body, emotions and soul--and it manifests its inmost meaning in leading the person to the gift of self in love (37). ~Jon Sobrino, S.J. Christology at the Crossroads. trans, by John Drury (New York: Orbis Books. 1978), p. 281. 41111 / Review for Religious, July-August, 1982 When things are disconnected, they become distorted. The absolutizing ten-dency to identify a part for the whole is not uncommon. A recent movie/play, The Elephant Man, demonstrates what happens when a single moment of life excludes other factors. Most people were unable to move beyond the elephant man's deformity and penetrate to the rich, inner beauty of his person. Sexuality has suffered over the years from the absolutizing impulse that has fragmented this great and powerful gift. When sexuality is reduced to physicality, emotionality or pleasure, meaning is lost. Familiaris Consortio presents a different vision. Here sexuality is understood as an integral part of the personality. It has meaning only in reference to the person and authentic love. This integral vision provides mean-ing and allows for prudential decision on how the gift will be used. Vision and virtue help to order this radical power in our lives. Though complex, sexuality is not incomprehensible; though innately powerful, sexuality is not uncontrollable. Certain things in history are a matter of life and death. One of these is human sexuality. Abundant life flows when this gift of sexuality is used with proper regard for the individual and is an expression of authentic love. Physical, emotional and spiritual life are all enriched. However, when sexuality is misused and becomes a form of manipulation or exploitation, few things are as destructive. Death is the consistent effect of unprincipled use of human sexuality. Here truth is abandoned, a lie is lived. The fruits are well-known: deception, secretiveness, joylessness, angst, boredom--exit Mrs. Robinson. Thus the paradox: that which can be most life-giving is capable of causing infinite harm. Sex education is an urgent need today. This obligation is frustrated because of confusion in regard to sexual matters, breakdown in communication, sheer ne-glect. Much information regarding sexual matters is transmitted through the mass media and peer groups, often highly distorted and erroneous. Justice is at stake. The child has the right to know; the duty rests primarily on parents. Assistance is often needed and other bodies (church and schools) get involved. One point must be stressed: ¯. the Church is firmly opposed to an often widespread form of imparting sex information dissociated from moral principle (37). The key issue is clear: human sexuality must always be dealt with in context: the context of love, the human person and God's plan. Theme 6: Education Thesis: Education is a primary duty and right of parents; the full growth and development of children depend upon the exercise of this obligation, The task of giving education is rorted in the primary vocation of married couples to partici-pate in God's creative activity: by begetting in love and for love a new person who has within himself or herself the vocation to growth and development, parents by that very fact take on the task of helping that person effectively to live a fully human life (36). According to the plan of God, marriage is the foundation of the wider community of the family, since the very institution of marriage and conjugal love are ordained to the procreation and education of children, in whom they find their crowning (14). Familiaris Consonio / 489 The mission to educate demands that Christian parents should present to their children all the topics that are necessary for the gradual maturing of their personality from a Christian and ecclesial point of view. They will therefore follow the educational lines mentioned above. taking care to show their children the depths of significance to which the faith and love of Jesus Christ can lead (39). Full growth and development demand education. This process of learning is of special significance in the first decade of a person's life. Here the twig is bent, the fate of the tree deeply influenced. In the confines of the home a type of informal education is always at work. By osmosis children are assimilating the values, thoughts and life-style of their parents. There will be times of more formal educa-tion: planned discussion, structured dialogue, explicit exchange of facts and per-spectives. Whether formal or informal, the learning process nourishes the mind and heart as food does the body. Intellectual needs are as deep as bodily ones. If deprived of proper feeding, strange compensatory behavior sets in, causing serious disorder or relationships. If nourishment is well balanced, the result is a healthy home and society. Given the limitations of time, talent and skills, parents will necessarily reach out to others for help in the fulfillment of this primary obligation to educate their children. This appeal for help should not lead to abdication. Certain things can only be learned in the home: the art of sustaining relationships in close quarters, the ability to deal with moods over long periods of time, the gift of hospitality to strangers. In these and other areas, parents are always teaching, if not in word, certainly by their actions. To succeed in this duty parents must continue their own education. The formation of parents through information and transformation is necessary for the full dex~elopment of the family. In an age of rapid ~:hange and high activism, there is a special lesson that parents can teach their children, the lesson of silence: We have yet to accept and act upon the axiom that the cultivation of a habit of silence is an integral part of all true education; and that children, so far from looking upon a demand for silence as an unnatural and intolerable imposition, have an inborn aptitude for quietness.9 Such silence gives access to the voice of God and the deeper recesses of oneself. Contemplation then becomeg a possibility and this activity is essential to a full, human life. Constant activity and incessant noise destroy the conditions for true humanness: loving attention and presence to others. A quiet period in the day could well be one of the greatest blessings a child might learn from parents and the Theme 7: Society Thesis: The mutual relationship between family and society must be carefully Herman. Creative Prayer (Cincinnati. Ohio: Forward Movement Publications). p. 33. Review for Religious, July-August, 1982 nurtured and lovingly critiqued. The family has vital and organic links with society, since it is its foundation and nourishes it continually through its role of service to life: it is from the family that citizens come to birth and it is within the family that they find the first school of the social virtues that are the animating principle of the existence and development of society itself (42). The social role of families is called upon to find expression also in the form of political intervention: families should be the first to take steps to see that the laws and institutions of the State not only do not offend but support and positively defend the rights and duties of the family. Along these lines, families should grow in awareness of being "protagonists" of what is known as "family politics" and assume responsibility for transforming society: otherwise families will be the first victims of the evils that they have done no more than note with indifference. The Second Vatican Council's appeal to go beyond an individualistic ethic therefore also holds good for the family as such (44), The family and society have complementary functions in defending and fostering the good of each and every human being (45). The privatization of religion is a constant danger. This attitude compartmen-talizes one's relationship with God, separating it from economic, socio-political, cultural issues. Christians must be constantly challenged to assume their proper role in society by fostering a public outlook: A public outlook among Christians asks them to care for the good ordering of people who are not saved and may never be. It means having concern for arts and letters, the quality of life and its cultural dimensions, the institutions of education and the forms of politics--even if there is no direct payoff for the churches.~° This linkage to the larger social whole was a major concern at the Second Vatican Council: the Church is to participate in the amelioration of the world by being socially conscious and politically concerned. Again this vision is shared in Famil-iaris Consortio. Families are to participate in social happenings in dynamic and varied ways. Non-involvement will often threaten human dignity and justice since a vacuum will be created if people abdicate their duty of articulating and living Christian values. The notion of responsibility underlies the mutual relationships between family and society. This responsibility is grounded in power. The individual, the family, the society, the church and the state, all possess this ability to bring about or prevent change. When all these parties exercise responsible power in fostering the common good, then justice and peace result. The common good is served. Yet vested interest tends to direct energies and gifts meant for the growth of the community toward self-serving and self-preserving needs and wants. Injustice is effected and society and the family are greatly harmed. The exercise of power for the common good and the proper assumption of responsibility by each grouping are of vital importance to the Church and the modern world. Rugged individualism will continue to thwart the creation of a healthy society. Narrow parochialism, social myopia, crass apathy, indulgent consumerism, afro- *°Reflection of Martin E. Marty in Parker J. Palmer's The Company of Strangers, p. 13. Familiaris Consortio / 49"1 gant nationalism are cancer sores that mar and rend the human heart and human family. Society will never be rid of these illnesses but they can be minimized by fostering a social consciousness that truly sees others as one's brothers and sisters. This consciousness begins at home or it never begins at all. Parents enrich society by their involvement in societal and political issues and by encouraging their children to participate as fully as they can. Theme 8: Church Thesis: The family as the domestic church gets its true identity and sense of purpose from its ecclesial nature. Christian marriage and the Christian family build up the Church: for in the family the human person is not only brought into being and progressively introduced by means of education into the human community, but by means of the rebirth of baptism and education in the faith, the child is also introduced into God's family, which is the Church (15). Among the fundamental tasks of the Christian family is its ecclesial task: the family is placed at the service of the building up of the kingdom of God in history by participating in the life and mission of the Church (49). The Church, a prophetic, priestly and kingly people, is endowed with the mission of bringing all human beings to accept the word of God in faith, to celebrate and profess it in the sacraments and in prayer, and to give expression to it in the concrete realities of life in accordance with the girl and new commandment of love (63). There is a rich symbiotic relationship between the family and the Church. They need each other; they enrich each other. Through the family new life is raised up, potential members of God's family; through the Church, the grace of baptism gives entrance into the community of disciples. The family is as integral to the Church as cells are to the body. Both the community of the family and the Church are about the same task: acceptance and proclamation .of the Good News, worship in spirit and in truth, service to those in need out of love, the building up of the kingdom. In a special way the Church does this through sacramental, apostolic and educa-tional avenues; the family does it by living faith, hope and love in ordinary and concrete situations. Several times in this apostolic exhortation Pope John Paul 1! stresses the building of the kingdom of God in history. Our liturgy describes some aspects of that kingdom: a kingdom of truth and life, a kingdom of holiness and grace, a kingdom of justice, love and peace.~ The Church and family intersect at this junction. Both strive to promote the realities of God's saving mysteries. Both are at the service of Jesus, the Lord of heaven and earth. Both find in him truth and life; in him the oneness with the Father; in him the love that makes justice and peace reality. Christ Jesus is the "Preface for the Feast of Christ the King. 4~)2 / Review for Religious, July-August, 1982 center of the Christian home and the Church. Romano Guardini refreshes our faltering memories: "Faith" in the sense of the New Testament means not only religious trust, reverence, self-surrender, but something specific: man's relationship to Christ and to the God who speaks through him which Christ demanded.~2 Two phenomena characterize the twentieth century: confusion about identity and the subsequent loss of meaning. Who are we? What are we to do? What is our destiny? The Church has a self-understanding that embraces mystery. Yet the task is clear: be a prophetic, kingly and priestly people! With such a vision the Christian family comes to its own self-understanding: the family also is to be a community of persons and the task and mission is the same as the Church's. No small grace here. Amid all the confusion and ambig6ity a sense of direction and purpose emerges. Energies can now be directed in meaningful ways. The Christian family is deeply enriched by seeing and living this relationship with the Church. Theme 9: Values Thesis: Family life is grounded in the knowledge and expression of basic gospel values. Christian families can do this (bear witness to the kingdom and the peace of Christ) through their educational activity--that is to say by presenting to their children a model of life based on the values of truth, freedom, justice and love--both through active and responsible involvement in the authentically human growth of society and its institutions, and by support-ing in various ways the associations specifically devoted to international issues (48). The Christian family also builds up the kingdom of God in history through the everyday realities that concern and distinguish its state of life. It is thus in the love between husband and wife and between the members of the family--a love lived out in all its extraordinary richness of values and demands: totality, oneness, fidelity and fruitfulness--that the Christian family's participation in the prophetic, priestly and kingly mission of Jesus Christ and of his Church finds expression and reali:,ation (50). Many negative phenomena which are today noted with regret in family life derive from the fact that. in the new situations, young people not only lose sight of the correct hierarchy of values but, since they no longer have certain criteria of behavior, they do not know how to face and deal with the new difficulties (66). Freedom, truth, justice, love, totality, oneness, fidelity, fruitfulness! These are the pillars (values) that support the community of persons we call the family, society and church. The importance of these values can readily be seen in contrast to their opposites: enslavement, falsity, injustice, hatred, non-commitment, divi-sion, infidelity, sterility. None of these categories are ultimately abstract; they. are not esoteric philosophical constructs. Rather, they provide the attitudinal base from which life is lived. Values shape decisions which in turn terminate in concrete action. Our actions have consequences that either humanize or destroy people. In evaluating our lives we move beyond specific, individual acts to the root system-- the values from whence they flow. These values truly characterize the essence of ~2Romano Guardini. p. 436. Familiaris Consortio / 493 our personality. Choices in life! To teach in the catechetical program or spend more time with the children; to build a new room onto the house or give more money to the poor: to take in a refugee child or prod the government to promote international justice. These choices are not necessarily exclusive but a theology of limitation restricts how much we can do. The formation of conscience is based not only on values but also the ordering of these values. What is helpful here is a guiding vision: To be an effective member of the Church. one needs a guiding vision. Such a vision should serve to interpret one's experience of life with fellow-believers, to suggest priorities and values, and to indicate ways in which the Church might make itself more effectively present in today's world.13 Value-free homes and societies are dissipated homes and societies, lacking direc-tion and purpose. Values provide a sense of meaning. The constant process of value clarification is urgently needed. The social scien-ces have methods to discern when values are truly authentic and when they are merely nominal. Internalized values have the markings of free choice, strong affective force and patterned activity. Clarifying our values helps to promote civil discourse, a discourse that is essential to keep our planet partially civilized. When values are confused and misunderstood, debate turns into a diatribe. Political, social and religious issues become muddied and constructive communication ceases. Value clarification is not the solution to world problems, but without some clarity there can be no progress. What is true of larger society is also true of the home. Clear values nourish healthy family life. Theme 10: Dangers and Difficulties Thesis: Inner and outer forces present major challenges to the delicate health of family life. On the other hand, however, signs are not lacking of a disturbing degradation of some fundamental values: a mistaken theoretical and practical crncept of the independence of the spouses in relation to each other: serious misconceptions regarding the relationship of author-ity between parents and children: the concrete difficulties that the family itself experiences in the transmission of values: the growing number of divorces: the scourge of abortion: the ever more frequent recourse to sterilization: the appearance of a truly contraceptive mentality (6). Consequently. faced with a society that is running the risk of becoming more and more depersonalized and standardized and therefore inhuman and dehumanizing, with the negative results of many forms of escapism--such as alcoholism, drugs and even terrorism--the family possesses and continues still to release formidable energies capable of taking man out of his anonymity, keeping him conscious of his personal dignity, enriching him with deep humanity and actively placing him, in his uniqueness and unrepcatability, within the fabric of society (43). Among the more troubling signs of this phenomenon (obscuring of certain fundamental values), the Synod Fathers stressed the following, in particular: the spread of divorce and of recourse to a new union, even on the part of the faithful" the acceptance of purely civil ~-~Avery Dulles, "Imaging the Church for the 1980"s." Thought. vo!. 56. no. 221 (June, 1981), p. 121. 4~4 / Review for Religious, July-August, 1982 marriage in contradiction to the vocation of the baptized to "be married in the Lord": the celebration of the marriage sacrament without living faith, but for other motives; the rejection of the moral norms that guide and promote the human and Christian exercise of sexuality in marriage (7). Teilhard de Chardin's work The Divine Milieu shows the deepest reverence for the environment, human-divine-natural, that surrounds and sustains us. When that environment is affected adversely, there is a breakdown in the rich interde-pendence of all life. Family life is no exception to this universal phenomenon. Certain negative attitudes are in the air and certain ways of relating are becoming accepted that are injurious and destructive of communities of persons: divorce that rends and tears the hearts and minds of parents and children; misunderstanding and subsequent misuse of the gift and beauty of sexuality: erroneous attitudes regarding freedom; a striving for a type of independence that makes relationships impossible. The litany is long and off-key: the pain and the hurt are even more far-reaching and dissonant. Realism demands that we share the full portrait. Healthy family life does survive and is the source of much hope and joy. There are homes where children rejoice in the love and care shown by their parents; there are homes in which youth are given a sense of dignity and respect; there are homes that are sites of caring education and gracious growth. God has promised his presence to the family and with that presence comes the grace to fulfill that unique and noble vocation of every home--the sharing of love. Familiaris Consortio offers a blueprint, charting the waterways of family life. The journey of Lewis and Clark was filled with many unnecessary delays and detours because of the lack of maps. Though they do not remove the struggle of the journey, maps do help in marking the way. The papal exhortation continues the apostolic mission: revealing the mystery of God's love and forgiveness which makes possible community, the building of the kingdom in which we hear and respond with love to the voice of the Lord. From Tablet to Heart: Internalizing New Constitutions--I Patricia Spillane, M.S.C. Sister Patricia, a psychotherapist, lectures on initial and on-going formation. She resides at the convent of the Missionary Sisters of the Sacred Heart; 428 St. James Place: Chicago, IL 60614. The second part of her presentation will appear in the next issue of REWF.W FOR REI.IGIOUS. During the past few years, we religious have witnessed a ferment of activity in our congregations centering on drafting, writing and debating new constitutions. The Lord's charge to Habakkuk: Write down the vision clearly upon the tablet so that we can read it readily (Hab 2:2) is being taken seriously. Constitutional committees, feedback designs, provincial chapters have been devoted to this task. Some of us are already breathing a sigh of relief before a completed task, some of us are still laboring to clarify the vision or inscribe the tablets. But there is a hidden illusion here, that once the tablet is inscribed, the work is over! The Lord who told Habakkuk to write on the tablet also told Jeremiah that he, himself, would plant his law deep within, "writing it on their hearts" (Jr 31:33) instead of on fragments of stone or clay. So it is today. Whoever finishes "tablet-work" is at a crossroads of a more intense and crucial nature. The real task, the "heart work," is just beginning and the challenge which lies before us is far greater than the challenge we may have already surmounted. A beautiful document will remain just that and nothing more, unless it also becomes an opportunity for personal conversion, for personal adherence to its sources of inspiration: the gospel, and the charism of the individual congregation. New constitutions are indeed "a word that goes forth from my mouth" (Is 55:! i) and so may be likened to the seed in the parable of the sower (Mt 13:1-23). There the seed-word was met by a whole spectrum of attitudes that rendered it 495 4~ / Review for Religious, July-August, 1982 more or less efficacious: from the indifference and defensiveness of those of "coarse heart., dull ears., shut eyes., fear [of] being converted," to the limited disponib~lity of those who "have no roots [since] trials., persecutions., worries ¯. riches choke the word," even after an initial joyful reception. The unconditional acceptance of those who are "good soil" is not found as often as we would like to believe. Human nature has not changed since the time those attitudes were described. The "word," whether of the gospel or of a congregation, will be as effective as each of us can allow it to be, personally and corporately. Our new constitutions are indeed a "two-edged sword," but we can block its passage to our "secret emotions and thoughts"(Heb 4:12). It is indeed a seed, bursting with the potentiality of life, but the finest seed in the world needs a welcoming environment. With all of our good will, each of us may be specializing in certain obstacles that may prevent these constitutions from taking root and producing the fruits of inner conversion, may render subjectively ineffective the objective grace of the moment. These obstacles, rather than our good will, may be at the root of our attitudinal decisions before the constitutions. Whether we realize it or not, we are not just passive recipients of these new documents. Each of us makes active decisions concerning them, with or without our awareness, and often the decision may be made before we even see the document. Neither is this "decision" an isolated factor in our life; rather it springs from the same soil which has fostered every other decision we have made. What Attitudinal Decisions Do New Constitutions Evoke in Us? What are some of the myriad possibilities of responses to this word, of attitudi-nal decisions before our constitutions, that could arise? We must recognize that anything which is both new and demanding naturally represents a threat to our established way of looking at things, to our life-style, to our values. It calls for change, for letting go of the comfortable and familiar, for embarking on untried and risky roads--even if only in small and subtle ways. It is good for us to recognize and admit how easily the gospel, our charism, our documents can threaten us. Our challenge lies in how we handle the stress which this threat brings. On the one hand we can resist in an active, rebellious way, challenging the need for norms, for institutional guidelines, for adherence to the magisterium of the Church. Or we can resist in a more subtle, passive way--remaining indifferent, unaffected; quietly ignoring what rubs us the wrong way. We can comply, go along with what is outwardly expected of us, as long as the community is aware of it or because the consequences of not "going along" would be too unpleasant. Or, at another level, we can accept the constitutions because "that's what good religious do," or because the present community to which we belong values them, and so should we. While this identification does not stop when we are no longer actually being observed by members of the community, the satisfaction due to our relation-ship with others is more important to us than the value itself. Thus, this attitudinal choice still leaves something to be desired. Our motivation remains external to us. From Tablet to Heart / 497 Finally, Luke describes the last category of listeners to the word as: people with a noble and generous heart who have heard the word and take it to themselves and yield a harvest through their perseverance (Lk 8:15). This is an excellent biblical description of what is meant by internalization: a true taking-to-heart of the value for its own sake, whether it is popular or unpopu-lar, whether we are being observed by others or not observed, whether it is gratifying or painful. Internalization of his Father's will was the only way that Jesus remained faithful unto death to his redemptive mission: rewards and friends had all disappeared; there remained only faith that this was what the Father called him to do. Vulnerability of Our Attitudes So we see that the great accomplishment of approved constitutions can falter and come to nothing, unless we are disposed to respond by attitudinal decisions that lead to the increase of internalization and the decrease of either resistance or compliance. We see that our attitudinal choices are vulnerable, with the result that, unknowingly, we may be moving towards an ephemeral and passing satisfaction instead of towards the true life that Jesus intends for each of us through these documents (see Jn 10:10). But what makes our attitudinal choices so vulnerable? What can we do about it? Perhaps we can begin by attempting to understand the source of these vulner-abilities. After all, it is a very ancient problem. The Israelites d~]ring the exodus could be seen to manifest the same spectrum of attitudes towards the covenant. Moses, in the words of the writer of Deuteronomy, finally put it to them clearly: I set before you life or death, blessing or curse: choose life then. (Dr 31:19). Let us begin to look more deeply into how, from the time of the Israelites to the present day, our choices can be torn between life and death, can lead us to our highest happiness or our greatest betrayal. To that end, let us look first at the source of these decisions--our very selves--and then at various aspects of these decisions. A. The Person as Locus of Attitudinal Decisions Attitudinal choices of life or death do not spring from a vacuum. They origi-nate in and are consistent with" that complex of motivations, forces and behaviors which we call "the self." Concentrating on the self, however, is not meant to be an exercise in individu-alism. Vitz~ warns us how the exaltation of the self and concentration on self-fulfillment result in a parody of our true selves. Kernberg2 has devoted many years ~Paul C. Vitz, Psychology as Religion: the Cult of Self- Worship (.Grand Rapids, MI: Wm. Eerdmans Publishing Co., 1977). 2Otto Kernberg, Borderline Conditions and Pathological Narcissism (NY: Jason-Aronson, 1975). __, "Why Some People Can't Love," Psychology Today (June, 1978), pp. 55-59. 1191t / Review for Religious, July-August, 1982 to a study of the increasing manifestations of narcissism in American society that result in a pathology of the self. Hendin describes the culture of the Age of Sensation as: marked by a self-interest and ego-centrism that increasingly reduces all relations to the question: What am 1 getting out of it?~ Obviously such caricatures of the self are inimicable to the gospel which says "anyone who wants to save his life will lose it" (Mt 16:25). Nevertheless, it is precisely self-knowledge which can be the greatest aid to making it possible for us to lay down our lives. All the saints testify to this truth, but 1 will restrict myself throughout this article to two great woman saints: Catherine of Siena, the great laywoman and mystic of the fourteenth century, and Frances Xavier Cabrini, the zealous mission-ary of the twentieth century, who founded my own congregation, the Missionary Sisters of the Sacred Heart of Jesus. If you would come to perfect knowledge and enjoyment of me, eternal life, never leave the knowledge of yourself . oh, how delightful to the soul and pleasing to me is holy prayer made in the house of self-knowledge and knowledge of me! (Catherine of Siena, The Dia-logue, no. 4,66). And when we begin to know ourselves, it is a grace so great that we can never thank Jesus enough since it is an illumination from his divine heart. Let us gratefully run along this way. (Frances Cabrini, Letters, no. 96). We have already insisted on the capacity of the self to function as an active sub-ject-- not just to react as the passive object of environmental stimuli. Our behavior may stem in part from external influences, but these influences are internally organized into already existing psychic structures that we normally call motiva-tions. Hence the motivations are as important as the behavior, the inner structures as important as the process of emotionally experiencing the environment. Neither is the self simply an organization of the present moment. We reach back to the past (which we may have forgotten) and forward to goals we have not yet attained. The actual needs of the past and present must be balanced with the ideals of the future, a fact which psychologists are more and more integrating into their self-theory. Wylie4 considers the sub-components of the self as the actual-self and the ideal-self. Kohut, who has devoted himself to the analysis of the self,~ speaks of its developing optimally from the interaction of ambition (needs) and ideals. Rulla6 further subdivides our actual-self with its needs and ambitions into a social, behavioral and latent self, and our ideal-self into a personal self-ideal as well SHerbert Hendin, The Age of Sensation (NY: McGraw-Hill & Co. 1977), p. 13. *R. C. Wylie, "The Present Status of Self Theory" in Handbook of Personality Theory and Research, Borgatta & Lambert, ed. (Chicago: Rand McNally, 1968), pp. 734-752. ~Heinz Kohut, The Analysis of the Se/f(NY: International Universities Press, 1977). 6Luigi M. Rulla, S.J., Depth Psychology and I/ocation (Chicago: Loyola University Press, 1971), pp. 35-37. The theoretical framework of this article is derived from the writings and teachings of Rulla. From Tablet to Heart / 499 as the ideals we believe others expect of us (institutional-ideal). Rulla further distinguishes between the subjective ideals we personally hold as important to us and the extent to which these are consonant with objective ideals---especially the revealed values of the gospei and the following of Christ. Needs and Values Within Our Conscious and Unconscious Selves However, we must admit that the self often remains a mystery to us. Paul laments "I do not understand my own behavior" (Rm 7:!5). Conscious factors interact with unconscious forces within us, unknowingly influencing our decisions and our attitudes despite our good will. Because they are unknown to us (and our defenses may be strong enough to resist coming to know them), this unconscious part of the self can greatly contribute to the vulnerability of our attitudinal deci-sions. Whether we are talking about the "Known/Unknown-to-self" of the Johari Window,7 Freud's unconscious, or Rulla's latent self, we cannot ignore the fact that we unconsciously put obstacles in the way of taking the word to heart. Grace builds on nature--but we may abuse our God-given freedom by hiding from unpleasant truths which may be interfering with the action of grace. It is this unconscious aspect of the self that touches so deeply two primary attributes of the self: our human needs which are innate, universal and strive naturally for psycho-biological or psycho-social satisfaction; and our values and ideals which are developed in the course of a lifetime. We all have needs, e.g., aggressive, dependent, sexual, and so forth, but backgrounds and previous situa-tions may have made these needs so unacceptable to us that we divorce them from ourselves by a defensive barrier that relegates them to our unconscious self. Because they are buried, however, does not mean they are inactive; in fact they may be all the more influential because of our lack of awareness. At the other end of the spectrum of self-attributes are our values which natu-rally begin by being subjective and personal, but which should mature so that the objectivb values of Christ come to coincide with our personal ideals and choices (which is what internalization is all about). However there is a "tension arc" stretched between these two poles which can often result in the weaker values succumbing to stronger unconscious needs. In this case, the values never are internalized because of contradictions in the self between the actual and the ideal. Rulla has introduced the term "inconsistencies" to describe these poorly-integrated tensions between needs and values. While certain human needs may be consistent with the following of Christ, e.g., the need to achieve, to care for others (nurtur-ance), to overcome difficulties (counteraction), certain others such as inferiority (abasement), avoidance of pain (harm-avoidance), or defensiveness interfere with the following of Christ and hence may represent significant inconsistencies in individuals where they predominate. Ideally, we should be able to acknowledge and accept the presence of these inconsistencies which we all have, integrate them 7joseph Lufl. Group Processed (Palo Alto: National Press, 1961). 500 / Review for Religious, July-August, 1982 in a manner appropriate to a vowed life, and thus be freer to be attracted by and assimilate the values of Christ. However, when the block of unconscious needs cannot be acknowledged, a vicious circle begins of denying what we most need to deal with, of distorting our image of ourselves to match our ideal-self instead of dealing with what is actually present. Self As Holistic, Structural, Purposive Thus far we have seen that our attitudinal choices originate in a self that is both reactive and becoming, both conscious and unconscious, both real and ideal in our efforts to integrate values and needs in a consistent way. Another theorist, Jane Loevinger,8 describes the necessary characteristics that must be incorporated into a healthy self, or into any adequate self-theory. Thus, among other elements, she maintains that the self must be understood as holistic, structural and purposive. When we interpret this in the light of religious life, several implications concerning the self emerge: The holistic self." Self as the locus of growth in Christ and for purposes of internali-zation must be seen as the integration of all its aspects: conscious and unconscious; active and passive; the psycho-biological, psycho-social, and psycho-spiritual: the cognitive, affective and volitional; the real and the ideal. The part that each element has to play in the final ordering of a mature consistent self is not just a result of haphazard whim or fancy. Rather, true integration moves from more primitive, ego-centered positions to more advanced levels that do not exclude the earlier but incorporate them into newer, more mature patterns. The structural self." A great many theorists today stress the self as being in process; problems are envisioned in terms of blocked emotional and experiential pro-cesses. 9 They emphasize those components of ourselves that are or should be in movement, in flux, in change. While this approach contains an undeniable truth, a holistic approach includes other aspects as well. We are not only emotion, flux, becoming. Our inner selves are also organized into stable structured patterns of needs, motivations and ideals; of behavioral tendencies and patterns of relation-ships that are remarkably stable, resistant to change and indeed form the source of our emotional reactions, our manner of experiencing the world and our behavioral tendencies. Thus while our structures or psychic patterns seem to epitomize Our stable and non-changing elements, in reality we can experience no real change unless these very structures are touched and altered. A structural view of the self is sound not only from a psychological point of view but also from a theological. The late Gustave Weigel in his considerations on Theology and Freedom looks first at the self which is capable of reaching freedom. He contrasts an experiencing self in flux as: 8Jane Loevinger, ~Theories of Ego Development" in ClinieabCognitive Psychology: Models and Inte-gration, L. Breger, ed. (Englewood Cliffs, N J: Prentice-Hall, 1969), pp. 87-99. 9E.g., most of the humanistic schools--Rogers, Maslow, et al. From Tablet to Heart / 51~1 isolated, unrelated consciousness, floating without orientation or direction on the mysterious sea of existence, itself selfless with the self as presumed by Catholic theology which begins with the supposition that the self is structured and its affirmations must be related to that structure.~0 ¯ Thus a view of the self without structure and only in process cannot help us either spiritually or humanly. If a religious has unknowingly reacted all his or her life so as to comply with the sacrifices invited, by chastity, poverty and obedience and has never really internalized them, he or she has unwittingly formed a pattern and a structure of compliance that will not change only by focusing on his or her emotions and experiences. The roots of our patterns must be dealt with before lasting, significant change can occur. The purposive self." Loevinger sees the self as inherently striving for meaning, purpose, goals--echoing the ideal-self of Wylie, Rulla, Kohut, et al. Frankl speaks of the "will to meaning" as opposed to "the will to pleasure." Indeed happiness, fulfillment, identity are all side effects of the successful search for meaning: It may now have become clear that a concept such as self-actualiTation, or self-realization, is not a sufficient ground for a motivational theory. This is mainly due to the fact that self-actualization, like power and pleasure, also belongs to the class of phenomena which can only be obtained as a side effect and are thwarted precisely to the degree to which they are made a matter of direct intention. Self-actualization is a good thing: however. I maintain that man can only actualize himself to the extent to which he fulfills meaning. Then self-actualization occurs spontaneously: it is contravened when it is made an end in itself.~ Indeed the capacity to commit ourselves marks our highest capacity, our ability to transcend ourselves, to go beyond gratification and pleasure to value and meaning. To the extent that the values and meanings for which we transcend ourselves are objective and true (consistent with our self-as-it-ought-to-be), happi-ness and self-fulfillment will gradually emerge as side effects. Thus, new constitutions ought to prick and challenge us--make us uncom-fortable- not be already within our grasp. Our tendency can be, however, to "cut down to size," reduce the demand quality of something which may annoy and anger us because it disturbs our comfort. We have to be willing to forego, unlike the rich young man (Mk 10:17-22), the gratification of"but I've already been doing all that," to push forward, stretch, go beyond where we are, to transcend our own comfort in the service of values which have originated beyond us. The Subjectivization of Values Both Frankl and Rulla have been very concerned with the relativization and individualization of values which we see so often in modern society. Values which ~0Gustave Weigel, S.J., "Theology and Freedom" in Foundations./'or "a Psychology of Grace (Glen Rock. N J: Paulist Press, 1966), p. 188. ~Victor Frankl, Psychotherapy and Existentialism (NY: Clarion Bks, 1967), p. 8. 502 / Review for Religious, July-August, 1982 should be objective and clear become subjectively evaluated (for discarding or adaptation); we tend to elevate ourselves and our needs as ends in themselves, thereby actually making ourselves into an object. We become the measure of the value instead of the value calling us forth. Here our ideal-self has become absorbed into our actual-self and has become its puppet, instead of being a liberating, independent force which urges our actual-self further along the road to maturity and freedom. An adaptation of one of Frankl's diagrams can help us envision this tendency more clearly:12 Strong human needs (1) especially unconscious ones that are dissonant with the following of Christ can cause the values (2) to be unconsciously "adjusted" (subjectified) so that the person (3) becomes the norm (objectified). This may lead to temporary self-fulfillment and gratification, but not to lasting happiness because it has diluted the values that encouraged us towards self-transcendence. Frankl calls for changing this situation through re-objectifying the values and re-subjectifying the person by means of a value-oriented theory and practice (4). To the extent that we can realize this, to that same extent can we find a true self-fulfillment in Christ that comes as a result of having transcended ourselves. Unless a grain of wheat fails on the ground and dies, it remains a single grain: but if it dies. it yields a rich harvest (Jri 12:24). Thus far we have considered the self with its intricate weaving of values and needs, structure and function, elements known-to-self and unknown-to-self as the source of our attitudes ranging from acceptance to refusal of God's design. Now let us turn to examine more closely the process and result of our decision-making, so '~Ibid., p. 66. From Tablet to Heart / 503 as to better understand the interactions of nature and grace within us. To do this, we shall look at attitudinal decisions from three aspects: spiritual philosophical and psychological. B. The Spiritual Dimension of Our Attitudinal Decision We can consider the spiritual dimension of decisions and attitudes since, in a holistic and purposive view of the self, over and above the fact that our capacities are God-given in themselves, we can and ought to reach out for transcendent goods. Thus our decisions may be considered spiritual on the basis of their object, i.e., what is being chosen, and on their mode, i.e., how the "what" is being chosen, under the influence of what--grace or inconsistent human needs. God calls, and awaits our human decision. He offers us his grace that makes possible but not obligatory our decision to respond to a transcendent good. Thus our decision may be the meeting ground between nature and grace--an encounter between two liberties. But, as we have already seen, this liberty to ,respond may be conditioned by various factors, notwithstanding our good will and sincere desire to serve God. This is our subjective holiness, the extent to which we actually do respond to grace in spite of our human limits and weaknesses. However, we also have to consider objective holiness--the extent to which we could respond to God if our liberty was less impaired, i.e., if there were less unknown inconsistencies with which we had to struggle.~3 We are responsible within the bounds of subjective holiness because there we know the weaknesses against wfiich we must consciously struggle. Obviously, we are not responsible for what we do not know--our hidden faults and failings--but we are responsible to do what is in our power to become aware of them. This is what the saints tried to do constantly--to become aware of what was formerly hidden from them through reflection, prayer, examen, and so forth. And because they were not defensive, they usually succeeded. Cabrini writes: We shouldn't be surprised at our defects, for such marveling comes from pride, but let us humble ourselves and reflect that they are like windows where the light enters so we can know ourselves better. Only humility is called the beginning of all perfection; why shouldn't our defects help to know ourselves better and become more humble? (Pensieri e PropositL p. 166-167.) Discernment When we consider the object and mode of our choices, we are reminded of St. Ignatius' rules for the discernment of spirits: whether the soul is choosing a real or an apparent good; whether this soul is being drawn by grace or by "evil spirits." How can we discern between these two goods, since nothing is chosen except under the aspect of good? Or, as Lonergan would have it, how can we discern whether we are being drawn by the goods of the "ego-centered self" or the "ego-transcending self"?. It is beyond the scope of this work to comment in detail on the ~-~Luigi M. Rulla, S.J., Joyce Ridick, S.S.C., Franco Imoda, S.J., Entering and Leaving Vocation (Chicago: Loyola University Press, 1976), pp. 212-214. 504 / Review for Religious, July-August, 1982 parallels between Ignatian discernment and modern vocational depth-psychology: the reader is referred to the numerous articles that have appeared recently in this vein)4 Suffice it to say that the real goods of the kingdom are consistent with the revealed objective truths of the gospel and of Church teaching: that they are concerned with discovering and living God's will regardless of the cost, and not our plan for ourselves; and that such goods leave intact or intensify our intimacy with Christ, our acceptance of and living out of his word, even when that entails great sacrifice and hardship. In some cases it is fairly easy to discern the real from the apparent good: at other times we know what God wants even though we feel humanly repulsed by it. Many times, however, the case is not so clear; we can be convinced that God wants something when in reality it is our own inconsistent tendencies that want it. Sometimes we later see and understand our error: sometimes we never discover that truth. St. Ignatius tells us to look for "consolation without cause" following the choice of the real good--and desolation when this is not so. Unfortunately, our emotional weighing of a good to be chosen can be confused by unconscious inconsistencies rendering our emotions unreliable guides. Consolation and desolation do not necessarily identify with pleasure and pain., only when affeetivity is ordered can it in turn become the clue to the direction in which one should go within the myriad good options that surround one's life (Italics mine).~5 Grace or Gratification? We have considered "decision for what?" The issue of "how, under what influence?" is equally important. How do we discern if grace or gratification is what moves us? Certainly, grace moves us in the direction of the real good: our conversion to the will of God and the imitation of Christ. Grace enables us to go beyond our natural desires for natural goods and to take root in a transcendent love of Jesus Christ. Not only does grace make conversion possible (Lonergan's operative grace) but enables us to cooperate with it so as to effect the gradual movement towards a full and complete transformation of the whole of one's living and feeling¯ one's thoughts, words, deeds and omissions.~ But how can we tell if it is really grace at work, or our own needs? There are no litmus tests for the Spirit, no computer analysis which can pin him down. But holy men and women from the dawn of the Christian era have used their spiritual ~'~Luigi M. Rulla, S.J., "The Discernment of Spirits and Christian Anthropology," Gregorianum (Vol. 59, 3: 78), pp. 537-569. Laurence Murphy¯ S.J., "Psychological Problems ~f Christian Choice." The Way, 1~75, pp. 25-28. ¯'Psychological Development," Supplement to 7he Way, n.38 (Summer. 1980), pp. 30-40. Louis Gendron¯ S.J., "The Exercises and Vocational Therapy," Supplement to The Way, n.38 (Summer, 1980), pp. 53-67. ~Michael Buckley¯ S.J., "Rules for the Discernment of Spirits," Supplement to The Way, no.20 (1973), pp. 29-35. ~rBernard J. Lonergan¯ S.J.¯ Method in Theology. 2nd ed. (NY: Herder and Herder. 1973), p. 241. From Tablet to Heart / 505 intuition, the fruits of disponibility to grace, to discern. Rahner, using the most simple and commonplace of means, discerns that only grace can be at work in the following instances: Have we ever kept quiet, even though we wanted to defend ourselves when we had been unfairly treated? Have we ever forgiven someone even though we got no thanks for it and our silent forgiveness was taken for granted? Have we ever obeyed, not because we had to and because otherwise things would have become unpleasant for us, but simply on account of that mysterious, silent incomprehensible being we call God and will?. Have we ever tried to love God when we are no longer being borne on the crest of the wave of enthusiastic feeling, when it is no longer possible to mistake our self. and its vital urges, for God?. Have we ever been good to someone who did not show the slightest sign of gratitude or comprehension and when we also were not rewarded by the feeling of having been "selfless," decent, etc.?~7 It is interesting from a psychological point of view how clearly Rahner sees that an inordinate need for self-esteem can be an obstacle to our growth in grace and holiness: when it is more important for our self-esteem to be boosted up by others' good opinion of us, our own positive evaluation of ourselves, uplifting emotional experiences, and so forth; when it is more important for us to feel good about serving God than simply to serve God for his own sake. Self-esteem is essential; abasement (a helpless sense of inferiority) is a deterrent to growth in holiness. But our self-esteem should be secure enough to withstand at times the lack of external supports and proofs of how good we are. Rahner, in commenting on the latter occasions, goes on to say: If we find such experiences, then we have experienced the spirit., when we let ourselves go in this experience of the spirit, when the tangible and assignable, the relishable element disap-pears, when everything takes on the taste of death and destruction, or when everything disappears as if in an inexpressible white, colorless and intangible beatitude--then in actual fact it is not merely the spirit but the Holy Spirit who is at work in us. Then is the hour of grace . The chalice of the Holy Spirit is identical in this life with the chalice of Christ. This chalice is drunk only by tho~ who have slowly learned in little ways to taste the fullness in emptiness, the ascent in the fall, life in death, the finding in renunciation. Anyone who learns this, experiences the spirit--the pure spirit--and in this experience he is also given the experience of the Holy Spirit of grace.~ Thus we see that evaluating our attitudinal decisions in the light of the spirit has to focus on the object of our choice (real, ego-transcending goods; apparent, ego-centered goods or the whole spectrum inbetween) and on the mode of our choosing (under the influence of grace or of gratification). Our constitutions are a real good, calling for that transcendence which leads to greater assimilation of Christ and consistent living of the gospel. "It is now no longer I who live, but Christ who lives in me" (Ga 2:20). Such a transformation can only be possible with the aid of grace, but grace is "God;s action on the psychic structure of man,''~9 and those same psychic structures can also render grace ineffective. ~TKarl Rahner. S.J., "Reflections on the Experience of Grace" in Theological Investigations. Vol. Ill (NY: Seabury Press, 1974), p. 87. ~Slbid. p. 88. ~gRulla, 1971, pp. 167-8. 501~ / Review for Religious, July-August, 1982 C. The Philosophical Dimension of Our Attitudinal Decisions The intellect, memory and will have traditionally been the principal faculties of man which have concerned the great philosophical theorists of the past. Modern thinkers have elaborated on the traditional criteria and begun to determine other intervening variables which must also be considered. Their contributions can be enlightening in our search for greater understanding of our attitudinal decisions. Lonergan20 analyzes the conscious operations of man to see how conscious decisions are reached, as summarized in this chart: Level of Faculty Operation Product Consciousness Senses Registration of empirical sense data Perception Empirical cs. Intellect Understanding (inquiry) Hypothesis Intelligent cs. Judgment (critical reflection) Validated insight Rational cs. Will Will: willing; willingness Decision Responsible cs. Decisions are built upon all the preceding conscious operations. Our intellect not only takes what has been perceived (level of experience) to inquire ("What is it?") and reach a hypothesis ("! think it's X!'), but also judges ("Was that fight?") to validate the original insight ("No, it was a Y!'). Only then do we, according to Lonergan, reach the level of responsibility where we can make a decision (therefore, I'll . . .). In reality, for example, a feeling of unrest (sense data) gets tentatively tagged ("Maybe I'm angry"), then validated ("As a matter of fact, I'm furious!'), before reaching a decision ("1'11 try to get hold of this, see what's causing it and not just attack the first person in sight!'). "An admirable decision!" we might say, but it is not one that occurs automatically. Lonergan's four steps are clear, but they do not explain why the resulting decisions could be so different from person to person. We can fail to come to a correct hypothesis of the same sense data ("They're all against me!"), fail to validate it properly ("As a matter of fact, they're figuring out how to get rid of me!"), and so come tb a completely different decision ("1"11 get even--I'll outsmart them all!'). In this example, it is obvious that emotion acted as intervening factor to distort the appropriateness of our final decision even if the four operations remained the same. To help us resolve this dilemma, Lonergan distinguishes at the level of respon-sibility between will, i.e., the bare capacity to make a decision, exercised or not; willing, i.e., the act of deciding; and willingness, i.e., a readiness to decide that does not need persuasion to bring it about.2~ Obviously, there are some objective goods -'°Lonergan, Method. pp. 6-16. __, Insight: A Study of Human Understandingo(I,ondon: I_ongmans Green, 1958), pp. 271- 278; 608-616. Ibid., pp. 622-23. From Tablet to Heart / 507 that we might be more reluctant to choose than others. This reluctance of ours is our lack of '~antecedent willingness." The whole issue of freedom is concerned here--not just essential freedom which is innately given to our nature, but even more important for our discussion, our effective freedom, i.e., "the broad or narrow., operation range" which this essential freedom can exercise.22 But, according to Lonergan, one of the requirements for effective freedom is precisely that antecedent willingness of which we have been speaking. Furthermore, Loner-gan sees grace as directly affecting this antecedent willingness,23 the grace of sincere effort even without guarantees of successful outcome. Finally, antecedent willing-ness is directly affected in conversion: To religious conversion. I would ascribe as a minimum two notes: First. it is a change in one's antecedent willingness: one becomes antecedently willing to do the good that previously one was unwilling to do . 24 And yet how do we become antecedently willing to do the good? What is there that prevents our passage into that state of mind and heart? What more must be considered? Rulla makes some useful comments when he considers the interrelationship of personal dispositions, affective and effective, on Lonergan's four conscious opera-tions. As in the previous!y quoted example, emotions originating from needs may influence our perception of X, our first hypothesis concerning X, and our judg-ment concerning our first impression. Emotions and human needs can befuddle us enough when they are conscious; the situation is even more serious when our needs and the subsequent emotions are unconscious and, therefore, even more influential on how we judge a situation. Hence, affective dispositions, whether conscious or unconscious, influence effective dispositions (and especially antecedent willingness) that lead to decision-making. With antecedent willingness thus limited, our effec-tive freedom is also limited, with the result that our emotions resulting from our needs (especially when unconscious) can form the single most effective barrier to God's gift of conversion. Our resistance to cooperative grace can render the gift ineffective. D. The Psychological Dimension of Our Attitudinal Decisions We have looked at the process of decision-making from the point of view of grace on the one hand, and our will on the other. What remains is to see in what way psychology can complement and round out what we have already seen. Magda Arnoldz5 has devoted her life to a phenomenological analysis of emo- "-'-Ibid., p. 619. 23Bernard J. Lonergan. S.J. Foundations of Theology: McShane. ed. (Dublin: Gill and Macmillan¯ 1971), p. 226. ~'~Lonergan, Method, p. 241. ~Magda Arnold¯ Feelings and F~notions (NY: Academic Press, 1970). ¯ Emotion and Personality. II Vol. (NY: Columbia, 1960). 501~ / Review for Religious, July-August, 1982 tion, especially in its influence on choice, will, and action. Her work is both scientifically sound, value-oriented, and appreciative of our transcendent dimen-sion. Arnold maintains that all choice--even of the most transcendent goods-- usually involves an emotional component which normally is derived from a basic human need on the psycho-biological and/or psycho-social level. Actually, truly human decision-making is a secondary possibility that follows from a more primi-tive instinctual movement. In this earlier phase, something is perceived, and immediately appraised, in a spontaneous, involuntary manner, as "good or bad for me here and now," i.e., as appealing to a basic instinct or need. Usually a spon-taneous emotion of attraction or withdrawal is the result. Emotional Wanting Three additional factors enter into this intuitive appraisal or emotional warn-ing. The first is the physiological reaction which accompanies normal emotion, e.g., changes in cardiac and/or respiratory functions, changes in hormone and enzyme secretions, tensing/relaxing of voluntary and involuntary muscles (from which the whole gamut of psycho-physiological disease can emerge). Often, if we are insensitive to our emotional states, our bodily changes may be the first indica-tions we will have--although we may remain in the dark as to the source of our physical discomfort. The second element in intuitive appraisal has already been indirectly noted, i.e., that we may be unaware of the emotional reaction which is taking place. Two components may become involved here, either the object of the emotion (e.g., at whom I am angry) or the experience of the emotion itself (e.g., the fact that I am angry). In either case, my defenses have arisen so that part of what I am subjec-tively experiencing becomes lost to my awareness even though it continues to influence me. The further pity is that I can no longer do anything about it and will remain enslaved to an unknown factor. In this case, I can no longer exercise my capacity for conscious choice (e.g., what ! am going to do about my anger). The reason behind my lack of awareness (partial or total) of my emotional state may involve the third factor, "affective memory." Memory involves not only the who, what, when. and how of the past (modality-specific memory), but also the specific feelings which that event or person aroused in me, e.g., fear, attraction, hatred, inferiority (affective memory). It is quite possible for the modality-specific dimension to drop from awareness behind the defensive barricade while the affec-tive dimension is being aroused time and time again--explaining why, for exam-ple, I continually have the same angry reaction towards authority figures, since my affective memory is being stirred up in each case. Hence, this emotion-laden deposit may be a hidden factor which predetermines me towards/away from a particular decision/course of action. The connection between Arnold's affective memory and Lonergan's antecedent willingness should be apparent. Furthermore, when mention was made in the previous section of the affective dispositions which influence Lonergan's conscious operations, it was precisely this issue of emotional wanting and affective memory that was meant. From Tablet to Heart / 509 Rational Wanting Are we, then, to remain a slave to our emotional vagaries and to the needs from which they spring? No, for Arnold has determined that a second phase of the decisional process may follow the first. 1 say "may" because I can stop at the level of emotional wanting ("l want it/l don't want it") and mislake that for a real decision. Certainly, animals and small children have no further possibilities, but as we chronologically mature, our capacity for reflective appraisal or rational want-ing should mature also. Here, what is appraised and judged is the emotional reaction and its accompanying tendency: "OK, I feel that way! now what am 1 going to do about it?" Here, the possibility for a real decision, not just an emo-tional reaction, occurs. The emotion and its source is consciously and calmly accepted, but we remain in control to decide whether or not to follow the emo-tional tendency. Here we move beyond our spontaneous reactions to the possibil-ity of free choice: if human needs from our actual-self were the source of the initial emotional movement, we can contrast and weigh them against the values, ideals, and commitments of our ideal-self Here, Lonergan's true level of responsibility has been reached, because we can truly take hold of the movement of our lives and give it responsible shape. Either form of decisions can prevail in a given life, either the pseudo-decisions of emotional wanting, or the true decisions of reflective judgment and rational wanting. In the first case we have the child, the immature adult--the man of James' epistle who looks at himself "and then, after a quick look, goes off and immediately forgets." In the second case, we have the man who looks steadily at the perfect law of freedom and makes that his habit--not listening and then forgetting, but actively putting it into practice (Jm 1:25). This is a portrait of a consistent individual who knows and integrates both needs and values in an increasingly mature and transcendent life-style. Not only must we respond appropriately to our human affectivity, but we must also be open to feel increasingly attracted to transcendent goods as well--intimacy with Jesus and the desire to imitate him, which is the hallmark of the emotional integration and affective maturity of the saints. The understanding., is moved by affection [which] is love's hand. and this hand fills the memory with thoughts of me and of the blessings 1 have given . IT]he soul cannot live without love. She always wants to love something, because love is the stuff she is made of ICatherine of Siena, The Dialogue. 51). What Function Does This Value Have in My Life? Obviously we form habits of reaction or decision-making in both emotional wanting and rational wanting. Pervasive attitudes are being established which form a matrix of"readiness to respond" in the direction of our needs/emotions or of our values and their attractiveness. Hence the phrase "attitudinal decisions," since each decision that we make is based" on the foundation of our previous attitudes, emotional wantings and rational wantings, known and unknown. 5"10 / Review for Religious, July-August, 1982 Let us focus more closely on this all-important attitudinal factor. We have myriads of attitudes--beliefs about this or that person, the community, the super-ior, the ministry in which I am engaged, the responsibility which 1 might be asked to assume. The basic components which underlie this multitude are more limited since our attitude towards any particular object is shaped largely by our needs or by our values; hence we may speak of emotional attitudes or rational attitudes (with the obvious admixtures). Like emotions, we may be aware or unaware of a particular attitude--or at least of the source behind it. Katz26 has determined that not only is the content of an attitude important (e.g., "working for social justice is the only worthwhile apostolate for me"), but important also is why that attitude is held, i.e., the function, known or unknown, which it plays in my life. Hence Katz demonstrates that attitudes (and values as well) may fulfill, among others, the following functions: an ego-d~fensive.function: I need to work with the poor and down-trodden to lift up my own sense of inferiority and feel good about myself. a utilitarian.function: Social justice is the stated concern of our hierarchy, and identifying with that will help me get a particular appointment I desire. Obviously, few of us can be that direct and honest about our motivations (although, with help, we could come to conclusions concerning our real intentions, and then be in a position to do something about it). Sadly enough, research27 shows that the more needy and conflictual we are a) the more we will act according to one of these aforementioned functions, and b) the more we will unconsciously protect ourselves from that knowledge, leading to a vicious circle which is not easily broken. Finally, we may espouse an attitude because of its value-expressive function: in spite of the discomforts and difficulties involved, ! think Jesus Christ is calling me to work directly with the poor without self-seeking or self-righteousness. Obviously even when struggling to maintain "a pure intention," motives get mixed, The difficulty lies in the situation where we are unaware of the mixture and, therefore, unable to choose otherwise; where we are so convinced that only the value-expressive function moves us that we never honestly look at other possibilities. A Deeper Look Into Compliance, Identification, Internalization To tie up this discussion of attitudes with our earlier considerations of the self from which these attitudes proceed, we must remember that in a structured self these tendencies towards the predominance of emotional over rational wanting (or vice versa) or towards the prevalence of ego-defensive or utilitarian functions of attitudes/values all form stable structures, enduring inner patterns which lead to -'nDaniel Katz. "The Functional Approach to the Study of Attitudes" in Readings in Attitude Theory and Measurement. Fishbein. ed. (NY: Wiley, 1967), pp. 457-468. aTRulla, Ridick and Imoda. 1976, pp. 77-80. From Tablet to Heart / 511 persistent behaviors that may or may not enhance the vowed following of Christ. Another psychic structure to which we have previously referred was the tendency to adapt new attitudes]values through compliance, identification or internaliza-tion. 2s It would seem advantageous to examine these tendencies more deeply. Kelman theoretically distinguishes them as follows: compliance is the predom-inant mode when we adopt a new attitude]value leading consciously or uncon-sciously to a particular behavior in order to gain a reward or avoid punishment, i.e., a satisfying or disappointing social effect on a significant other or others. We do not behave in that way or proclaim that value unless others are there to witness it. We do not believe in the content of the value or behavior for its own sake. In identification, we do believe in the value/behavior, but only because it is relevant in the context of a satisfying relationship to a person or a group. I identify with my friend Fr. X who believes in]does Y: or, 1 am happy to be a member of Group A which believes in and practices B. "Being a friend of," or "belonging to" is my chief source of satisfaction and self-esteem, not the belief or practice in itself. When X is no longer my friend, or no longer cares about Y: when my role as member of A is no longer attractive, or when A tells me that B ispassb, then 1 have no reason to continue believing in and living that value, and it will quietly be extinguished from my life. Finally, in internalization, we accept and live the value for its own sake, apart from punishment or reward, apart from roles or relationship. We believe in it and manifest it, whether it is popular or unpopular, "welcome or unwelcome" (2 Tm 4:1). I will serve God with all the faithfulness of which I am capable--not for the reward promised nor for the sake of the threats against those who are unfaithful--but for the pure love of him (Frances Cabrini, Pensieri e Propositi, p. 170). How clearly Cabrini rejected any lesser motivation than internalization, acting only for the pure love of God! We are called to do the same. In Katz's terms, the attitude/value is lived in a value-expressive way, and not in a utilitarian or ego-defensive fashion, as would be the case for compliance and identification. Rulta has made some important distinctions and additions to Kelman's theo-retical foundation. First of all, identification is really an ambivalent force, since it may lead us in time to an appreciation of the value in itself, apart from the relationship or role. Most of us began religious life identifying with the group or a particular person: only in time can it be seen if our initial identification leads forward to internalization of values, or remains bound up in non-internalizing identification. Secondly, external social influences are not the only factors at work in these three processes. There are also internal personal factors, especially those hidden in our latent selves, which dispose us to react to the environment in certain structured ways. Thirdly, true internalization for Rulla is not just a matter of any -'SHerbert Kelman. "Processes of Opinion Change," Public Opinion Quarterly (.Vol. 25, 1961). pp. 57-78. 512 / Review for Religious, July-August, 1982 value, no matter how fervently espoused, but of values which are objective and true. To achieve this, therefore, there must be a double consistency, my actual-self with my ideal-self, and my personal values with the objective values of Christ and the Church. In other words, 1 must have come sufficiently to know and accept my real self, so that I can then be attracted to, and be converted in reality to the values of Christ. Thus does affective maturity in Christ become possible: "knowing and accepting one's objective and free self-ideal and living it."~9 So far, we have proposed a number of problems and pitfalls that can occur when subjective attitudinal decisions meet the objective truth of our new constitu-tions. What can be done about this? In what direction must our attitudes change to effect the true internalization that we all seek? As it can be suspected, whatever tentative answers do exist are neither altogether new, nor will they provide an easy panacea. However. in the second part of this article 1 will try to provide a frame-work that may be useful in clarifying such a task. -"~Rulla, 1971, p. 182. The" Activ e-Co nte m pl a tiv e' Problem in Religious Life by David M. Knight Price: $.75 per copy, plus postage. Address: Review for Religious Rm 428 3601 Lindell Blvd. St. Louis, Missouri 63108 Poverty and Incarnation John J. O'Donnell, S.J. Father O'Donnell is a Lecturer in Christian Doctrine at Heythrop College: 11-13 Cavendish Square: London WIM 0AN. A Jesuit friend once confessed that he could honestly say that he wanted to be chaste and obedient, but he could not honestly desire to be poor. This attitude probably reflects the attitude of many Christians. After the Second Vatican Coun-cil with its affirmation of secular values and its admission that building this world contributes to the growth of God's kingdom, many Christians desired to turn away from an other-worldly spirituality, symbolized dramatically by external practices of asceticism and poverty. Interestingly enough, however, even the few intervening years since Vatican II have revealed that the gospel does not allow such an easy settlement with the issue of poverty. From the opening descriptions of Jesus' humble origins in a tiny, utterly insignificant corner of the Roman empire, to his final moments on the cross, abandoned by his people, his disciples and even the God whom he called Abba, Jesus is indeed poor. No doubt some elements of the gospel story, such as the stable at Bethlehem, have been sentimentalized. But even a non-believer such as Ernst Bloch acknowledges that we cannot demythologize the poverty of the historical Jesus. He writes, "The stable, the carpenter's son, the fanatic among the humble people, the.gallows at the end, all this is the stuff of history, not the gold of fable." Furthermore, if the life of Jesus manifests such a restlessness for the kingdom that he is the man who has nowhere to lay his head, his preaching as well points to the poor man as the one who is in the right situation to grasp the message of God's kingdom. At the heart of the New Testament is the beatitude whose original form according to Scripture scholars is closer to the Lucan version: "Blessed are you poor." It is the literal poor who are in a position to grasp what Jesus is about. The 513 5"1~1 / Review for Religious, July-August, 1982 woes of Jesus upon the rich are full of pathos. Tragically the wealthy are in the wrong life-situation to grasp the good news of Jesus. The only hope for such people is to sell all that they have and give it to the poor. As St. Luke puts it, "Sell your possessions and give alms; provide yourselves with purses that do not grow old, with a treasure in the heavens that does not fail, where no thief approaches and no moth destroys. For where your treasure is, there will your heart be also" (Lk 12:33-34). In pointing to the heart, St. Luke touches upon the ultimate danger of riches. The man who piles up material things becomes a slave to the mentality of having so that he is no longer free to be himself. He so identifies himself with what he has that he is no longer free to be open to receive God's gift. God can only give his kingdom to the man who is poor enough to want to receive. Therefore, St. Luke's attitude to material things is to get rid of them as encumbrances to that openness necessary for accepting the good news. The gospel attitude to poverty operates on two levels. There is no escaping the fact that Jesus recommends real poverty but real poverty is for the sake of spiritual poverty. The latter is the ultimate goal but we deceive ourselves if we think we can achieve the one without the other. Bonhoeffer, in meditating upon the story of the rich young man in the gospels, suggests the kind of rationalization which we are all prone to make: "Jesus may have said: 'Sell thy goods', but he meant 'Do not let it be a matter of consequence to you that you have outward prosperity: rather keep your goods quietly, having them as if you had them not. Let not your heart be in your goods.'" Bonhoeffer rightly comments that such rationalizations prevent us from submitting to that single-mip, ded obedience to the word of the Lord which he demands. If Jesus demands both real and spiritual poverty from his followers, he has himself first embodied both these dimensions of poverty in his own life. The actual poverty of the man who began life in the stable and ended it on the gallows points to the spiritual poverty of the man for others, the one who loses his life to find it, who loves his own to the end. The actual poverty of Jesus thus points to the deeper poverty of his entire being. As Son of the Father he has nothing of his own. It is literally his nature to receive his entire being from his heavenly Father. And all that he receives he passes on in turn to his disciples. "All that 1 have heard from my Father I have made known to you" (Jn 15:15). The deepest poverty of Jesus then is the poverty which he has at the heart of the Trinity, a poverty which reveals itself in the incarnation. Grasping and possess-ing are so alien to his being that even his equality with God is not something to be clung to. Rather, as Paul says, Jesus emptied himself taking the form of a servant. He divests himself even of the form of his divinity. Paul sees that there is a logic which binds incarnation and poverty together. For what the incarnation means is precisely this: "He who was rich, for our sake became poor" (2 Co 8:9). And as the apostle further perceived, the sharing of our humanity contains already within it the risk of our rejection and the shadow of the cross. What then does this poverty of Christ mean for us, men and women of the Poverty and Incarnation / 515 twentieth century, who desire to be his disciples? Fundamentally it would seem that we are required, as Paul says, to put on the mind of Christ. The heart of his mentality is, as the incarnation attests, the self-emptying love of the servant of others. Matthew no doubt grasped this .point accurately when he modified the first beatitude to read: "Blessed are the poor in spirit." But poverty of spirit without actual poverty would be a rationalization and compromise of the gospel. For there is no way around the stumbling block that the God of Jesus is a God who is a partisan of the poor, the defender of the widow and the orphan, the champion of the oppressed, the seeker of the lost. God has identified himself with the outcast and those on the margins of respectability. The irrevocable event of this identification is the cross of the Jesus who died con-demned as a blasphemer and a rebel. In this event it becomes transparently clear that power-seeking is utterly alien to the being of God. This is the stumbling block which shatters the illusion that we can create an identity by grasping and self-assertion. The gospel proclaims that the weakness of God is stronger than men. If a man is truly grasped by this gospel, he cannot do otherwise than divest himself of possessions, not because he despises material things but because he is as restless as Jesus for the kingdom. And knowing who God is he wants to identify himself where God has identified himself, with the poor and the oppressed. It is not just a question of helping others. It is a question of identification. The man who believes the gospel of Jesus about the kingdom, who believes the gospel about the cross literally finds God hidden under His contrary in the ongoing suffering of the world. And here is perhaps the greatest challenge facing the contemporary disciple. There was a time when the gospel could be preached and understood in more individualistic categories. The neighbor with whom Christ identified was the man next door, the poor and needy of the village, other members of my family. But today it is impossible to identify with my neighbor unless I think in global terms. Our planet has become so small and the network of relationships so intertwined that one inevitably bears a responsibility for the suffering of men and women everywhere in the world. In 1980 the Brandt commission reported such statistics as the following: the northern hemisphere including Eastern Europe has a quarter of the world's population and four-fifths of its income: the southern hemisphere including China has three billion people, three quarters of the world's population but living on one-fifth of the world's income. Eight hundred million people are estimated to be destitute in the Third World today. It is estimated that hundreds of millions die from lack of food or will have their physical development impaired. The consumption of energy per head in industrialized countries compared to middle-income or low-income countries is in proportion of 100:10:1. Total military expenditures are approaching $450 billion a year, of which over half is spent by the Soviet Union and the United States, while annual spending on official develop-ment aid is only $20 billion. One could argue that such statistics reveal an injustice of tragic proportions according to the norms of any humanistic ethics. But for a Christian it is more 516 / Review for Religious, July-August, 1982 than a question of justice. It is the logic of God's love which impels him. If God's being is self-emptying love, if his preferential love is for the poor and powerless, then the disciple who accepts this transvaluation of all ~?alues cannot help but be in deep pain as he is assaulted by the suffering cries of the millions of the poor of the earth. He cannot help but want to identify with them and their plight, for he sees God's face in them. The more deeply one penetrates the mystery of the God of Christian faith, the more one sees the intrinsic connection of the incarnation and the cross. For incarnation is God's identification with creatureliness, finitude, powerlessness. And the ultimate consequence of this identification is the powerlessness of God in the cross of Jesus. To accept Jesus and his Father implies our taking this same powerlessness upon ourselves and our identification with the powerless of the earth. Paradoxically the more one loves this world, the more one is led in love to divest oneself of this world's goods in order to identify more completely with the dispossessed. In our own time it would seem that an authentic Christian spiritual-ity will call not for less poverty but for more. Meditating upon the massive proportions of human suffering, we cannot help but feel compelled to pray not only for the spiritual poverty of self-emptying love but for the grace to identify with the fate of the actually poor as well. The Contemporary Spirituality Of the Monastic Lectio .by Matthias Neurnan, O.S.B. Price: $.50 per copy, plus postage. Address: Review for Religious Room 428 3601 Lindell Blvd. St. Louis, Missouri 63108 Parables and Paradigms: Jesus' Journey and the Search for God Anthony Wieczorek, O.Praem. Brother Wieczorek, a seminarian, has taught courses on prayer and mysticism in the Continuing Education Department at Cardinal Stritch College (Milwaukee) and the Ministry and Life Center at his abbey: he lectures at St. Norbert College (De Pete). He resides in St. Norbert Abbey: De Pere. WI 54115. Scripture is the saga of a long and mutual search. God encourages and empow-ers all people to "seek God, in the hope that they might feel after him and find him. Yet he is not far from each one of us, for 'in him we live and move and have our being.'" (Ac 18:27-28: all Scripture verses are from the RSV). At the same time as we search for God, he searches for us. So much the searcher is God, so great is his longing for us, that "though he was in the form of God, he did not deem equality with God a thing to be grasped, rather he emptied himself, taking the form of a servant" (Ph 2:6). God gives us an example of how to find him and be found by him in the life of the God-man, Jesus. Nowhere is the search in all its varied hues of meaning, or the spiritual life in all its mysterious rhythms, more clearly seen than in the life of Jesus, the Proto- Searcher. The life of Jesus is itself a parable and paradigm which describes the ebb and flow of the search for God in true fullness and balance. Some insight into the movements of the spiritual life can be gleaned from the following section of Mark's gospel. In those days Jesu~ came from Nazareth in Galilee and was baptized by John in the Jordan. And when hc came up out of the water, immediately he saw the heavens opencd and the Spirit dcsccnding upon him like a dove: and a voice came from heaven: "'You are my beloved son: with you I am well pleased." The Spirit immediately drove him out into the wilderness. And he was in the wilderness forty days. tempted by Satan: and he was with the wild beasts: and the angels ministered to him. 517 5"11~ / Review for Religious, July-August, 1982 Now after John was arrested, Jesus came into Galilee. preaching the gospel of God. and saying: "'The time is fulfilled, and the kingdom of God is at hand: repent and believe in the gospel." That evening at sundown, they brought to him all who were sick or possessed with demons. And the whole city was gathered together about the door. And he healed many who were sick with various diseases, and cast out many demons: and he would not allow the demons to speak, because they knew him. And in the morning, a great while before day, he rose and went out to ~ lonely place, and there he prayed. And Simon and those who were with him pursued him, and they found him and said to him: ~'E\'ery one is searching for you." And he said to them: "l,et us go on to the next town. that I may preach there also: for that is why I came out"(Mk 1:9-15, 32-38). At least three movements with regard to the spiritual life are visible from this text: the journey of the Father to the Son (Jesus' baptism): the journey of the Son to the Father (Jesus" flight into the wilderness): and the journey of the Father with the Son (Jesus' return to Galilee). The Journey of the Father to the Son In Jesus' baptism the Father reached out to touch his Son. It is always God who initiates the search. Our search is a response to a search on the part of God. We seek and find because we have first been sought and found. What drew Jesus on to the Jordan'? May it not be the same as what draws us on to search for God? For a few, the spiritual life begins with an overwhelming experience of God's presence, an experience powerful enough to sustain them for years of diligent and serious searching. St. Paul's experience of the Risen Christ may be one such example. Many of us, though, are like Augustine. We search out of a want, a need, a hunger for something we do not possess or perhaps even know. God oftentimes initiates the spiritual life with a gift of hunger and longing, with emptiness rather than fullness. We are led on by the reality of our own emptiness. We may not know what we want but we know what we don't have. God some-times initiates the search with an itch. There is a wisdom in this that is often overlooked. The emptiness in which we find ourselves contributes to a condition of desperateness. No one is more ripe or willing to attempt an unheard-of cure or course of action than one who is truly desperate. Only one who has been readied by emptiness, hunger, and longing can respond to the impossible call of following God. Sometimes that hunger can build for years. Or, it may suddenly poke into consciousness even in lives which, in the eyes of the world, should be quite content and satisfied. For example, more and more people feel drawn to religious life during their middle-years, or at least at an age later than had been the norm. Whether their decision to pursue a religious life was a sudden thing or the result of many years of discernment, their choice to abandon one way of life and follow another is a response to a summons that is as persistent as it is intangible. Perhaps it is no accident that Jesus was well into adulthood when he was Parables and Paradigms / 5"19 .baptized. Maybe Jesus had tried to put off his call? Maybe Jesus was drawn to the Jordan by a hunger he had always had but which the Scribes and Pharisees could not satisfy? Jesus' baptism was itself the result of a search: it was the culmination of a decision to believe. Jesus' baptism was a surrender to the Father which involved the acceptance of a call and the attempt at a response. Therefore, Jesus' baptism was the beginning of another search to understand what the Father wanted of him. For Jesus, as for us, the completion of one search--the decision to believe--led to the commencement of another: what form of response is our belief to take? The Journey of the Son into the Father How strongly it is put in Mark's gospel, "The Spirit immediately drove him into the wilderness." Yet, it is not hard to imagine being so overwhelmed by an experience. There have been times in each of our lives when we felt swept away by the devotion of a friend, by an act of love, by a singular twist of fate. Overwhelm-ing experiences often leave us puzzled or speechless as well as joyous and grateful. Afterwards, we feel the need to wander off for a bit, to be alone to consider what really happened and ponder the reasons and implications for our lives. Jesus was overwhelmed at his baptism. The Spirit that drove him into the wilderness was bestowed through the power of God's presence, a presence that possessed him and forced him to try to understand more fully what had happened. The flight of Jesus into the desert can be seen as his search to understand the experience of his baptism. Our response to any situation is mediated by our understanding of what took place. To understand something, though, is not primarily to know about it objec-tively. To understand means to enter into another reality. Understanding does not refer to the ability to master the secret of some mystery. Rather, to truly under-stand someone or something, it is necessary to surrender oneself to it. to pass into it, to participate in it from the inside. When Jesus went into the wilderness he sought the time and space to under-stand the reality of what had happened at the Jordan, to enter into it, to submit himself to it. By leaving his former life behind and going out into the wilderness, Jesus was saying "yes" (2 Co I: 19) to the possibility of entering into a new life. His quest for understanding involved his submission to faith, his entrance into faith, and his participation in the presence and activity .of the Father. The understanding Jesus attained was the understandiffg available only to those who know through loving. Through the bond of love people can know not only what others are thinking but also what is in their hearts. It is by loving that we enter into the life of another, that we can acquire "inside" understanding. Such understanding cannot be earned or purchased: it is the free gift of one person's self-revelation to another. The knowing that comes from loving comes from open-ing up and sharing the heart of another. At Jesus' baptism, the Father opened up his heart to the Son. Jesus' wilderness journey was a searching through the Father's heart. Such a journey can only be made if the giving and revealing are mutual. Therefore, Jesus had to open his heart to the Father. However, by doing 520 / Review for Religious, July-August, 1982 so he opened it to himself as well. We cannot know God and participate in his life if we remain strangers to ourselves. Understanding comes by loving, and loving is a mutual and freely given gift. If we want to know God and search through his heart we must be willing for the same thing to be done to us. But God will not enter where he is not welcomed. We must guide God through our own hearts, even though they are foreign and frightening. In making a commitment to know God, we make a commitment to know ourselves. The search for God will bring us face to face with reality, with the truth about ourselves. When he shows us himself, God also discloses the truth about ourselves. We cannot hide from one without hiding from the other. We cannot know the one without knowing the other. The wild beasts among whom Jesus lived (Mk 1:13) were not all external creatures. Jesus would have also lived with all the urgings and desires of himself. Luke's gospel brings out some of this in his temptation account (4: I- 13). Jesus had to accept even the beasts within him and we are called to do the same. To spend time alone with God means spending time alone with ourselves in the haunts and wilds of our own hearts. There can be no conversion if we do not first know the truth about ourselves, both our strengths and weaknesses. The Journey of the Father with the Son In the third movement of his spiritual life, the tide which drew Jesus into the wilderness now leads him back. It .is important to see Jesus' return to the people of Galilee not as a separate mission but as a continuation of the one search that led him into the wilderness. The spiritual life as lived by Jesus is not an individual venture, not merely a way of achieving personal self-fulfillment. It is, rather, a way of responsible involve-ment in the lives of others, a life of compassion and service. The temptation we face is to view the spiritual life as a "me and Jesus"enterprise which lifts us beyond the troubles of life. To live as Jesus lived, however, is to live in the service of the whole human family. We characterize the spiritual life as one of serene detachment, blissful tran-scendence from the everyday world. This is not Jesus" spirituality. He did not leave the wilderness to complete his search in even greater isolation. He returned to Galilee because only there could he fully live the search. Only by participating in the life of the world could he enter fully into the life of God. Jesus' search drew him into deeper participation in the love of the Father. God is not a God who remains untroubled by the plight of his people. He is not an indifferent God. Throughout the Old Testament, God continually acts within the realm of history to redeem Israel by empowering people to meet the challenges of the times. The God of Jesus is the God who raised up Moses to lead his people out of slavery. God took Moses out of the solitary life of shepherding and thrust him into the very heart of the social and political arena of his day--even though Moses claimed he Parables and Paradigms / 521 was not equal to the task. The same was true for the Judges who led the people out of the threat of military conquest. God also empowered the prophets to speak on his behalf, taking, in the case of Amos, a vine dresser and making of him a missioner who confronted the social and religious injustice of the northern kingdom. We misunderstand the spiritual life if we sit back and wait until our spiritual lives are all in order before we enter the world of human needs. God takes the weak and makes them strong (I Co 1:27). He begins our transformation in the crucible of solitude but, for most of us, completes it in the arena of apostolic involvement. It was after John had been arrested that Jesus returned to Galilee. To be sure, Jesus considered John a prophet. Did Jesus feel called to "take up the torch" carried by John'? The search of Jesus led him into the responsibility of loving, as the Father loves. The return of Jesus to Galilee was response of love, not only toward the Father, but to all those whom the Father loved. Notice that Jesus came to Galilee, to the home of the outcast and oppressed, to empower the little people, to assure them they had not been forgotten by the Father. Jesus preached with both word and deed. He spoke and acted out of the Father's love. He proclaimed the fullness of time, the passing of the old age, the coming of the kingdom. He taught the necessity of conversion, of turning our lives around to face God (Jr 7:24). He proclaimed a kingdom where faith replaces distrust, love replaces the equity of finance, and understanding replaces judgment. To follow in Jesus' way, we are meant to be heralds and healers, echoing the Word with the quality of our lives. The healing Jesus brought answered a need that went much deeper than bodily illness. The town that gathered about his door (Mk 1:33) sought someone to heal them of doubt; he gave them someone to believe in. They needed to be healed of confusion: he gave them understanding. They needed to be healed from prejudice: he gave them love. They needed to be healed of their aimlessness: he gave them a way to follow. He healed them and so made them ready to undertake his own search. He restored their sight that they might see the way. He gave strength to their limbs to ready them for the march. He expelled the demons which bound them in fear to an age out of which they were afraid to pass. It must have been quite a switch from the solitude of the wilderness for Jesus to have found himself surrounded by demanding people. Yet, despite that switch, Jesus' ministry was a continuation of his interior search to follow the Father. He had .journeyed far down the road of faith during that day of preaching and healing. It is no surprise that Mark describes Jesus going out to a lonely place and praying (Mk 1:35). He had come a long way in a short time: from carpenter to hermit to preacher and healer. What went on within his heart? Had Jesus left the wilderness expecting to be a local prophet like John'? Had the need of the crowd spoken to Jesus of a new sense of ministry? God acted upon Jesus no less in his ministry than in the solitude. The scene may have changed but the voice still called. But what did it say? How had the new 522 / Review for Religious, July-August, 1982 forum altered the message? One step leads to another but where does the path lead? Where does the journey end? What is the price we must pay for following a whisper? Did these questions plague Jesus as they do those who follow him? For whatever reason, Jesus sought out the wilderness to again comprehend what had happened. He needed time to pray and reflect and understand where the Spirit had taken him and where he was to go. Blazing a trail is a much different matter than simply following one. We too need to withdraw from time to time to ponder the advents of the Lord in our lives. How has he spoken? What did he say? The voice is rarely so clear as to leave us certain. God speaks through daily events, but what does he say? Moreover, the hectic pace of life can cloud our sense of vision and distort our perception of the call. Living leaves us tired and numb. So many other issues seem more pressing than our private prayer. Amid the myriad tragedies of life, the pointless suffering and rampant injustices, how can we continue to thank and praise God? Life points more to the absence of God than to his presence. All this points to the necessity of continuing the search in the solitude of our hearts. The spiritual life is a relationship and no relationship is maintenance free. We need time for prayer and reflection if our spiritual life is to continue growing. It is no secret what happens in a marriage when the lines of communication falter and break down. Yet the time for prayer and solitude with the Lord is not simply a time to be "recharged," as though the Spirit were but a battery which served as a power source for our personal ministry. Our time alone is more than a time to be recharged; it is a time to grow in relationship with God, to share with him person to person. We withdraw for solitude out of the longing of lover for beloved. Jesus' solitude was interrupted by Simon's statement: "Everyone is searching for you." This was a time of decision for Jesus. He could stay where he was and let the people flock to him. Yet, this was not enough, he could not wait for them to find him. "Let us go out into the next town, that I may preach there also: for that is why ! came out" (Mk 1:38). A moment of insight, perhaps, when Jesus understood why he had left the serenity of his solitude with the Father and undertaken to come out and serve the people? He had left the wilderness not only to be found but to seek out and find a people who had become lost and scattered. Jesus, the Searcher- God, saw his mission as a search for the very people who sought him. He would not remain in one place as though he were the end of the search--he was the Way, the proto-type of searching. Those who followed him would be led by his light and come into the truth. He would tell them the way to go and show them the way to follow. The Son would become the shepherd, leading the Father's flocks back into their own pasture