Every year, through mass drug administration (MDA), hundreds of millions of the world's poorest people receive a single annual dose of one or more drugs to eliminate certain parasitic worm or bacterial infections. Some of these infections, mostly prevalent in tropical areas, have traditionally been neglected from the public health and research point of view. These conditions, collectively known as the neglected tropical diseases (NTDs), still cause, at the cusp of the second decade of the 21st century, a significant amount of morbidity and mortality. The existing control measures for NTD have an enormous potential, although there are still some challenges that require further investigation. For some diseases, alternative strategies may be needed, including longer duration of MDA programmes or modified drug regimens. For other diseases, such as yaws, the work must start almost from scratch, since little has been achieved in terms of control of this disease in the past 50 years. Although eight NTDs affect the region, two diseases pose a major public health problem in the South Pacific Islands, namely yaws and lymphatic filariasis and are the basis for his thesis. These two infections were selected for a number of reasons. First, they affect the South Pacific region disproportionately. Secondly, little research has been conducted in the past years. And third, but more importantly, several epidemiological, technological and historical factors make these two diseases amenable to elimination. Safe and effective tools and interventions to achieve these targets are available and concerted efforts to scale them up are likely to lead to success. Yaws is one of the most neglected of the NTDs. Yaws was one of the first diseases to be targeted for eradication on a global scale, efforts which almost led to the disease disappearance as a result of a massive treatment program started in the 1950s. After the successful eradication campaigns the primary health care systems were supposed to give the last push towards eradication of yaws. However a combination of various factors including poor political commitment and limited funding resulted in a progressive abandonment of efforts and the resurgence of the disease. Every new case of yaws was the disappointing confirmation that the public health world had missed a great opportunity. Today yaws has resurged in many tropical areas and presents new challenges including its unknown epidemiological situation, the attenuated clinical forms of the disease, a poor awareness and knowledge among health care workers, the lack of knowledge about the effectiveness of classic treatment with penicillin and, an obvious need for research into simplified administration schemes or new antibiotic treatments, particularly oral ones. There is an enormous knowledge gap regarding current reliable epidemiological information about the disease. Certainly we know little about the burden in the three Melanesian countries where the disease is highly endemic, Papua New Guinea, Solomon Islands and, Vanuatu. In Solomon Islands and Vanuatu there are indications that Yaws is widespread and prevalent, but we know that the diagnosis is unreliable. This takes us to the next point, what does a diagnosis of yaws mean? Overall the natural history of the disease in this era, where it is often subject to inadequate antibiotic pressure, is very unclear. Some authors have suggested that yaws appears to be attenuated in both Solomon Islands and Vanuatu. They state that bone involvement in yaws is now rare and implies that yaws is a mild disease not requiring efforts for elimination. However, the first paper of this thesis describes the epidemiology of yaws in Lihir Island (Papua New Guinea, PNG) and shows a high rate of classical primary ulcers (almost 60%) and significant bone and periosteal involvement (more than 15%), suggesting that "attenuation" is not an important issue. When we look at the diagnostic criteria for yaws, signs and symptoms alone are still used often in many areas to diagnose the disease. This reliance on clinical findings was the result of the difficulty of performing serological tests in remote areas. Today, available rapid serological tests are simple, rapid, inexpensive and useful for guiding confirmation of cases, making them adequate tools for the diagnosis and monitoring of the disease. The clinical diagnosis of yaws is complicated because its clinical manifestations may be unspecific. Thus, it is possible that a significant proportion of yaws cases may in fact have been falsely diagnosed. We show, in the first article, that in our experience only 60% of the cases with a clinical suspicion of yaws were finally confirmed by serologic tests. Therefore, a proper diagnosis of yaws requires the interpretation of clinical findings with reference to laboratory results and the epidemiologic history of the patient. Serological testing in yaws is not only important for diagnostic accuracy, but also is very helpful in defining the disease's evolution and eventual cure after treatment. Rapid plasma regain (RPR) titres should decline within 6-12 months, becoming negative in less than 2 years. The second article of this thesis combines a clinical and serological approach to assess the response after treatment with benzathine benzylpenicillin, and it identifies an overall 20% treatment failure. This could be related to resistance to the antimicrobial drug used or to re-infection caused. The distinction between re-infection and true resistance to antibiotic treatment is difficult to make but these failures are worrisome. This article also proposes a multivariate model performed to identify independent determinants of failure that affected the outcome after treatment. The risk for reinfection caused by repeated contact with infected children seems to be a pivotal predictor of failure. Low baseline titters (<1:32) of RPR are also an important and independent predictor of failure, possibly as a result of the greater difficulty in resolving chronic infections which are usually accompanied by low titters. With yaws re-emerging, the development of new strategies against this infection aimed at simplifying its treatment and potentially re-focussing strategies towards its eradication seems essential. Injectable penicillin is still effective but management with an oral drug that can be easily administered on a large scale should be the preferred method for treatment. To date, there had been no studies that directly compared the efficacy of penicillin with any of the potentially alternative agents shown to work in the treatment of the non-venereal treponematoses. The fourth paper in this thesis has shown that a single-dose of oral azithromycin is non-inferior to benzathine benzylpenicillin for the treatment of yaws in children in PNG. In an open-label randomised trial, at 6-month follow-up, 96% of patients treated with azithromycin were cured, as were 93% in the benzathine benzylpenicillin group. The prospects of eliminating and eventually eradicating yaws may now be enhanced by the use of a single-dose of oral azithromycin in mass drug administration campaigns. Community based mass administration of azithromycin has been widely used in many locations for the control of trachoma, which, like yaws, is a disease of poor rural communities in developing countries, and has been used in a more limited way to control granuloma inguinale and outbreaks of venereal syphilis. Elimination of yaws and lymphatic filariasis in the South-Pacific Islands is now considered biologically feasible and programmatically attainable. The Global Programme to Eliminate Lymphatic Filariasis (GPELF) has expanded quickly to reach the target of elimination by 2020. On the other hand the strategy to eliminate yaws is again at the centre of discussions and given that infected humans are the only source of disease, its eradication could be achieved within a very relatively short time. The fifth article of the thesis comprehensively reviews antimicrobial treatments and elimination strategies against yaws. In order to control yaws and push it towards elimination, we propose to move away from penicillin to azithromycin and use mass treatment campaigns of the entire population in endemic communities irrespective of the prevalence. Also, to make sure all cases are tracked down and treated, strict follow-up measures and selective mass treatment will be required until zero case prevalence is reached. Importantly, we suggest testing the principle of interrupting transmission in pilot implementation studies, including prevalence surveys to assess the impact of the intervention and macrolide resistance monitoring which in our opinion will be essential evaluation tools to guide us towards a sustainable elimination. Lymphatic filariasis (LF), caused by the mosquito-borne nematode Wuchereria Bancrofti, is a major public-health problem in the Melanesian countries. Annual MDA over five years is currently the WHO's recommended strategy to eliminate lymphatic filariasis. This approach aims to suppress microfilaraemia in infected individuals and bring the infection below a threshold that leads to interruption of transmission. However theoretical work and clinical field experience has highlighted how the ecological diversity between different endemic regions can result in elimination thresholds that vary between local communities. This means that the duration required might be different for different areas. Other variables have also been previously identified as potentially having an influence on the outcome of the program, including baseline prevalence of infection, vector density or the treatment coverage. The last article of this thesis provides data about the impact of a five-year filariasis control program in Papua New Guinea. The findings reported support this strategy for areas with low-to-moderate rates of transmission in regions where anopheline mosquitoes transmit this infectious disease. Additional measures or longer periods of treatment may be necessary in areas with a high rate of transmission. The experience acquired on Lihir Island in MDA programs during the campaigns for the elimination of filariasis, will be very valuable when implementing a pilot strategy for yaws control. Also, in the near future it might be important to link yaws mass treatment with other mass programmes to increase efficiency. The plan for elimination of lymphatic filariasis in PNG was approved as a pilot project in 2005 but the program still needs to be extended to the total of 20 provinces in the country where filariasis is endemic. In this context, an integrated approach to NTD control could represent an important global public health solution in PNG and other South Pacific Islands. Little has been achieved in the past decade in NTDs. We are now in a good position to translate into policies the results of our research projects. A new elimination policy for yaws around the azithromycin pillar has been sketched a WHO consultation meeting held in Morges, Switzerland last March. In the intentions of the organization, a last global mass campaign to tackle yaws should permit to reach zero cases in 2017, and the subsequent certification of worldwide interruption of transmission by 2020. ; Cada año, a través de la administración masiva de medicamentos (MDA), cientos de millones de personas, las más pobres del mundo, reciben una dosis única de uno o más medicamentos para eliminar ciertas infecciones, parasitarias o bacterianas. Algunas de estas infecciones, frecuentes sobre todo en las zonas tropicales, han sido tradicionalmente desatendidas desde el punto de vista de salud pública e investigación. Estas enfermedades, conocidas comúnmente como las enfermedades tropicales desatendidas (ETD), aún causan, en el inicio de la segunda década del siglo 21, una cantidad significativa de morbilidad y mortalidad. Las medidas de control actuales para ETDs tienen un enorme potencial, pero todavía existen algunas cuestiones que requieren investigación. Para algunas de estas infecciones, son necesarias estrategias alternativas, incluyendo una mayor duración de los programas de MDA o regímenes modificados de medicamentos. Para otras enfermedades, como la enfermedad de pián, el trabajo debe comenzar casi desde cero, ya que poco se ha logrado, en términos de control de esta enfermedad, en los últimos 50 años. Aunque ocho ETDs afectan a la región, dos enfermedades constituyen un problema importante de salud pública en las Islas del Pacífico Sur, a saber: el pián y la filariasis linfática y son la base de esta tesis. Estas dos infecciones fueron elegidas por muchas razones. En primer lugar, afectan a la región del Pacífico Sur de forma desproporcionada. En segundo lugar, pocas investigaciones se han llevado a cabo en los últimos años. Y en tercer lugar, pero lo más importante, varios factores epidemiológicos, tecnológicos e históricos hacen que estas dos enfermedades sean susceptibles de eliminación. Existen armas terapéuticas seguras y eficaces para lograr este objetivo, y esfuerzos coordinados para ejecutar los programas de control pueden conducir al éxito. El pián es una de las más olvidadas de las ETDs. Ésta fue una de las primeras enfermedades en ser objetivo de erradicación a escala global. Los esfuerzos de un programa de tratamiento masivo, que se inició en la década de 1950, casi llevaron a la desaparición de la enfermedad. Después de las exitosas campañas de erradicación, los sistemas de salud de atención primaria debían dar el último empujón hacia la erradicación del pián. Sin embargo, una combinación de varios factores, incluyendo un pobre compromiso político y una financiación limitada, dieron como resultado el abandono progresivo de los esfuerzos y el resurgimiento de la enfermedad. Cada nuevo caso de pián era la decepcionante confirmación de que el mundo de la salud pública había perdido una gran oportunidad. Hoy la enfermedad de pián ha resurgido en muchas áreas tropicales con nuevos desafíos: una situación epidemiológica desconocida, formas clínicas atípicas o atenuadas, poco conocimiento de la enfermedad entre el personal sanitario, la falta de datos acerca de la eficacia del tratamiento clásico con penicilina inyectable y la necesidad de desarrollar esquemas terapéuticos simplificados o investigar en nuevos tratamientos antibióticos, en especial de administración oral. Actualmente hay una enorme brecha de conocimiento entorno a la información epidemiológica fiable sobre la enfermedad. Ciertamente, sabemos poco acerca de la incidencia en los tres países melanesios, donde la enfermedad es altamente endémica, Papúa Nueva Guinea (PNG), Islas Salomón y Vanuatu. En las Islas Salomón y Vanuatu, las cifras de incidencia son muy altas lo que demuestra que el pián es una enfermedad frecuente y ampliamente extendida, pero sabemos que el diagnóstico no es muy fiable. Esto nos lleva al siguiente punto: ¿Cuáles son los criterios diagnósticos del pián? En general, la historia natural de la enfermedad en la época actual, donde la bacteria es objeto de presión antibiótica inadecuada, no es muy clara. Algunos autores han escrito que el pián parece presentar manifestaciones "atenuadas" en las Islas Salomón y Vanuatu. Afirman que la afectación ósea en el pián es poco frecuente, lo que implica que el pián es una enfermedad leve que no requeriría esfuerzos para su eliminación. Sin embargo, el primer trabajo de esta tesis describe la epidemiología del pián en la Isla de Lihir (Papúa Nueva Guinea) y muestra una alta tasa de úlceras primarias clásicas (casi el 60% de casos) y una afectación significativa del hueso y periostio (más del 15%) que sugiere que la "atenuación" no es un tema importante. Cuando nos fijamos en los criterios diagnósticos, únicamente signos y síntomas todavía se utilizan en muchas áreas para el diagnóstico de la enfermedad. Esta confianza en los hallazgos clínicos fue el resultado de la dificultad de realizar pruebas serológicas en las zonas remotas. Hoy en día, las pruebas serológicas rápidas son simples, rápidas, económicas y útiles para orientar la confirmación de los casos. El diagnóstico clínico del pián es complicado debido a que sus manifestaciones pueden ser inespecíficas. Así, es posible, que una proporción significativa de los casos de pián puedan haber sido falsamente diagnosticados. En el primer artículo, presentamos que, en nuestra experiencia, sólo el 60% de los casos con sospecha clínica de pián fueron finalmente confirmados por pruebas serológicas. Por lo tanto, un diagnóstico adecuado del pián requiere la interpretación de los hallazgos clínicos con referencia a los resultados de laboratorio y la historia epidemiológica de los pacientes. Las pruebas serológicas en el pián no sólo son importantes para el diagnóstico de la enfermedad, también son muy útiles en la definición de curación después del tratamiento. En la prueba de la Reagina plasmática rápida (RPR) los títulos deben descender a los 6-12 meses, llegando a ser negativa en menos de 2 años. El segundo artículo de esta tesis combina un enfoque clínico / serológico para evaluar la respuesta a bencilpenicilina benzatina, e identifica una tasa de fracaso terapéutico del 20% a los 12 meses del tratamiento. Esto podría estar relacionado con resistencia al fármaco antimicrobiano, o bien indicar una re-infección por re-exposición. La distinción entre la re-infección y la resistencia verdadera al tratamiento es difícil, pero estos fracasos terapéuticos son preocupantes. En este artículo se describe un modelo multivariante realizado para identificar los factores determinantes del fracaso terapéutico. El riesgo de re-infección causado por el contacto repetido con otros niños infectados parece ser un predictor fundamental de fracaso. También es un factor de riesgo, los títulos basales bajos (< 1:32) de RPR. Este último factor podría estar relacionado con la mayor dificultad para resolver infecciones crónicas (en estadio secundario), habitualmente acompañadas de títulos bajos. Con la enfermedad de pián re-emergiendo, el desarrollo de nuevas estrategias contra la infección para hacer más fácil los esfuerzos de erradicación es esencial. La penicilina inyectable sigue siendo eficaz, pero el tratamiento con un fármaco por vía oral que pueda ser fácilmente administrado a gran escala es el método preferido para el tratamiento, prevención y finalmente eliminación en todas las regiones endémicas del mundo. Hasta la fecha, no ha habido estudios que comparen directamente la eficacia de la penicilina con cualquiera de los agentes alternativos en el tratamiento de las treponematosis no venéreas. El cuarto artículo de esta tesis ha demostrado que una dosis única de azitromicina por vía oral no es inferior a la bencilpenicilina benzatina intramuscular, para el tratamiento del pián en niños en Papúa Nueva Guinea. En un ensayo abierto, aleatorio, el 96% de los pacientes tratados con azitromicina estaban curados a los 6 meses de seguimiento, al igual que el 93% en el grupo de bencilpenicilina benzatina. Las perspectivas de finalmente erradicar el pián son ahora mayores, mediante el uso de una dosis única de azitromicina oral en campañas masivas de tratamiento. El tratamiento masivo con azitromicina ha sido ampliamente utilizado para el control del tracoma, que, al igual que el pián es una enfermedad de comunidades rurales pobres de países en desarrollo. También se ha utilizado de una manera más limitada para controlar el granuloma inguinal y brotes de sífilis venérea. En general, el uso de azitromicina ha demostrado ser seguro, y de hecho ha habido beneficios inesperados de salud en algunos programas. La eliminación del pián y la filariasis linfática en las Islas del Pacífico Sur se considera ahora biológicamente factible y operacionalmente alcanzable. El Programa Global para Eliminar la Filariasis Linfática (GPELF) se ha expandido rápidamente para alcanzar la meta de eliminación en el año 2020. Por otro lado la estrategia para eliminar el pián es nuevamente centro de atención. Además, dado que los seres humanos infectados son la única fuente de la enfermedad, su eliminación podría lograrse en un plazo relativamente corto. El quinto artículo de la tesis revisa de forma integral el tratamiento con antimicrobianos y las estrategias de eliminación contra el pián. Con el fin de controlar el pián hasta la erradicación, se propone pasar de la penicilina a la azitromicina, y el uso de campañas de tratamiento masivo de toda la población en todas las comunidades endémicas. Además, para asegurar que todos los casos son encontrados y tratados, serán necesarias medidas estrictas de seguimiento y tratamiento masivo selectivo hasta llegar al objetivo de cero casos clínicos. Es importante destacar que el principio de interrupción de la transmisión se debe probar en estudios piloto, incluyendo estudios de prevalencia, para monitorizar el impacto de la intervención, y también la valoración de resistencia a macrolidos, que en nuestra opinión, serán herramientas fundamentales que nos guíen en el camino hacia una eliminación sostenible La filariasis linfática (FL), causada por el nematodo Wuchereria bancrofti, es otro de los grandes problemas de salud pública en los países de la Melanesia. Un curso de MDA anual, durante cinco años, es la estrategia que la OMS recomienda para eliminar la FL. Este enfoque tiene como objetivo suprimir la microfilaremia en los individuos infectados y disminuir los niveles de infección por debajo de un umbral que conduzca a la interrupción de la transmisión. Sin embargo, trabajo teórico y experiencia práctica clínica han puesto de relieve cómo la diversidad ecológica, entre diferentes regiones endémicas, puede resultar en que los umbrales de eliminación varíen en diferentes comunidades. Esto significa que la duración requerida podría ser diferente para diferentes áreas. Algunas variables que han sido previamente identificadas como potenciales determinantes en el resultado de un Programa para la eliminación de FL (PELF) son la prevalencia basal de infección por filariasis, la densidad de vectores (mosquitos) o la cobertura del tratamiento en la población. El último artículo de esta tesis, proporciona datos sobre el impacto de un PELF de cinco años en PNG. Los resultados obtenidos apoyan la estrategia descrita para las zonas con baja a moderada tasas de transmisión en regiones donde mosquitos anofelinos transmiten la infección (pe. Melanesia, África). Medidas adicionales o períodos más largos de tratamiento pueden ser necesarios en áreas con una alta tasa de transmisión. La experiencia adquirida en la Isla de Lihir en los programas de tratamiento masivo durante las campañas para la eliminación de la filariasis, será muy valiosa en la aplicación de una estrategia piloto para el control del pián. Además, en un futuro próximo podría ser importante vincular los programas para el control del pián con otros programas de tratamiento masivo (por ejemplo, filariasis) para aumentar la eficiencia y reducir los costos. El plan para la eliminación de la filariasis linfática en PNG fue aprobado como proyecto piloto en 2005 en la provincia de Milne Bay. El programa todavía tiene que ser extendido a un total de 20 provincias en el país, donde la filariasis es endémica. En este contexto, un enfoque integrado para el control de enfermedades tropicales olvidadas podría representar una importante solución global de salud pública en PNG. Poco se ha logrado en la última década en enfermedades tropicales desatendidas. Ahora estamos en una buena posición para traducir los frutos de nuestra investigación en políticas de salud. Durante una consulta celebrada en la sede de la OMS en Ginebra el pasado mes de marzo, ya se ha esbozado una nueva política de eliminación para el pián que toma como pilar el tratamiento con azitromicina. La intención de la OMS es que una última campaña global debe permitir llegar a cero casos de pián en 2017, y la posterior certificación de la interrupción de la transmisión en todo el mundo en el año 2020.
La población mundial, que cuenta dos mil millones de habitantes alrededor del año 1950, ha crecido a un ritmo casi exponencial en las décadas siguientes hasta 4 mil millones y 5,3 en 1990 (Naciones Unidas - Departamento de Asuntos Económicos y Sociales, 2010). Sin duda un gran aumento tanto en términos absolutos cuanto relativos. Según las estimaciones de las Naciones Unidas, la población mundial se estima que alcanzará los ocho millones y medio de 2025. Estas tasas de crecimiento se producen, obviamente, tanto en Europa, donde la población ha crecido de 550 millones en 1950 a 750 millones en 2010, y en Italia, donde en el período 1861 a 2008 hubo un aumento de la población de 22 millones de habitantes a casi 60 millones (fuente: ISTAT, 2010). La población ha crecido, sin embargo, a tasas más altas en los países en desarrollo, con una tendencia a la constante en los países industrializados en las últimas décadas. Dicha población mundial intenso tiene consecuencias directas sobre el territorio urbano, mientras que lleva a una extensión de las actuales áreas urbanas menores y pequeñas ciudades. Todo esto, cada vez más, dar lugar a problemas de gestión y uso del suelo, produciendo un crecimiento del componente de la vulnerabilidad en la ecuación de riesgo. Crecimiento de la población no justifica un aumento de las condiciones hidrogeológicas de la inestabilidad. Si es así, ya que la población se ha convertido en firme en los últimos años, al menos en la mayoría de los países industrializados, no hay que hacer frente a riesgos cada vez mayor. En cambio, el modelo de desarrollo económico, basado principalmente en redes e infraestructuras, así como los asentamientos, por supuesto, produce un doble efecto: un aumento de los activos expuestos a la amenaza, una presión sobre el territorio, capaz de hacer la activación de los fenómenos peligrosos más frecuentes. Los fenómenos naturales también tienen un impacto en el marco socio-económico, ya que son responsables de la pérdida de bienes y servicios y, en ocasiones, una pérdida en términos de vidas humanas. En tal situación, la vulnerabilidad de la zona está relacionado con el desarrollo de su sistema de infraestructura social, civil y urbano. Este concepto se expresa claramente en la declaración "Los desastres ocurren cuando los riesgos se encontra con la vulnerabilidad" (Wisner et al., 2004). Esto nos lleva a considerar los desastres naturales como los fenómenos sociales reales. Cuando se habla de riesgo geomorfologicos y de políticas ambientales, uno de los pioneros es, sin duda, Earl E. Brabb, que ya en 1991 en un artículo titulado "El problema de movimientos de ladera del mundo", sostuvo que los deslizamientos son un problema mundial que cientos causa de muertes y miles de millones de dólares de daño cada año en todo el mundo. Los poblemas geomorfológicos son y serán un tema importante y un requisito fundamental del conocimiento para la política de toma de decisiones. A pesar de 20 años han pasado desde que el trabajo Brabb, la situación no parece haber cambiado. No son aún insuficientes los procedimientos de todo el mundo aunque sólo sea compartida que permite evaluar la calidad y precisión de un inventario de deslizamientos o la forma de clasificar en términos de susceptibilidad a los deslizamientos de un área y para evaluar cuantitativa y cualitativamente el rendimiento predictivo. Las imágenes y escenas de devastación, destrucción y muerte que ocurren cada año, hacen que el problema de los riesgos geomorfológicos en un problema social. ¿Quien es el responsable? Seguimos construyendo, incluso en lugares que no son adecuados para la construcción. Tenemos que admitir por lo menos una doble responsabilidad. Si bien es cierto que los acontecimientos que causar un derrumbe apenas son "previsibles", por el contrario sí podemos identificar y predecir donde estos fenómenos se producen con mayor capacidad destructiva, produciendo más daños y reducir al mínimo la vulnerabilidad. Por lo tanto, si no es posible evitar, ya que no es posible predecir, la palabra clave debe ser "la prevención". Cada vez deslizamientos de tierra u otros eventos con características destructivas y letales, que a menudo se supone y se define como "impredecible", nos ofrece con el escenario de las víctimas, los heridos y desaparecidos, el público se estremece y recuerda la vulnerabilidad de los bienes de la comunidad y direciona la discusión sobre el tema de prevención de los desastres naturales o por lo menos tratar de minimizar las consecuencias trágicas que lo acompañan. La ola emocional que sigue a la fase de emergencia se produce entre las llamadas a "enrollar las mangas" a una "cultura de prevención" que "nunca vuelva a suceder", e induce a los legisladores y los técnicos para intervenir con una variedad de medidas urgentes de mitigación y obras y de intervención inmediata, tal vez proponiendo también las regulaciones y leyes dirigidas a "evitar otro desastre similar". Hoy Saponara, ayer Génova, el día antes Giampilieri y San Fratello y así sucesivamente durante décadas: Salerno (1954) con 318 víctimas, 250 heridos y sin hogar cerca de 5.500, y el Longarone y el desastre de Vajont (1963) con cerca de 2.000 muertes de Agrigento, (1966), Valtellina (1987) 53 muertes y 4.000 millones de liras de los daños, el deslizamiento de tierra en el Val di Stava de julio de 1985 (269 muertos), las corrientes rápidas del 5 de mayo de 1998 y Sarno y Quindici y otras áreas de la región Campania, con 153 muertes, Maierato (2010), son algunos de los eventos más importantes que lleva a más de 4.000 las muertes causadas por movimientos gravitativos en medio siglo, un promedio de 4 muertes por mes, además de un daño económico incalculable. Pero cada día hay una lista de los deslizamientos de tierra, carreteras y puentes bajando, a pesar de que pasa desapercibido. A falta de una cultura de prevención y un aumento de la cultura de emergencia en su lugar. Y la protección civil se ve ahora como la única ancla de salvación y la asistencia de los municipios y la población involucrada. Italia es un País que se desmorona debido a la negligencia del hombre y a la falta de prevención. Hay 5,596 sobre 8,101 municipios en riesgo hidrogeológico, el 84% de los centros de población se define en riesgo. Esto sin duda demuestra que las construcciones se construyeron cuando no se podia. De estos municipios, 1.700 (alrededor del 21%) están en riesgo de deslizamientos, 1.285 (casi el 16%) en riesgo de inundación y 2.596 (32%) se encuentran en una combinación de deslizamientos de tierra y riesgo de inundación. El área total clasificada como de alto riesgo asciende a 36.551 km2 (7,1% del total nacional) dividido en km2 de áreas de deslizamientos de tierra y 7.791 km2 de áreas inundadas 13.760. Estas cifras ponen de relieve la inestabilidad hidrogeológica con el que cada región debe enfrentar, tarde o temprano, contra la cual el flujo de millones de euros, a menudo sólo le prometió, no servirá de mucho para la estabilización y obras de medida de seguridad. El informe de Legambiente revela que los municipios son la punta de lanza de una evidente debilidad de nuestro territorio. No hay una única manera de preparar los mapas de susceptibilidad, como lo demuestra la enorme cantidad de artículos científicos producidos incluso durante la última década, y lo mismo es cierto en cuanto a la zonificación de los peligros y los riesgos involucrados, todavía sigue siendo un problema sin resolver en gran medida (Carrara et al., 2009). La contribución de este trabajo las siguientes fases de un estudio con el fin de definir la estructura de la sensibilidad, los riesgos y peligros de un área: 1. Construcción de la base de datos: en este trabajo las diferentes técnicas y métodos de detección de deslizamiento de tierra y delimitación se comparan directamente (trabajo de campo) e indirectamente (fotografías aéreas, software de visualización remota del territorio) y su posterior despliegue en un sistema GIS. 2 Elección y definición de la escala de análisis: De hecho, uno de los problemas más actuales de la proposición se relaciona con los métodos de evaluación de susceptibilidad a escala múltiple. 3 Unidades cartográficas: las diferentes unidades se utilizan para la cartografía y zonificación del territorio, cuya previsión de resultados se comparan con el fin de ser capaces de identificar las unidades de la asignación básica más adecuada para la planificación y para fines de defensa civil, teniendo en cuenta la exactitud científica de que la modelo debe soportar. 4 Elección de los factores control: en el trabajo, es la posibilidad de identificar el conjunto más probable de los factores que se consideran relacionados directamente o indirectamente a la inestabilidad de la ladera. Se proponen procedimientos de prueba y seleccionar el conjunto de posibles factores de control, así como la construcción de modelos específicos para cada tipo de deslizamientos. 5 Construcción de modelos: como para la construcción de un modelo geo-estadístico, las soluciones se comparan diferentes y el modelo de presentación de los mismos resultados y la objetividad que se elija, teniendo en cuenta que las necesidades de una implementación más bajo en términos de costo y tiempo. 6 Validación: los modelos están sujetos a diferentes técnicas de validación, que luego se comparan entre ellos. 7 Exportación espacial de un modelo de susceptibilidad: este es un ensayo para definir y validar los términos de susceptibilidad a los deslizamientos de una amplia zona en los gustos de cientos o miles de kilómetros cuadrados, en base a los estudios de detalle de algunos sectores que lo representan. Al igual que muchos otros autores, con el propósito de este trabajo es hacer una contribución a la comunidad científica, tratando de ofrecer una modesta contribución en la solución de algunos problemas en este campo a través de experimentos y modelos realizados en una variedad de contextos y comparar los resultados entre ellos. En este sentido, unas pruebas se llevaron a cabo en algunas áreas, previamente seleccionadas, será probado y verificado el resultado de algunos de los procedimientos en los años de investigación doctoral. A continuación, un resumen de los resultados vendrán de estas pruebas experimentales TEST 1a: TUMMARRANO river basin: Model Exportation En el marco de un estudio de la susceptibilidad de deslizamientos regional en el sur de Sicilia, una prueba se ha realizado en la cuenca del río Tumarrano (unos 80 km2) tiene como objetivo caracterizar las condiciones de su susceptibilidad movimientos de ladera mediante la exportación de un modelo, definido y entrenado en el interior un número limitado (unos 20 km2) representativas del sector ("el área de origen''). Además, la posibilidad de explotar software de Google Earth y el banco de datos de fotos para producir imágenes de los archivos deslizamiento de tierra ha sido comprobado. El modelo de susceptibilidad se define, de acuerdo con un enfoque multifactorial basadas en el análisis condicional, con unidades únicas condiciones (UCUs), los cuales fueron obtenidos mediante la combinación de cuatro factores seleccionados control: litología afloramiento, la pendiente, la curvatura del plan y el índice de humedad topográfica. La capacidad de predicción del modelo de exportación, formado con 206 deslizamientos de tierra, se compara con la estimada para toda el área estudiada, mediante el uso de un archivo completo de deslizamiento de tierra (703 deslizamientos de tierra), para ver hasta qué punto el mayor tiempo/dinero necesario se tienen en cuenta los costos para. TEST 1b. Tummarrano river basin: modelo de susceptibilidad basado en la Forward logistic regression La regresión logística con pasòs hacia adelante, nos ha permitido obtener un modelo de susceptibilidad por los flujos de tierra en la cuenca del río Tumarrano, que se definió mediante el modelado de las relaciones estadísticas entre un archivo de eventos 760 y un conjunto de 20 variables predictoras. Para cada movimiento del inventario, un punto de identificación de deslizamientos (LIP) se produce de forma automática, como corresponde al punto más alto a lo largo de la frontera de los polígonos de deslizamientos de tierra. Los modelos equilibrados (760 stable/760 inestable) se presentaron a adelante el procedimiento de regresión logística. Una estrategia de construcción del modelo se aplicó para ampliar la zona considerada en la preparación del modelo y para comprobar la sensibilidad de los modelos de regresión con respecto a los lugares específicos de las células se considera estable. Un conjunto de dieciséis modelos se preparó de forma aleatoria extraer los subconjuntos diferentes céldas estables. Los modelos fueron sometidos a regresión logística y validado. Los resultados mostraron que las tasas de error satisfactoria y estable (0,236 en promedio, con una desviación estándar de 0,007) y AUC (0.839, para la formación, y 0.817, para conjuntos de datos de prueba). Como en relación a los predictores, la pendiente en el barrio de las células y la curvatura topográfica de gran perfil y plan local-fueron seleccionados de forma sistemática. Litología arcillosa afloramiento, drenajes midslope, crestas locales y midslope y los accidentes geográficos cañones eran también muy frecuentes (de 8 a 15 veces) en los modelos de la selección hacia adelante. La estrategia de construcción del modelo nos ha permitido producir un modelo de flujo de tierra realizando la susceptibilidad, cuyo modelo de ajuste, la predicción de la habilidad y solidez se estimaron sobre la base de los procedimientos de validación. Test 2. Imera river basin: modelo de susceptibilidad por flujo de tierra basado en las unidades de ladera. Un mapa de susceptibilidad de un área, que es representativa en términos de marco geológico y los fenómenos de inestabilidad de ladera de grandes sectores de los Apeninos de Sicilia, fue producida usando unidades de ladera y un modelo multiparamétrico univariado. La zona de estudio, que se extiende por aproximadamente 90 km2, fue dividida en 774 unidades de la pendiente, cuya ocurrencia esperada avalancha se estimó un promedio de siete valores de vulnerabilidad, determinado para el control de los factores seleccionados: litología, pendiente media del gradiente, SPI en el pie, el índice de humedad topográfica y la curvatura del perfil, y el rango de altitud. Cada uno de los reconocidos 490 deslizamientos de tierra estuvo representada por su punto de centro de gravedad. Sobre la base de análisis condicional, la función de la susceptibilidad aquí adoptada es la densidad, calculado para cada clase. Modelos univariante fueron preparados para cada uno de los factores que controlan, y su rendimiento predictivo se estimó por curvas de tipos de predicción y la relación de efectividad aplicada a la categorías de vulnerabilidad. Este procedimiento nos permitió discriminar entre factores efectivos y no efectivos, de modo que sólo la primera se combinó posteriormente en un modelo multiparamétrico, que fue utilizada para producir el mapa de susceptibilidad final. la validación de este último mapa nos permite comprobar el rendimiento y la fiabilidad de la predicción modelo. Los principales factores reguladores resultaron: la litología y, subordinadamente, el SPI a el pies de la unidad, y tambien el gradiente medio de la pendiente, la curvatura del perfil, y el índice de humedad topográfica dieron resultados satisfactorios. ; The World population, which counted two billion inhabitants around 1950, has grown at an almost exponential rate in the following decades up to four billion in 1980 and 5,3 in 1990 (United Nations – Department of Economic and Social Affairs, 2010). Definitely a high increase both in absolute and relative terms. According to estimates by the United Nations, the World population is estimated to reach eight billion and a half around 2025 (Chart 1.1), and then it will become steady around ten billion in 2050 because of the expected decline in fertility. These growing rates occur, obviously, both in Europe, where population has grown from 550 million in 1950 to 750 million in 2010, and in Italy, where in the period from 1861 to 2008 there was a surge in population from 22 million inhabitants to almost 60 million, (source: ISTAT, 2010). The population has grown, however, at higher rates in developing Countries (Fig. 1.1), with a tendency to become steady in industrialized Countries in the last decades. Such an intense world population has direct consequences on urban territory while leading to a spread of current minor urban areas and small towns. All this will, increasingly, result in management and land use problems, producing a growth of the vulnerability component in the risk equation. Population growth alone does not justify an increase of hydro-geological conditions of instability. If so, since the population has become steady in recent years, at least in most industrialized countries, we should not face increasing risks. Instead, the economic development model, largely based on networks and infrastructures, as well as settlements of course, produces a double effect: an increase of assets exposed to threat; a stress on the territory, able to make the activation of hazardous phenomena more frequently. It is however true that recent disasters with great loss of lives (i.e., Sarno Giampilieri, Aulla, Genova and Saponara) are actually the results of the response (letting nature take its course) to the changes in territorial asset occurred after the war. Another cause may be found in environmental changes: when the stress regime in a region changes (such as extraordinary rainfall intensity), the response is obviously new for both sides/slopes and the population. The WWF notes that from 1956 to 2001, urbanized areas in Italy have increased by 500 times and it is estimated that from 1990 to 2005 we have transformed 3.5 million hectares of land. The problem of interaction between humans and the natural environment is a very complex and diversified issue, not often approached in a systematic way, also because of the severe limitations of sources to be invested on research on a medium and long-term, for a better and effective knowledge of the environment, primarily on measures aimed at reducing risk (Plattner, 2005). Natural phenomena also have an impact within the social-economic framework as they are responsible for the loss of goods and services, and sometimes, a loss in terms of lives. In such a situation, the vulnerability of the area is related to the development of its social, civil, and urban infrastructural system. This concept is well expressed in the statement "disasters occur when hazards meet vulnerability" (Wisner et al., 2004). This leads us to consider natural disasters as real social phenomena. This condition is strongly valid especially with regard to landslides (Brabb and Harrod, 1989; Brabb, 1991). Since economic problems common to all countries do not allow either to invest in research projects on a medium and long-term or the stabilization of structures or areas on a large-scale, a new philosophy of environmental policy opens up for all active political and administrative subjects that should govern the use and exploitation of the territory. For this reason, the scientific community is engaged in a continuous search for methods and techniques to estimate the degree of real and potential instability, using the minimum amount of equipment and possible economic resources. Usually there is a substantial difficulty in identifying the most reliable procedures, that allow to approach this matter in a non-traditional manner based on modeling and investigative techniques built on the exchange of experiences between experts and conducting studies and experiments on all continents, and showing different strategies and possible technical combinations depending on the type and/or the number and complexity of the investigation, producing susceptibility, hazard and risk maps, used as the basis for decision-making processes in land management. In this framework, further efforts are needed in trying to make the different methods more objective and shared by all in order to be simple and reproducible, and most of all in transferring the knowledge gained in laws that underpin territorial planning, building regulations, and in civil defense plans (Guzzetti, 2006). When discussing about landslides and environmental policies, one of the pioneers is undoubtedly Earl E. Brabb, who already in 1991 in a paper entitled "The World Landslide Problem", sustained that landslides are a worldwide problem that cause hundreds of deaths and billions of dollars of damage every year all over the world. The same added that these losses can be reduced if the problem is identified and acknowledged in time, but many countries are simply equipped with maps showing where landslides produced problems in the past and they have even less susceptibility maps that could allow policy makers control land use. Landslides, adds Brabb, are generally more predictable and controllable than other natural events of catastrophic nature such as earthquakes, volcanic eruptions and storms, but despite this, few countries have taken advantage of this knowledge to reduce landslide hazard. Geomorphological problems are and will be an important issue and a fundamental requirement of knowledge for the politics of decision-making. Although 20 years have gone by since Brabb's work, the situation does not seem to have changed. There are still insufficient globally shared procedures even just allowing to assess the quality and accuracy of a landslide inventory or how to classify in terms of landslide susceptibility of an area and to evaluate quantitatively and qualitatively predictive performance. 1.2 Basic concepts One of the most obvious effects of rapid territory development in the past decades is the increasing impact that natural disasters have on man and his activities. Institutions are therefore committed to investing their resources in both the implementation of structural interventions to mitigate the risk as well as implementation of early warning systems and defining guidelines for land management; the latter activities allow, in fact, to avoid or minimize damage to persons and property, produced by natural phenomena, without necessarily investing in expensive resources and long structural interventions. The term "risk" is used in relation to the various components of the social and territorial fabric, as an expression of the expected consequences in the assets as a result of this disastrous phenomenon of assigned intensity at a given time interval. Within the guidelines for the preparation of prevention and management plans in terms of geological risk of the Sicilian Civil Protection Service (Regional Hydro-geological and Environmental Risks department), the term Hydro-geological Risk means the effect on different parts of the territory led by natural disasters such as landslides (geomorphological risk) and floods (hydraulic risks) triggered by events related to climate and its changes. Two main components contribute to the definition of risk: territorial hazard (geomorphological and hydraulic) and vulnerability. The latter depends on both the physical resistance of structures or assets exposed to the threat and the so-called vulnerability of social organization, which is linked, in fact, to the capacity of disaster prevention and management that a community has developed prior to the same disaster. The propensity of a territory to be affected by new landslides, the degree of hazard or risk that characterizes it, are usually expressed with the help of a map in which the area is divided into different zones according to the different values that qualify it. In this mapping, the territory is zoned or divided into homogeneous zones or user-defined fields/areas, whose ranking is defined according to their real or potential degree of landslide hazard (Varnes, 1984). Over the decades, many research groups and national and international commissions have tried to provide precise definitions, trying to reduce the existing confusion of terms in the management of natural hazards. In this section, some basic concepts are expressed as well as the terminology that will be used in the thesis below. Landslide events that develop in a given area involve a large number of environmental variables, to determine undoubted difficulties in identifying a suitable action of management, control and planning. In order to do so, understanding the problem without having a clear conceptual framework and method to be used may not be sufficient. The "forecast" of the phenomena and therefore the modeling phase is always required to designated public administration bodies and territorial control, carried out by the creation of digital simulation models which become crucial at the time when decisions must be taken/made. The creation of maps indicating the different vocation planning of an area, based for example on landslide hazard maps, not only allows you to compose the scene of the incident consequences of a given failure, but also to react under emergency, if magnitude, area, and associated potential damage are known. Planning is a subject which studies and regulates the processes of local governance and to evaluate the resulting dynamics of evolution and development. The principles guiding the choice of planning require development policies coherent with the principles of environmental protection and sustainability in an effort to control the excessive human presence, able to transform irreversibly natural systems and preserve the quality of life for future generations. Information, territorial knowledge and assessment of its natural predisposition and vulnerability are the basis of planning. These forms of knowledge and the use and application of the best technologies available to facilitate information processing and optimization of procedures for evaluation and zoning of the territory, will yield the best design solutions to achieve the desired objectives. Planning is aimed to government land use and management of spatial information, and is achieved by regulating the area according to different uses, which should be awarded taking into account the natural predispositions. Planning activities can affect a large portion of territory, in other words include a supra-municipal area or one that does not match with administrative boundaries (e.g. Provincial Territorial Coordination Plan, Hydro-geological Plan) or urban (e.g. General Regulation Plan). The geological, geomorphological, hydro-geological and seismic component should be placed at the base of the strategic development of the territory. In national legislation, water management is understood both as a natural resource but also as an element of risk, and has been regulated at the watershed level since the nineties (national framework law 183/89 on soil protection). This allow us to overcome divisions and inconsistencies produced by the adoption of targeted areas having only administrative boundaries that, therefore, do not take into account natural dynamics. The zoning of landslide hazard area is considered the most effective level of knowledge for territorial planning and territorial governance purposes. A map showing portions of an area classified as "hazardous" is of great importance due to the fact that these areas are subject to limitations and constraints that also affect the usability or simply the economic value. 1.2.1 Landslides and soil protection Italy, besides having a territory particularly prone to heavily collapse, has a highly populated territory with a density of 189 inhabitants per km2, much higher than France (114 inhabitants/km2) and Spain (89 inhabitants/km2), in Lombardy and Campania respectively, the density changes to 379 and 420 inhabitants per km2. As clear from the Report on landslides in Italy (National Geological Survey, 2007), commissioned by the ISPRA (National Institute for Environmental Protection and Research), in the last 50 years almost 500 thousand landslides have been recognized and recorded for an area of about 20 thousand km2, corresponding to 6.6% of the entire national territory. These data should be updated. As indicated by the last study conducted by the Ministry of the Environment (2010), 9.8% of the national area is to be ranked highly hydro-geological critical and 6.633 municipalities are involved, representing 81.9 percent of the national territory. This value, according to a report EURISPES ( Report Italy, 2010) is "largely underestimated", therefore agreeing that "a reliable estimate is made up of about 2 million phenomena and consequently the percentage of the Italian territory subject to ongoing phenomena is more than 20%." The Ministry of Environment, through the work for the realization of development plans undertaken by the hydrogeological Basin Authority, estimated a funding requirement of almost 40 billion euros to hydro-geologically secure the entire country, and 4.1 billion for more urgent works. Undoubtedly, the amounts are considerably high, but it is enough to consider that almost 21 billion euros were spent just to stanch the damages by hydro-geological disasters occurred in the decade 1994-2004. 1.3 Aims and scientific contribution There is no single way to prepare susceptibility maps, as evidenced by the enormous amount of scientific papers produced even during the last decade, and the same is true as for the zoning of the hazard and risk involved, still remaining a largely unsolved problem (Carrara et al., 2009). The contribution of this paper the following phases of a study in order to define the susceptibility structure, hazard and risk of an area. 1 Construction of the landslide database: in this work different techniques and methods of landslide detection and delimitation are compared, directly (field work) and indirectly (aerial photographs, remote viewing software of the territory) and their subsequent deployment in a GIS system. 2 Choice and definition of the analysis scale: the problem of scale models of susceptibility is approached. In fact, one of the most actual problems of the proposition is related to approaches to multi-scale susceptibility evaluation. 3 Mapping units: different units are used for mapping and zoning of the territory, whose foresight results are compared in order to be able to identify the basic mapping units most suitable for planning and for civil defense purposes, taking into account the scientific accuracy that the model must bear. 4 Choice of controlling factors: during the work, it is the possible to identify the most probable set of factors considered to be directly or indirectly related to the instability of the slope. Procedures for testing and selecting the set of possible controlling factors are proposed as well as the construction of specific models for each type of landslide. 5 Model building: as for the construction of a geo-statistical model, different solutions are compared and the model presenting the same results and objectivity is chosen, considering it needs a lower implementation in terms of cost and time. 6 Validation: models are subject to different validation techniques, which are then compared to each other. 7 Spatial exporting of a landslide susceptibility model: this is a trial to define and validate the terms of landslide susceptibility for a wide area in the likes of hundreds or thousands of square kilometers, based on studies of some fields that represent it. Having clear that the result of this type of study is intended to provide maps that can be used by planners in a useful manner, these must be characterized by an immediacy in understanding even by non-experts and they must also be easy to read and interpret. Therefore, these methods should be as simple as possible, for example, susceptibility levels must be clearly expressed not only in quantitative but also in descriptive terms (Clerici et al., 2010). Like many other authors, the purpose of this work is to make a contribution to the scientific community by trying to offer a modest contribution in solving some problems in this field through experiments and modeling carried out in a range of contexts and comparing the results between them.
The College Mefcufy. Toh. iv. GETTYSBURG, PA., MAY, 1896. No. 3. THE COLLEGE MEfiCUfiY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor: D. EDGAR RICE, '96. Associate Editors : EDNA M. LOOMIS, '96. GRAYSON Z. STUP, '96. ;IENRY W. BIKLE, '97. WEBSTER C. SPAYDE, '96. ILLIAM E. WHEELER, '97. HERBERT D. SHIMER, '96. ROBBIN B. WOLF, '97. Alumni Association Editor: REV. D. FRANK GARLAND, A. M,, Baltimore, Md. Business Manager: WILLIAM G. BRUBAKER, '96. Assistant Business Manager: E. A. ARMSTRONG, '97. m™™. /One volume (ten months). . . . $1.(10 limns. |slngiecopies . . . .15 Payable in advanco. Ml Students are requested to hand us matter tor publication. The Alumni and ex-members or the College will tavor us by fending Information concerning their whereabouts or any Items hey may think would be Interesting tor publication. &U subscriptions and business matters should be addressed to he business manager. {Matter Intended for publication should be addressed to the Editor Address, THE COLLEGE MERCURY, Gettysburg, Pa. CONTENTS. DITORIALS, 32 JEED BUT NOT FREE, 35 ETURN OF PERSEPHONE. 37 HAD TO Go, 38 OLLEGE I.OCALS, 38 LUMNI NOTES, 41 THLETICS, 42 MATERNITY NOTES, 43 OWN AND SEMINARY NOTES, 44 ■ITERARY SOCIETIES, - - - • 45 EDITORIAL. With this number of the MERCURY the pres-ent staff completes its editorial work, and gives it over to its successors. Although the duties of our position have at times been trying, and there is a feeling of relief comes with the thought of being freed from them, yet the pleasure and profit connected with the position have been great, and the training and experi-ence have been well worth the trouble. We can hardly hope to have pleased all in the discharge of what we have considered our duty, but whatever failures of this kind may have been made are not chargeable to an ab-sence of the desire to please. Neither have we measured entirely up to the standard we had placed before us, and yet considering the small support which the staff receives from the student body, we believe they have done all that could reasonably be expected of them. The greater part of our support has come from members of the lower classes, and we hope that those who have begun to take an interest in the MERCURY will not grow weary, but will make even greater efforts in behalf of the new staff. The MERCURY, it must be remembered, is almost the only representative of the college among our alumni and other colleges, and to make a creditable showing it requires the hearty co-operation of all. * * * THE recent cowardly attack on two of our students, in which both were seriously injured, the one possibly being permanently disabled, is but an extreme case of the danger and in-sults to which we are daily exposed on the streets of Gettysburg. The students never molest any of the people of the town nor make themselves disagreeable in any way, and yet it is a very common occurrence for them to be 33 THE COEkEGE MERCURY. made the objects of insulting language, and sometimes even of personal injury. In winter, when there is snow on the ground, they are constantly made the targets of the small boy with his snow ball, and it becomes absolutely dangerous to walk along the streets, even when the supposed guardians of the peace are in full view of all that is occuring. The students expect nothing more of the town officials than protection in their rights to walk the streets unmolested, and if the authorities are too careless to guarantee these rights, it is time that strong steps be taken, and an example be made of some one. It is to be hoped that the perpetrators of the recent outrage be punished with the full penalty of the law, and that the rough element of the town be shown that even though only stud-ents, we yet have rights which the authorities are bound to protect for us. We do not de-sire to incur the enmity of any one, but we feel that our rights should be defended, let the consequences be what they may. * * * As we look forward to the end of the term, the query presents itself, what kind of a com-mencement will we have. It is a fact which must be admitted, that for the last several years there has been a noticeable lack of in-terest in the exercises of commencement week. Fewer of our alumni attend, than were present on former occasions, and some who come on special business, leave again before the final exercises. The students who remain feel more as if the college were closed for some sad occasion than that they are celebrating the close of another year's work. It is rather hard to acconnt for this lack of interest, but we are inclined to believe that it is due, in part, at least, to the regretable want of harmony which exists in the church in re-gard to Pennsylvania College. For one who is not very familiar with the inner workings of the matter it is by no means easy to see the good which is being done by this division of opinions, and even less easy to decide who is in the right. Of one thing, however, we feel quite certain, and that is that the sooner a compromise of some kind is effected, the better it will be for the college. Our institution is not in a condition at the present to remain un-injured by a conflict which is so fundamental, and the small attendance at commencements is not the greatest of the evils which arise from it. Another possible reason which may be of-fered as explaining the decline in the interest of commencement has been the lack of spirit of our students. All seem to be content to move along in an uneventful way, without an effort to enliven things. There are hopeful signs, however, that we are gradually awakening, and we believe that the students will do what they can this year to add to the pleasures of the week. Preparations are being made for field day sports, and the outlook is quite en-couraging. And in this connection we would again suggest that arrangements be made by the alumni to have several class reunions at that time. We have received several letters from alumni, urging this matter strongly. THE sixty-fourth annual catalogue of the college has recently been issued in its usual good form. The enrollment shows a very en-couraging increase, and we believe it is only twelve less than the highest enrollment we j have ever had. The college and graduate de-partments have the same number as last year, with an increase of ten in preparatory, making the total 227. As the Senior class this year is less than half the size of last year's class, the prospects are that next fall the number of | students will be greater than ever before. A noticeable improvement in the catalogue I is that the street address of students living in the town is given, instead of simply the name of the family with which they live. We would also call special attention to the description of the new course in anatomy under Dr. Stanley, which has been added during the last year. We are pleased to see that the MERCURY has I THE COLLEGE MERCURY. 34 [for the first time received a notice in the cata-logue. CONSIDERABLE dissatisfaction has been ex-pressed among the students with the careless way in which our athletics are being con- I ducted. Of the three games of base ball we have played thus far, we have succeeded in winning but one, and that was almost en- Itirely through the work of our pitcher, who [did so well as to leave the fielders very little to do. Of course, defeats are to be expected, and i are excusable when suffered at the hands of stronger teams, but when it is plainly seen that they are the result of want of practice, jthey are not excusable. The principal cause of complaint is that the practicing of our team is not done at all sys-tematically. Instead of being arranged in their positions, and required to do regular ' work, the players are allowed to do almost as they please, and only the better players get the practice, while those who need it most are being neglected. If the team wants the sup-port of the students, it must get down to work, and at least show that it is making its best ef-forts. Then if defeat comes it will be excus- ! able. About the same criticism is applicable to the [relay team which was sent to Philadelphia on ; April 25th. The general sentiment of the students before the race was that we had very poor hopes of winning, and the reasou for thinking so was that the team did not have sufficient practice. Since the race we are in-formed that if better preparation had been made, we would have had good prospects of winning. It may be consoling to think that, [but we feel that it shows very poor manage-ment to go to the expense of sending a team [to the contest, when we were conscious before-hand that it had not had as much practice as it might have had. It surely does not help our reputation much to enter the contest and Icome out in third place. It would have been much better to remain out entirely. If our athletic association would have a full treasury, it might be able to furnish these lit-tle pleasure excursions to its members, with-out seriously noticing it, but with the heavy expenses of our new athletic field on our hands, and when all our students are doing what they can to remove the debt, it looks like extravagance to incur the expenses of the relay contest, when no one expected our team to win. It is little wonder that the students are unwilling to make sacrifices for the athletic field, when so little economy is used in dis-pensing the funds contributed. We think that until this debt is paid, the management should be careful that every cent goes where it will do the most good. * * * IF an)' one has, from any reason, gone through college with an inadequate prepara-tion, it is his duty to warn others against this evil. Some may plead lack of time and money,' but let them think long before they enter upon any work for which they are not fully pre-pared. It will be done with small profit and less pleasure. What is the aim of a college course ? Is it to get through as quickly as possible or is it to know something ? The years of preparation are the ones that tell all through college life and all through the life afterwards. Two years of good drill when beginning the languages are worth more than two years of extra reading afterwards, without the drill. And the preparation in other branches is no less important. A good preparation is the key ; it has the power to unlock all the treas-ures of learning. Slight any other part of the course rather than this. L- * * * THE advantages and disadvantages ofexam-inations have been discussed until the ques-tion is an old one. But, to a body of students, the question is one, that, though old, is ever new. Examinations are, to some extent, a test of scholarship; but they are not the test that they might be. In many cases, over work and excitement unfit the student for his task 35 THE COLLEGE MERCURY. and he cannot do himself justice. At the end of the term, he is compelled to do an extra amount of hard work; and, when examinations are over, he is worn out, mentally and physi-cally. Besides this disadvantage, nothing af-fords such a temptation to dishonest work as examinations do. Too often, the idea is to "get through," and it does not matter much how it is done. So far as scholarship is con-cerned, any teacher usually knows from the daily recitations, about how his students stand. It may be said that the reviews pre-ceding examinations are valuable. This may be conceded, but might we not have the re-views, and with just as much profit, if they were not made solely for the sake of the exam-inations ? Some colleges have a system of examination that does not involve cramming for days and nights beforehand. The students never know when an examination is coming and so they never prepare especially for one. It may come any day, and so they do not leave all their work for the end of the term ; it is quite nec-essary to work regularly every day and it goes without saying that this is the work that counts. May it not be that examinations con-ducted in this way are a better test of scholar-ship, and better in every respect? It seems to us that if cramming and worrying and dishon-est work could be done away with, there would be a better chance of attaining the true end of examinations. L. * * * PRESENT REQUIREMENT FOR ADMISSION TO COLLEGES.—Not long since Prof. Ira Rem-sen delivered an address before the Johns Hop-kins university graduates, in which he took the ground that the present requirements for admission to our leading American colleges are too great, and should be modified. As at present, it is scarcely possible for a young man desiring to engage in one of the professions, to complete his course upon reaching his major-ity. A very few may, by reason of special ad-vantages in his life, be able to do so, but the many cannot. A young man will take his bachelor's degree at twenty-two. If he desires to fit himself for the medical profession, he must now pursue a further four years course, and should he desire special preparation, as many young men are ambitious to obtain, he will be close to the thirties before he is ready for his profession. The same is true of the law, and of the ministry. Might it not be well to require less in the number of subjects upon which examination is required for admission, and if possible, demand a greater degree of | thoroughness in preparation. Educators in general seem to agree in this, that our colleges are too much mingling with collegiate meth-ods university features, and so are raising the standard of admission too high for the average student seeking a collegiate education. The method leads to what is termed "coaching" for examination, which cannot be other than hurtful to the student. Preparatory work is all-important, but quality, rather than quan-tity, ought to be the aim. It is not the amount of Latin a man may have lead which ought to qualify him for admission to college, but the amount of Latin he knows. You cannot meas-ure knowledge by the yard-stick. A well-trained memory, thoroughness and accuracy— these are of the highest importance in the preparation for the pursuit of a collegiate edu-cation. G. FREED, BUT NOT FREE. Joel Chandler Harris, in one of his short stories called "Free Joe and the rest of the World," gives a short sketch of a freed negro | in ante-bellum days. Free Joe was shabby, poor, and almost friendless. Who cared for a ragged negro with a little dog trotting at his heels ? The better class of whites did not; they had their own negroes to care for, the I lower class were far above him because of their | color, and made him an exile. To them all, he was an object of suspicion. Poor, humble I Joe was freed, and, therefore, a subtle danger was lurking in all he did or said. THE COLLEGE MERCURY. 36 One, only one, was a friend to Free Joe. iThat was his wife, and she belonged to a slave [owner who did not allow "free niggers" on [his premises. For a long time the two met in Ithe woods near the Calderwood plantation, (but Mr. Calderwood found this out and hur- Iried Lucinda off to the cit}' where he sold her. Free Joe knew nothing of this. Night after night he waited under the old tree, but his {wife came no more. His simple heart never doubted Lucinda, but he could not understand Bier absence. He consulted a wise fortune-jteller who gave him no encouragement. Once [more he went back to the old trysting place ; perhaps she would come this time. He was so Inear the Calderwood plantation that he could [hear the darkies singing, and he almost thought he could distinguish Lucinda's voice. [There he sat all night; morning found him in Ithe same place with his head bowed upon his [breast. Was he asleep, dreaming of the Lu- [cinda who never came ? A white man, pass-ing by, shook him roughly but he did not [waken. The story-teller says; "His clothes jwere ragged, his hands rough and callous; his Bhoes literally tied together with strings; he Iwas shabby in the extreme. A passer-b}', [glancing at him, could have no idea that such [a humble creature had been summoned as a witness before the Lord God of Hosts." What was Free Joe's freedom to him? He Iwas an outcast even from his own race while [white people looked on him as less than a elave. His only friend beside a poor little dog Iwas an enslaved wife, and she was separated from him forever. He was affectionate and [hopeful, but he was also ignorant and super-stitious. There was no opening for Free Joe; lie had no talents, no friends, no ambition. 3orn and trained in slavery, in freedom he vas helpless. Free Joe is a type of the great class of ne-roes who, at the end of the Civil War were ireed men, but not free. At the Atlanta Ex-position was a plaster cast, made by a colored San. It represents a powerful negro with tragments of chains clinging to his limbs, and it bears the legend: "The chains are broken, but not off." The Emancipation proclamation was only the beginning of freedom for the colored race. It was the breaking, but not the removal of their fetters. They had black skins, and woolly hair, they were Africans; they had been slaves; therefore, they were despised. Not one of them had ever known a home in the true sense of the word. Their families were not their own. Their work had always been done at the command of others; they had no habits of industry and no sense of responsi-bility. They were careless and happy, affec-tionate and emotional. They were a race born under sunny skies in a tropic land, trained in the school of slavery, and then sent out to make their way among energetic, educated white people. Was the negro lazy and im-provident ? Why should he be otherwise ? Was he ignorant ? Slaves had no use for learning ; not even as much as the "three R's." Behind these people were generations of heathen life in Africa and generations of slavery in Amer-ica. Before them, what? When they were freed, they had very crude ideas of what that freedom meant, while only a few of the white people cared what it meant. While they were slaves they had learned one thing, and that was to reverence the white man's God. The negro is and always has been, religious. Even when he was worship-ing idols in his old heathen home, he was nevertheless religious. Now, his worship has been turned in the right direction, and the ne-groes are not only Christians, but Protestant Christians. This much the white man has done for him. What else has been undertaken for the sake of his progress ? He has been given the ballot, but he has not been allowed • its free use. If politicians cannot get round the law in one way they can in another. "The negro is not fitted for the rights of citizenship," they say, when they fear he is about to vote with the other party. But other benefits be-side the negro's political salvation have been attempted. Some are taken back to Africa 37 THE COLLEGE MERCURY. and placed in settlements, when missionaries ; teach them how to civilize their wild brethren, j "Africa is their home" it is said, "and that is the only place where they can develop." Others are educated here, and that education is enough to make one groan. In some schools they are found studying higher mathematics, when they do not know arithmetic, and Greek and Latin, regardless of the fact that they do not yet comprehend plain English. This pleases them, of course. With all their love for display and aptness for imitation, they feel that they are having "white studies" now. Their friends think their advancement is mar-vellous: Their teachers—if their teachers had more sense and courage, the pupils would get what they need, rather than what they want. But some are beginning to see the needs of the colored people and are establishing schools for them on a diffeient plan. Schools where they are given a practical training for a prac-tical life. Where they learn to be mechanics, architects, and whatever else a community needs. . They learn to do all kinds of work, and, more than this, they learn how to work every day. -They learn English, too, and after that, as much more as they can and will. When the negroes were freed, they were like children, and they were at the mercy of the civilized and cultured, but often selfish, white race. In many instances nothing has been done in the way of training them. In most cases when anything has been done, it has been in the form of experiment. One plan after another has been tried until Booker T. Washington, himself a negro, has adopted this plan of practical education; of giving his peo-ple just what they need; both industrial and intellectual training. Despised, neglected, and ■the subject of experiment, is it any wonder that the average negro does not yet stand be-side the average white man ? He has borne much at the hands of the white man; the one whose duty it is to befriend and teach him. White men brought the negroes to these shores and made them slaves; in a great political crisis they were presented with freedom; thrown upon their own resources when they had no resources. We, whose fathers favored or permitted slavery, owe it to the freed slaves to give him what recompense we can. He cannot change the color of his skin and become a white man; neither can he change his nature to that of the white man. He must always be himself; but when that self has been trained and developed, it will not be the lazy, careless self of the present day. The past thirty years mark much improvement, even under great disadvantages. Leaders have risen from among their own race and the habits of slavery are disappearing. But they cannot be white people; they must develop in their own way and keep their own individu-ality. Thus, and only thus, can they rid themselves of their broken chains. But the chains are falling; and we may look for the day when the negro will step forth, no longer a freedman, but a free man, and take his place among the great and good of the nation. In the meantime, the least that we can do, is to see that we put no occasion for stumbling in our neighbor's way. E. M. L-, '96. ♦ ♦ ♦ RETURN OF PERSEPHONE. Demeter decks the wood in green To greet Persephone, She carpets with a verdant sheen Each meadow, lawn and lea ; And every field and forest scene She brightens, silently. She bids the tiny bud unfold, The merry robin, sing ; The violet forget the cold. The arbutus upspring; The crocus too, in cup of gold, Its sweetest tribute.bring. She watches, with an anxious eye. Each shifting shade and light, And scans the ever changing sky From morning until night; Now heavy clouds go floating by, And now the sun shines bright. Oh, for a breath of summer breeze. To wake the sleeping flowers ; Oh, for the shade of budded trees, The balm of April showers ; Oh, for the green of grassy leas, For "glad and golden hours ! Oh, Earth, no more in silence be, In deepest, darkest night; Break forth in streams of melody, THE COLLEGE MERCURY. 38 Press onward to the light, Then shall my lost Persephone Return, all fair and bright. Persephone, Persephone, For many dreary days My heart has wandered, seeking thee In dark and desert ways. Persephone, come back to me, And fill my life with praise ! I hear her foot-step on the hills, Her smile the flowers hold ; Her laughter ripples in the rills, Sunshine, her hair of gold. Her sweetness all the Springtime fills With beauty never told. She comes. Her footsteps press the grass. And flowers spring beneath, And bloom, a perfect, perfumed mass, Her queenly brow to wreathe. The wild birds greet her, as they pass. And sweetest carols breathe. Oh, Earth, bring all thy treasures sweet, The flowers of the lea, And scatter at her fairy feet Who cometh now to me. And sea and sky grow fair, to greet Returned Persephone. A. R.W.,'99. IT HAD TO GO. 'Twas late at night, the halls were dark. All Freshmen were asleep. When slowly through the darkened halls The Sophs were heard to creep. They slowly wound their way around Until they reached Joe's door, And then they stopped and listened long ; At last they heard him snore. A knock awoke him from sweet dreams To things more real iu life. He learned the object of their call He saw their sharpened knife. Disguised with masks, they made for him In such a " friendly " way, That made him shake though half awake And beg them not to stay. "Take what you will, I'll pay the bill," (Combined strength Joseph feared), "There's only one thing that I ask, And that is, save my beard." A smile passed round the gathered mob, Then came the verdict, slow : "Sir, we decided 'ere we came Your beard would have to go." Then quick the knife sped o'er his face Held firm by willing hands, And in the morn Joe found his beard Was scattered like the sands. H.M.C. I On Thursday, April 9th, Mr. Beaver, trav-eling Sec'y of the State for the Y. M. C. A., Iwas here looking after the interest of the work. COLLEGE LOCALS. GRAYSON Z. STUP and ROBBIN B. WOLF, Editors. you come so Hot weather. Spring fever. New MERCURY staff elected. Bums put much big curve on ball for In-dian. Musselman and Armstrong have the strong-est room in college. "Why, darling, why did late?" Kitzmeyer, '98, is confined to his home with sickness. The Juniors are working hard on their ora-tions for the oratorical contest. The ten speakers for commencement are as follows : Rice,"England's Policy in Turkey;" Eisenhart, Valedictor}^; Miss Eoomis, "Liter-ature of the Home;" Stup, Salutatory; Shinier, "Revival of Olympic Games;" Spayde, "Christianity and the Working Classes;" Shaar, "The Earth a Remnant;" Reitzell, "The Primacy of the United States in the Western Hemisphere;" Baum, "Municipal Reform;" Loudon, "Cecil Rhodes." The Octet and Violin Quartet are contem-plating a trip to Millersburg in May. They are prepared to give a good concert. A good job for an overworked student : Plucking the dandelions out. of the grass on the campus. Two Sophomores, cogitating over Dr. B.'s head, propounded the following conumdrum : Why is Dr. B.'s head like a hound ? Because it makes a little hair go a great way. E.,'99—Oh! Mr. F., the MERCURY says that if anyone has a dispute that cannot be settled amiably he shall call around to 29 W. He must have been thinking of the amiable girls. B.,'99—What are you reading? There, you are designating the Sabbath again ! S.,'99—Who is the author of Milton's "Par-adise Dost?" H., '97—' 'Shakespeare, of course.'' A., '97, While walking up the street dur-ing vacation, was reading Spectrum proof, and not noticing a shoot that was conveying coal 39 THE COLLEGE MERCURY. into a cellar he fell over it, breaking it down, and at the same time considerably disturbing his own equanimity. A passer-by said it was possible to hear the coal hustler hurl all sorts of expletives, dashes, and question marks af-ter the editor. Shortly after the term opened two Sophs overslept themselves on Sunday evening, and finding their appetites too strong they decided to call at the store and get some apples. They knew the girls would let them have them, so they went without collars. When they got there, however, the ladies insisted that they should come in, which they finally agreed to do until the apples were procured. While sitting there, with coat collars turned up, L. said : F., why don't you put down your coat collar ? This was too much for the modest young man, and he blushed. Mr. H., '99, believes in the motto that "Bet-ter the day, better the deed," having arisen one Sunday morning at 5 o'clock to study a declamation. The report is circulated that Mr. C.,'99, has been kidnapped by the Millersville authorities. We hope he may enjoy this experience better than his previous one. Mr. K.,'99, has been blessed with his third set of teeth, which he finds very troublesome, especially when he wishes to flirt. He had a slight experience in that line, recently. For further information, apply to Josey. Mr. E., Prep., recently astounded a young lady by the remark that his mother expected him to bring an American wife with him when he returned. Sammy is doing pretty well, but he must remember he is not yet ready to return to Persia. Mr. B., '99, would like meditetaneous speaker. Mr. S.,'99, during vacation remarked to some lady friends : "Oh, I'm naturally bright in languages, and I read French at sight. Dr. M. begs leave to differ. If "conceit were consumption" he'd be dead this long time. to become a good Mr. W.,'99, on account of his "lovely hair," has found favor in the eyes of the '99 co-ed. The "son of an eminent divine" has so far advanced in his manhood that he can now go around with a pipe in his mouth and not get sick. Bravo ! Luther. Nearly all the Seniors have taken leave of their moustaches. The object is to make the class appear as young as possible. Those who I kept their moustaches were afraid that they could never raise another one. Mr. H., '99 was seen, or rather heard, at a late ball game with a deaf .young lady. The conversation ran somewhat as follows: He— "Is'nt that a fine pitcher?" She—"No, I don't think it will rain." One of the Juniors, who had ruined his eyes the night before, by writing fine print, was unusually disappointed to hear that the exam-ination was excused. The committee appointed by the board of trustees in regard to Dr. McKnight's resigna-tion, met in the reception room of the recita-tion hall last Tuesday morning. Nothing is known as to their action. The Spectrum will be out in a few days. The publishers have had the material for some time and will send the books about the first week in May. There will be a few extra copies. If you have not subscribed, you should do so at once. Again work in gymnasium has been deserted. Tennis and base ball, how-ever, have more than replaced it. Tennis spirit is running high. Nearly seventy of the boys have entered the tournament. Baseball is also getting its share of enthusi-asts. Very exciting and close class games are expected. At noon on Wednesday, April 29th, Miss Margaret Grayson Valentine, daughter of Dr. Milton Valentine, professor of theology in the Seminary, was united in marriage to Mr. Henry W. Siegrist, of Lebanon. The cere-mony occurred at the home of the bride, and was performed by Dr. Valentine, assisted by the bride's brother, Rev. Milton H. Valentine. The bridal procession was composed of the groom and his best man, two bridesmaids, the maid of honor, and the bride, leaning on the arm of her brother, Sterling Valentine, and marched to the altar to the strains of Tann-hauser's wedding march. The room in which the ceremony was per-formed was decorated most beautifully with apple blossoms, producing a charming, as well as novel effect. The wedding was very largely attended, and the presents were especially numerous | and handsome. THE COLLEGE MERCURY. 40 After congratulations were extended to the newly-married pair, most elegant refreshments were served to the guests. The bride and groom started on their tour on the afternoon train on the W. M. R. R. The MERCURY unites with their many friends in extending congratulations and best wishes. It is reported that a midnight flitting took I place at Prep, a few _ evenings ago. Some of the Preps, thinking that the attractions were too great for Mr. E., 1900, kindly helped him i to move. We are sorry to learn that the rooms sought for by Mr. E. were occupied, and Mr. E. was compelled to move back with all his possessions. The MERCURY extends its sympathy. At last things have come to an end, or, at least we hope so, in the line of fights. On Friday night, April 18, as Messrs. Smith, '98, land Spayde, '99, were returning to college, after having been up town for something to eat, they were stopped at the depot by three town fellows, who demanded "a dime to rush the growler." They were refused, when they followed our men down to and inside the col-i lege gates, where they made a desperate as-sault on them. One of the assailants, King, {by name, had a knife, and succeeded in cutting ;'both Smith and Spayde. Finally, the fight was ■ interrupted by the appearance of other college Imen on the scene, and the town men then withdrew. On account of not knowing the names of the assailants, warrants could not be issued as soon as needful, and King managed to escape for the time being. All three men jhave now been caught, tried and convicted. ■There is no doubt but that the}' will receive a |just sentence. On Friday evening, April 25th,- the last of a Ivery good course of Y. M. C. A. entertain- Imeuts was given. Dr. Willits was the speaker lof the evening, and his subject was "Sunshine, lor How to Enjoy Eife." Quite a large num- Iber of people were present, and the lecture ■was enjoyed by all. Dr. S. [in physiology]—Which is the bet-ter, Mr. B., to live upon a mixed diet all the time, or upon one consisting of the same kinds I of food ? 'Chummie" B.,'99—Why, Doctor, if you |iat the same kind of food all the time, you'll [die sometime, won't you ? Dr. B. [In Greek]—What is a man ? Mr. R.,'99 -Man is a quadruped. "Capt." D., famous as a '99 foot-ball player, is calling on a girl, when the college bell is heard to ring,— THE GIRE—Mr. D., do you hear, the bell for study hour is ringing. Mr. D.—Oh, that's all right, they'll excuse me. THE GIRE—Well, I'll excuse you, too, Mr. D. Mr. M., '99, of New York fame, while in Physiology, enumerating the different parts through which the food must pass before reaching the stomach, grew eloquent, men-tioning the throat, the pharynx, the gullet, the liver, the lungs, and would have included the heart and the brains, had Dr. S. allowed him. Dr. S. [in physiology]—Mr. E., what word in the English language do we get from bicus-pids ? Son-of-an-emineut-divine—Cuspidor ! Dr. M.—How are consonants at the end of the words pronounced ? Mr. S.,'99—They are pronounced silent. Dr. B. [In Sophomore Botany class, hold-ing up a flower stalk]—Does this resemble grass ? Chorus, on back row—Yes, sir ; it's green. Dr. B.—There are other things besides grass that are green. Chorus, on back row—Yes, sir—Freshmen. Mr. F.,'98, in Greek class the other morn-ing furnished some entertainment by reading about Alexander and Meualaos fighting for "the woman with long spears." "Doc." E.,'98, recently convulsed several of his friends by referring to the spray, which he uses for cologne, as his "itemizer." Und no huts ihn gewunert fer was sie lacha ! Mr. S.,'99, on being told that the Odyssey treated of the wanderings of Ulysses, said he couldn't see how that could be, because his Mythology said that Homer wrote about the wanderings of Ulysses. These Freshmen are always so exact. Mr. H., '99, insists that coquette is pro-nounced croquet! Perhaps there is some re-lation between the two in the place from which he comes. Charles F., '98, has taken to chewing to-bacco, and if any fellow wants a chew he knows where to get it. Gold Rope, No Tax, Finzer's Old Honesty and Battle Axe are some -M THE COLLEGE MERCURY. of his favorites. We have heard it reported that he did not commence this detestable habit voluntarily, but that he was prevailed upon by his friends. One short sentence will tell the whole story. His sideburns arc no more. We all know who wore them; we all know who did the college the service of removing them; and we all know that we are very thankful. It is not necessary to add, that he looks a great deal better with-out them. What strange freaks of nature we do read about—worse than earthquakes and landslides. Mr. H., '98, the other clay in Bible astonished the class by saying that "the Taurus mount-ains flow westward into the Mediterranean sea!" "Jerry" F.,'98, recently in English litera-ture, made a slight mistake when he said that among the books of the Elizabethan period was one on "railways." Zullinger, '98, is at his home in Waynes-boro, suffering with a severe attack of rheu-matism. McAllister, '98, was also on the sick list for about a week and a half, but is again back to his work. The exhibition given by the Sons of Her-cules in the Gymnasium, Tuesday evening, April 21, was one of the best for some years. The audience, however, should have been much larger, and it is to be regretted that the fellows did not turn out as they should have done. The performance consisted mainly of mat work, with some work on the horizontal and parallel bars, and concluded with a three round sparring match between Bechtel, 1900 and Kahler, 1900. All the performances and figures were very skillfully executed, and the Sons of Hercules are to be congratulated upon their successful entertainment. "The floral tributes to the favorites were many and beau-tiful." Those who took part in the perform-ances are : Wiest, '95, Stup, '96, Krafft, '98, Fuss,' 98, Hermann,' 99, Brumbaugh, '99, Straw,'99, Kahler 1900 and Bechtel, 1900. The College Octette and the Violin Quartette furnished the music, which was well appreci-ated— especially by the gallery, who rendered their applause in a very vociferous manner when the Octette closed with "Away down South in old Virginia." /\LUw|Ni- II. D. SHIMER AND H. W. BIKLE, Editors. '68. Rev. L. M. Heilmau, D. D., pastor of the Lutheran church at Harrisburg, is deliver-ing a series of five illustrated lectures covering subjects of history, travel and science. '72. Rev. J. A. Koser will occupy the new-parsonage by May 1st, at Sioux City, la. '74. Rev. W. L. Remsberg, of Omaha, Neb., has been called to the Myersville charge in Frederick county, Md. '75. Rev. E. G. Hay, of Red Hook, N. Y., delivered his illustrated lecture on Gettysburg in Story and in Art, in the Lutheran church at Albany, Rev. Dr. G. M. Heindel, pastor, on April 29th. '75. Since Rev. E. D. Weigle, D. D., as-sumed the pastorate of Trinity Lutheran church, Meclianicsburg, January 1st, 1896, sixty persons have been added to the member-ship of the church, increasing the roll of mem-bers to over two hundred. '78. Rev. A. R. Glaze has changed his ad-dress from Gordon to Maple Hill, Pa. '80. Rev. G. W. McSherry, of Taneytown, Md., has resigned. This leaves one of the most important charges in the Maryland Synod vacant. '82. The second edition of "Practical Exer-cises in English," by Rev. Prof. Huber Gray Buehler, published some months since by Harper Brothers, is now going through the presses. The author is at present engaged in the preparation of another book of an educa-tional character. '82. Rev. H. H. Weber, General Secretary of our Church Extension Board, immediately after the last meeting of the Board, suffered a relapse, and is now at his home, unable to leave it. It is thought the heavy work before Eas-ter is the cause. '82. Rev. H. L. Jacobs has resigned his charge at Hanover. His many friends and acquaintances will regret to lose him as a citi-zen, while his congregation must doubly re-gret their loss of a gifted pulpit orator and a faithful and earnest pastor. Mr. Jacobs will l go to Tyrone. '83. Field Secretary Rev. H. L. Yarger, of j the Church Extension Board, is visiting all ■ the churches of the General Synod in Califor- I nia. THE COLLEGE MERCURY. 42 '84. Rev. Geo. E- Faber, A. M., has pub-lished in tract form, a patriotic discourse, which he delivered before Wayne Council, No. 46, Jr. O. U. A. M., Nov. 24, 1895. Thesub-j jectof his discourse is "Four Horns and Four [ Carpenters.'' '88. Rev. D. Frank Garland, pastor of the Church of the Reformation, Baltimore, Md., has published a neat card of his special servi- Ices now being held. '91. Rev. Chas. Ritter, of Fayetteville was recently in town visiting H. T. Weaver and family. '91. Rev. W. G. Slifer, of Idaville, has re-ceived and accepted a unanimous call to St. John's Lutheran church of Davis, W. Va., j and will take charge in the near future. '91. Rev. August Pohlman, our medical [missionary-elect to Africa, was graduated from the Baltimore Medical College on commeuce- Imentday, April 22d. He had the honor of having been chosen class valedictorian. '91. Rev. Stanley Billheimer preached in [Bethlehem Lutheran church, Harrisburg, on Sunday, April 12. '93. Rev. W. H. Ehrhart, of the Gettys-burg Seminary, has been called to Silver Run, [Md. '93. Rev. John C. Grimes has been asigned Jto the Greencastle charge, Greencastles, Pa., [by the Central Pa., M. E. Conference. '95. Ivan L- Hoff has been admitted to the Ibar of Carrol county, Md., and is building up a good clientage. ATHLETICS. WILLIAM E. WHEELER. Editor. The base ball season was opened April 17th, by the game with Washington and Jefferson, Ion the home grounds. The game was quite Ian exciting one on account of the opportune jbatting on both teams. W. and J. made two |runs in their half of the third inning, and by a nome-run hit of Tate, Gettysburg tied the score in the second half of the third. Two nore runs were added to each nine in the fifth inning, and again enthusiasm ran high. W. and J., by bunching their hits in the sixth and seventh, added five more runs, and this lead IGettysburg was unable to overcome, and al-though adding three more to their favor, they were defeated by a score of nine to seven. The make-up of the home team was somewhat uncertain until the day for the game, and their playing was very good, only two errors being made. Rogers, for W. and J., pitched the better game, allowing Gettysburg but six hits. For the "blue and orange" Sheely and Tate led at the bat, while Heisey and Eicher carried off the honors for the visitors. Being the first game of the season, a large crowd was present, and between innings the Gettysburg band played appropriate strains. The following is the score in detail : GETTYSBURG. R H PO A White, 3b 0031 Sheel}', lb 1260 Leisenring, ss. 3 o o 6 'rate, c 1270 Wolf, e.f 0110 Hartzell, l.f. 0060 Huttou, r.f 0020 Wisotzski, r.f. 1 1 o o Courtney, p 1003 Licht'b'rg'r^b 0020 w AND j. R Nesbit, ib 2 Hughes, ss 1 Heisey, rf 2 Eicher, 3b 1 Moore, cf o Rogers, p o Thomson, c. . 1 Beason, 2b o Gamble, If 2 Totals 9 13 27 14 7 lotals 7 6 27 10 2 Earned runs—Gettysburg, 4; W. and J., 7. Two-base hits- Gettysburg, 1; W. and J., 1. Three-base hits—w. and J., i- Home runs—Gettysburg, 1. Stolen bases—Gettysburg, 5; w. and J., 6. Double plays—Hughes, Beason, Nesbit. Struck out—by Gettysburg, 6; by W. and J., 8. Passed balls—Thom-son, 2. Time of game—2,30. Umpire—Donald McPherson. The home team was again defeated on the 18th of April, at Lancastei,by the Franklin and Marshall team, by a score of nine to noth-ing. Inability to hit F. and M.'s pitcher, a State League man, was the cause of defeat. Gettysburg put up a pretty game in the field, and supported Burns in fine style. The latter struck out fourteen men, creating for himself an enviable record against F. and M.'s hard hitters. He allowed them but eight scattered hits. Harr did the best batting for F. and M., and Sheely and Leisenring for Gettysburg. The game was without any distinguishing fea-tures, since both teams showed considerable weakness at the bat. Cremer and Kready did the best fielding for F. and M. The fol-lowing is the score : GETTYSBURG. White, 3b Sheely, ib Leisenring, 2b Mulhall. c Diehl, cf Wisotzki, ss. Wolf, r. f Burns, p Hartzell, 1. f. R H PO Oil 013 o 1 3 o o 14 F, & M. R H PO A Hambright, 3b. 1 o 2 2 Cremer, c 2193 Sheckard, p I 1 2 1 Barthol'm'w.ib o 1 8 1 Sheibley, 2b I o 3 1 Gillan, cf 2120 Harr, rf 0210 Helman, If 1 1 o o Kreads', ss 1 1 o 2 Total o 3 23* 7 4 Total 9 8 27 10 ♦Sheckard out-hit by batted ball. Earned runs—F. and M., 1. Two-base hits—F. and M., 3. Double plays—Sheibley aud Bartholomew. Base on balls— Gettysburg, 1 ; F. and M" 6. Hit by pitched ball—Gettysburg, 1; F. and M., 2. Struck out—Burns, 14; by Sheckard, 8. Passed balls—Mulhall, 1. Time of game—2.05. Umpire—Mr. G arwood. 43 THE COLLEGE MERCURY. The third game of the season resulted in a decided victory for Gettysburg, whose oppon-ent was the strong nine from the Carlisle In-dian school. As is usual in all games with this institution, a large and appreciative crowd was present. The grand stands were filled. It was an ideal clay for base ball, and both teams entered the game with a de-termination to win. Stung by the two previ-ous defeats, Gettysburg made every effort to retrieve lost reputation at the expense of the Indians. But seven innings were played, to enable the visiting team to catch a train for home, and in that time Burns had them en-tirely'at his mercy, allowing the Indians but three hits. His ups and downs and deceptive, ins and outs were too much for the heavy hit-ters from Carlisle. Seventeen men fanned the air in vain attempts to hit the ball. Both teams played a pretty game in the field. Tate led at the bat for Gettysburg, getting three out of the five hits made. Jamison and Shelafo were the only ones able to touch Burns. Score in detail : GETTYSBURG. White, 3b 1 Sheely, ib o Leisenring, ss. 0 Tate, c 1 Wolf, cf 1 Hnrtzell, If o Licht'b'ger, 2b. o Hums, p o Mutton.rf o R II PO A 18 I 5 2I INDIANS. R H TO A Pierce, ib 0050 Roger, cf 0030 Shelafo, p 1203 Archiquette, If o o 2 o Jamison, 2b. o ] jackson, rf o Yrobe. ss o Louis, 3b o o Spenser, e o o o o o 1 Total. Earned runs—Gettysbnrg, 2. Total 1 3 18 7 3 Two-base hits—Indians, I" Stolen bases—Gettysburg, 2; Indians, 2. Double plays—Louis. Jamison, Pierce. Base on balls-Gettysburg, 3. Hit by pitched ball—Gettysburg, 1; Indians, I. Struck out—By Burns, 17; by Shelafo, 4. Time of game—1.55. Umpire-Paul Kuendig. The need of a good track team was clearly shown by the recent participation on the part of Gettysburg in the relay races held at Frank-lin Field, University of Pennsylvania on the 25th ult. With proper and sufficient training we could have undoubtedly won in our event; as it was our team secured third place. Many benefits are derived from such meets and the good obtained shows itself in subse-quent races. The meeting with the college athletic world, the exchanging of plans and purposes by the different men and coaches are of an inestimable benefit to any team, and es-pecially to our own team. Track work has hitherto been a minus quantity at Gettysburg and only an occasional spur would cause any-thing like a revival of the true athletic spirit. The result of this, our first participa-tion in relay racing, should not be disregarded, but all energy and power exerted to put into 1 the field a strong representative track team. This is the intention of the management and it should meet the hearty co-operation and sup-port of the students. Arrangements are now being made for a "field day" during com-mencement week. Further notice and needs will be made known. The prospects for our foot ball team next i year are now engaging the attention of the management. During the next few weeks the i old men as well as new ones will get out on i the field and practice kicking, running and I falling on the ball. This practice is absolutely I necessary for a successful team, and though a I little earlier than usual, means a great deal I toward the success of the eleven There is good material now in college and, with prom-ised accessions, our prospects for a winning team were never so bright. The manager is now arranging the schedule, and a number of dates have been secured. The drawings for the tennis tournament have not yet been made, but will be done in a few days. A greater number of entries have been secured this year than ever before. Manager Lark is working hard to make this tournament more successful financially and otherwise than previous ones; and from the entries and possible drawings a goodly number of close and exciting games will be witnessed. All tennis players should enter this tournament and uphold the record made by former players. FFJATERNHY NOTES. PHI KAPPA PSI. We were pleased to have among us recently for a few days, Rev. J. L. Smith, D. D., '62, ofPittsburg, Pa. F. G. Turner, '93, is studying law at the University of Maryland. Rev. J. G. Goetman, D. D., attended a com-mittee meeting held here several days since. Eisenhart and Reitzell, '96, are two of the ten speakers at the coming commencement, Eisenhart receiving the appointment of Vale-dictorian. E. W. Smith, '93, intends pursuing shortly a course of medicine at U. P. Paul F. W. Kuendig, '98, has been elected official umpire of the Cumberland Valley League. THE COLLEGE MERCURY. 44 PHI GAMMA DELTA. Bro. Walter H. Stifel, of Allegheny, Pa., was initiated on Tuesday, April 28th. We had the pleasure of entertaining Bros. Beason and Logan from W. and J. during the visit of their base ball team, Apr. 17. Bro. Swartz, '81, until recently pastor at Wilmington, Del., accepted a call to Pough-keepsie, N. Y. Bro. Fichthorn, '84, will sail from New York, June 24, on the Friesland, for a two months tour of England and Germany. Bros. Seabrook, '77, Gait, '85, and Anstadt, '90, were welcome visitors in Gettysburg re-cently. The following brothers were in town attend-ing the Siegrist-Valentine wedding last Tues-day : Hocker, '80, Valentine, '80, Stahler, '80, Valentine, '82, Alleman, '84, Fichthorn, '84, Kausler> '84, Miller, '85, DeYoe, '86, Garland, '88. Bro. Herr, ex-'97; is one of the performers [in the U. of P. "Mask and Whig" Club. Bro. Smith, '97, recently took a trip to Phila. on business in the interest of the Spec- : hum. Bros. Rice, Shaar and Baum are speakers chosen for Commencement. Bro. Norman Gait, '85, of Washington, D. C, was married to Miss Edith Boiling, at Wyethville, Va., Thursday morning, Apr. 30. Bro. H. R. Smith was recently elected Busi-ness Manager of the MERCURY for the coming I year. ALPHA TAU OMEGA. Rev. C. G. Bikle, '92, of Glen Gardner, N. J., paid the °hapter a visit, recently. Geo. A. Kyner, '89, of Chambersburg, Pa.,- was in Gettysburg some time ago. M. R. Zulliuger, '98, who was compelled to go home on account of sickness, has improved and will be back in a few weeks. Ralph L. Smith, '98, has gone home and will not return this term. W. E. Wheeler, '97; C. B. Erb, '97, andH. F. Grazier, '98, who were members of the relay team, report a fine time while at Phila-delphia, through the courtesy of Penn. Tau. F. S. Emmert, ex-'gs, has graduated from 1 Bellevue Hospital, New York, and is practic- | ing his profession there. Chas. H. Spayde, '99, was home for a few days, recently. PHI DELTA THETA. O. H. Melchor, '76, spent a few days in town recently. C. E. Reinewald, '85, paid us a visit on April 29th. J. C. Hughes and Alex. Eicher, of Penu'a Gamma, were the guests of the Chapter on April 17th and 18th. J. E. Meisenhelder,' 97, and J. W. Ott, '97, have been elected to positions on the MERCURY staff, the former as assistant business manager, and the latter as an associate editor. SIGMA CHI. . Emory L. Loudon, '87, of Altoona, Pa., paid the Chapter a Welcome visit April 29th. E. W. London, '96, was. one of the repre-sentatives from this college in the relay races at the University of Pennsylvania, at Philadel-phia, April 25th. He has also been chosen as one of the ten speakers for commencement. Frank Leisenring, '97, spent Saturday, 18th ult, at Lancaster, with the base ball team. TOWN ^D SEWIJNARY NOTES. WEBSTER C SPAYDE, Editor. TOWN. Among the bills passed by the New York Legislature and sent to Governor Morton for approval was one appropriating $25,000 for an equestrian statue at Gettysburg to Major Gen-eral H. W. Slocum. It is not at all. likely that the bill will be vetoed. Before many years the field will be dotted with works of sculptors. . The Senate has concurred in the House bill to improve the roads within the National Park at this place. Another observation tower is to be erected this summer. Sunday trains will likely be put on the Ship-pensburg, Carlisle and Gettysburg divisions of the Reading Railroad, again about the middle of May. The repair hands are getting the electric road in condition for operation. 45 THE COLLEGE MERCURY. The Union League of Philadelphia will be here on the 23rd and 24th of May on their an-nual excursion. At the oratorical contest between members of the Prohibition Club of the Seminary and College, held in the Court Room, Thursday, April 23d, J. S. Huddle, of the Seminary, was chosen to represent the association in the State contest, which will take place in Philadelphia, May 8th. The judges were Revs. T. P. Ege, Hugh Gilchrist and A. R. Steck and Wm. Arch McClean and D. P. McPherson, Esqs. The able and eloquent sermon of Rev. Dr. Billheimer in St. James Lutheran church on Sunday evening, April 26th was attended by over 100 members of Gettys Lodge of Odd Fellows in a body, and by an audience which crowded the spacious audience room. At a meeting of the Board of School Direc-tors Monday evening, April 27th, it was de-termined to buy from J. Emory Bair and Calvin Gilbert the tract of land which forms the triangle between the Chambersburg pike and the Springs road, from the railroad east to the monument. The price fixed is $1,500. Several architects have been notified of the in-tention to build, and plans are requested for a handsome, two-story brick building. SEMINARY. Rev. W. S. Oberholtzer, who was ill for quite a long time, is well again, and left for his home on Monday morning, April 27th. We extend to him our best wishes for the future. On Sunday, April 19th, Rev. Ervin Diet-erly preached at Greenvillage in the morning and at Fayetteville in the evening. Rev. L. H. Waring returned lately from Bloomington, 111., where he spent several weeks in mission work. Rev. L. B. Hafer preached for Rev. Jas. Guiney, at Cold Springs, Sunday, April 12th. On Sunday, April 12th, Rev. J. T. Huddle preached at Germantown, Pa. Rev. Charles P. Wiles has accepted a unan-imous call to the Rossville charge, York county. Rev. E. E. Neudewitz filled the pulpit for Rev. Weigle, at Mechanicsburg, on April 19. The joint council of the Myersville, Md., Lutheran charge has extended a call to Rev. Wilson L. Remsburg, of Omaha, Neb., to be-come their pastor, and it is understood that he will accept the call. Rev. Remsburg was graduated from the Gettysburg Seminary. The following Seminarians were out preach-ing on Sunday, April 26th : Rev. E. E. Par-son in the Messiah Lutheran church, Harris-burg ; Rev. C. P. Wiles at Rossville, York county, Pa.; Rev. A. A. Kelly at Mechanics-burg, Pa.; Rev. M. J. Kline in the Bethlehem Lutheran church, Harrisburg; Rev. L- F. Myers at Frederick, Md.; Rev. J. M. Guss in the Second Lutheran church, Carlisle ; Rev. J. C. Bowers at Lutherville, Md.; Rev. J. F. Crigler at Newport, Pa.; Rev. A. J. Rudisill at New Bloomfield, Pa.; Rev. Flavius Hilton at Martin's Creek, Pa., and Rev. W. H. Erhart at Silver Run, Md. LITERARY SOCIETIES. EDNA M. LOOMIS, Editor. PHILO. On Friday evening, April 17th, the Senior members of Philo Society, arra37ed in their gowns and mortarboards, followed the custom instituted by the class of '95, and rendered their valedictory program. Notwithstanding the great warmth of the evening, an unusually large audience assembled, and apparent^ were much pleased with the performance. The program was as follows : Instrumental Solo, - - - Miss DIEHL. Greeting, --- BADM. Roll Call, - RITTER. Essay, "Oratory as a Factor in Education," - - RICE. '96 on the Campus, REITZELL. Vocal Solo, - - - STOT. Poem, --- Miss LOOMIS. Oration, --- EISENHART. Retrospect, --- - MENGES. '96 on the Carpet, - ' - - - - CAKTY, Vocal Solo, - - - - - - REITZELL. '96 in I,ab., --- I,OUDO!(. Prophecy, --- YODER. Piano Solo, --- Miss DIEHL. At the close of the program, Mr. Stup, on behalf of the Senior members, presented the society with an excellent portrait of Dr. E. S. Breidenbaugh. The following men were elected to positions on the MERCURY staff for the ensuing year: Business Manager, H. R. Smith, '97; Asso-ciate Editors, S. J. Miller, '97; L- Kohler, '98; C. H. Tilp, '98; C. T. Lark, '98. The following officers were elected on Fri- THE COLLEGE MERCURY. 46 day evening, May 1st : Pres., Abel; V. Pres., Lark; Cor. Sec, Fuss; Rec. Sec, Herman; Treas., Fite; Critic, Miss Sieber; librarian, Englar; Ass't Librarian, Tilp; Subscriber for papers, Armstrong. PHRENA. On Friday evening, May 1, Phrena ren-dered the following special program before a large and attentive audience : Essay, "The Functions of the Farmers' Alliance,' Essay, "Woman's Eights," Essay, "The Complaints of the Populist Party," Music—Violin and Guitar, - - - - • - Recitation, "The Ship of Faith," Essay, "The Glory of the Democratic Party," Oration, "Why I am a Republican," Oration, "Why I am a Prohibitionist," Music—Violin and Guitar, - :- Oration, "The Know-Nothing Party," "Tang-an-ang-jeera," - Kline,'!!!) Finch,'98 0tt,'97 Manges Bros. Hickman,'99 - Spayde,'9C Shimer,'96 Brubaker,'9C Manges Bros. Woods,'98 - Weeter,'99 LITERARY QUESTIONS. Is Thomas Hardy now-a-days ? Is Rider Haggard pale ? Is Minot Savage ? Oscar Wilde ? And Edward Everett Hale ? Was Lawrence Sterne? Was Herman Grimm? Was Edward Young? John Gay? Jonathan Swift ? and old John Bright ? And why was Thomas Gray ? Was John Brown ? was J. A. White ? Chief Justice Taney quite? Is William Black ? R. D. Blackmore ? Mark Lemon? H. K. White? Was Francis Bacon lean in streaks ? John Suckling vealy, pray ? Was Hogg much given to the pen ? Are Lamb's tales sold to-day ? Did Mary Maple Dodge in time ? Did C. D. Warner ? How ? At what did Andrew Marvel so? Does Edward Whimper now ? What goodies did Rose Terry Cook ? Or Richard Boyle beside ? What gave the wicked Thomas Payne ? And made Mark Akenside ? Was Thomas Tickell-ish at all ? Did Richard Steel, 1 ask ? Tell me has George A. Sala suit? Did William Ware a mask ? Does Henry Cabot Lodge at home ? John Home Tooke what and when ? Is Gordon Cumming ? Has G. W. Cabled his friends again ?—Ex. DISAPPOINTED. T'd heard about the palisades ; One minute was enough To see that they were after all But one enormous bluff. —Yale Record. "My daughter," and his voice was stern, "You must set this matter right ; What time did the Sophomore leave, Who sent in his card last night? " "His work was pressing, father dear, And his love for it was great; He took his leave and went away Before a quarter of eight." Then a twinkle came to her bright blue eyes And her dimples deeper grew, " 'Tis surely no sin to tell him that, For a quarter of eight is two."—Ex. As Providence willed, By her bicycle killed, 'Twas thus that her epitaph ran : "In bloomers and cap Though sad the mishap She went to her death like a man."—Ex. A. G. SPALDIf k BROS "The Name is a Guarantee" that the article bearing it ia the best produced. Uniforms and Supplies of Every Description for. Base Ball = Tennis = Golf Send for Handsome Illustrated Catalogue. The Acme of Perfection— THE SPALDING BICYCLE FOP 1896. A. Q. Spalding & Bros., largest manufacturers of Bicycles and Athletic Goods in the world. NEW YORK, PHILADELPHIA. CHICAGO. ADVERTISEMENTS. DURING VACATION GO TO CHAUTAUQUA p-R El El FULL INSTRUCTIONS. NO EXPERIENCE REQUIRED H. B. WILLIAMS, Secretary, Geneva, N. Y. ■ YOU CAN EARN UO TO S100 MONTHLY AND EXPENSES IF YOU WORK FOR THE NURSERY CO. Stock sold with a guarantee and replaced. «>R.$H.$REININGER," MERCHANT TAILOR fI}@ tait Work at tfc@ Lowest 'lYiws, NEXT DOOR TO POST OFFICE, tjP-STAIRS. Suits from $121 to $40.00. Pants from $00 to $12,01 G^Centre *q[uare. COLLEGE OF PHYSICIANS I SUSGRONS, ^BALTIMORE, W|D.^ The College of Physicians and Surgeons of Balti-more, Maryland, is a well-equipped school. Four ses-sions are required for graduation. For full informa-tion send for the annual catalogue, or write to THOMAS OPIE, M. D. Dean, Cor. Calvert and Saratoga Sts. . ; c_£P=iEstablished 1876.5^5-5 ., WATCHMAKER AND JEWELER, Gettysburg Souvenir Spoons, College Souvenir Spoons. No. 10 Baltimore Street, GETTYSBURG, PENN'A. UfE|CAND|i| HONIAN^ J. A. TAWNEY I& ready to furnish clubs and boarding houses BREAD, ROLLS, M0TEL GETTYSBURG* -aSAfiBBS SllQVK- [Centre Square. ine Stationery Jeople'a *Dru(/ Store. •Jrcscripii'ono a Specialty. d.L MunqpGP, *P/iotograp/ii}er, No. 29 Baltimore St., @ETTySBUT^(S SPECIAL ATTENTION PAID TO ffiine Qollsotion of. BAffLEFIELD VIEWS Iteatfs on hand. MAIL CRDERS RECEIVE PROMPT ATTENTION. if ^«yj3w$s»* -^A-asriD— Elliott & HOUSOP. N. 3. —Stiff Hits mads to Fit the Eon in two minutes. 8. E. KiTznJul^ riivrs, CAPS, —^ —- Boors * SHOES. G^Satisfaction Guaranteed.^) No. 6 S. Baltimore Street, GETTYSBURG, PA. por all Ihe latest styles in Suitings and.Trousers, AND FULL LINE OF Gents' Furnishing Goods, Call on D. H. WELSH, York, F»a. ADVERTISEMENTS. OLLEGl!7 A® Classical Course for the Degree of A. B. II. Scientific Course for the Degree of B. S. III. Post-Graduate Course for the Degree of Ph. D. IV. Special Course in all Departments. V. Elective Studies in Junior and Senior Years. VI. New Testament Greek and Hebrew in English Bible Department. Observatory, Laboratories and new Gymnasium. Four large buildings. All buildings heated with steam from central plant. Libraries, 25,000 volumes. Fine Museum. Expenses low. Department of Hygiene and Physical Culture in charge of an experienced physician. Accessible by frequent railroad trains. Location, on BATTLEFIELD of Gettysburg; most pleasant and healthy. PREPARATORY DEPARTMENT, in separate buildings, for boyj and young men preparing for business or college, under special care of the principal and three assistants, residing with students in the building. For full particulars, apply for catalogue to HARVEY w. MCKNIGHT, D. D., LL. D., PRES'T., Penirr,sjcl)\fainf,a &,QMe>%®<, Gettysburg1!, Pa»
Based on preliminary estimates, the Lao People's Democratic Republic (PDR) economy grew by 7.5 percent in 2014, compared to an average of 8 percent over 2011-13. Looking forward, real gross domestic product (GDP) growth is projected to slow further in 2015 before accelerating in the medium term. Average annual inflation in 2014 decelerated to 4.2 percent from 6.4 percent a year earlier, driven primarily by slower growth in food prices and a decline in fuel prices. In response to a widened fiscal deficit in FY2012-13, the government embarked on much needed fiscal corrective measures in FY2013-14 and FY2014-15. Foreign exchange reserves coverage remains low as compared with prudential benchmarks. While the nominal exchange rate remained relatively stable within the band set by the Bank of Laos (BOL), the real exchange rate continued to appreciate. Indications in 2014 are that bank credit growth is slowing down sharply compared to its previous rapid pace over several years. In order to grasp new opportunities and enjoy the benefits of regional integration, it is necessary for Lao PDR to take steps to create a conducive business environment. In order to achieve broad-based, inclusive growth and poverty reduction in Lao PDR, channeling greater resources toward tackling key workforce skills and productivity challenges is of significant importance.
Although Moldova has made some important advances since the 2008 FSAP update, risks to banking sector stability have become severe. There is an urgent need, therefore, to improve transparency and governance in the banking system. Although the banking sector appears to be well capitalized and liquid, important pockets of weakness remain and vulnerabilities may be masked by fraud or misreporting. The two securities settlement systems are in need of updating, though plans to take this reform forward are not finalized. Weaknesses in the insolvency and creditor or debtor regime create uncertainty and may deter some stakeholders from engaging in financial transactions. Especially in light of the weaknesses described above and recent geopolitical uncertainties, urgent action is needed to address these and mitigate the risks to which the financial system appears to be exposed.
Several developing economies have recently introduced conditional cash transfer programs, which provide money to poor families contingent on certain behavior, usually investments in human capital, such as sending children to school or bringing them to health centers. The approach is both an alternative to more traditional social assistance programs and a demand-side complement to the supply of health and education services. Unlike most development initiatives, conditional cash transfer programs have been subject to rigorous evaluations of their effectiveness using experimental or quasi-experimental methods. Evaluation results for programs launched in Colombia, Honduras, Jamaica, Mexico, Nicaragua, and Turkey reveal successes in addressing many of the failures in delivering social assistance, such as weak poverty targeting, disincentive effects, and limited welfare impacts. There is clear evidence of success from the first generation of programs in Colombia, Mexico, and Nicaragua in increasing enrollment rates, improving preventive health care, and raising household consumption. Many questions remain unanswered, however, including the potential of conditional cash transfer programs to function well under different conditions, to address a broader range of challenges among poor and vulnerable populations, and to prevent the intergenerational transmission of poverty.
Over the past dozen years, policymakers have largely abandoned long-standing popular approaches for addressing risk in agriculture without fully resolving the question of how best to manage the negative consequences of volatile agricultural markets. The article reviews the transition from past policies and describes current approaches that distinguish between the trade-related fiscal consequences of commodity market volatility and the consequences of price and production risks for vulnerable rural households and communities. Current policies rely more heavily on markets, even though markets for risk are incomplete in numerous ways. The benefits and limitations of market-based instruments are examined in the context of risk management strategies, and innovative approaches to extend the reach of risk markets are discussed.
Beninese rice production has a major challenge: produce quality rice in sufficient quantity to meet national needs and thus reduce the quantity of imported rice. There are two weaknesses in achieving these objectives: low productivity and low quality of finished products. Both of these weaknesses are closely linked to the use of quality seeds. Seed is a productivity factor that alone could contribute to 40% of yield improvements (FAO 2008). Seed carries the genetic potential of the variety and largely determines the effectiveness of other inputs and production conditions. Therefore, the seed is one of the essential factors for any plant production system. Other factors such as: adaptation of the variety to the production ecosystem, respect of the production schedule, quality of inputs, production conditions, etc. also largely influence production results. After more than fifty years of extension of certified seed, 'the adoption rate of these seeds remained generally low in Benin, with only 22%' (Kinkingninhoun-Medagbe, 2013). Benin has a significant potential in terms of natural resources that can enable it to ensure its self-sufficiency in rice. Benin's rice production has experienced a significant quantitative increase over the last two decades, from 13 686 tonnes of paddy in 1994 to 281 428 tonnes in 2016 (FAOSTAT, 2018) This significant increase in rice production by more than 20 times in 22 years, is largely due to an increase in cultivated area (8 736 ha to 82 351 ha). The devaluation of the CFA franc in 1994 and the 2008 food crisis were the triggers. Average yields have also increased, but to a lesser extent. They rose from 1.7 t/ha in 1994 to 3.4 t/ha in 2016. This level of yield, however, remains below the world average, which now exceeds 4.6 t/ha but above the average of West Africa which is at 2.09 t/h in 2016, Senegal at 3.9 t/ha and Mali at 3.3 t/ha (FAOSTAT, 2018). There is still room for improvement. The varietal mixture that is observed from the production fields is the main problem that arises through the accessibility of small producers (less than 1 ha) to quality seeds. «96% of rice farmers in Benin have areas of less than one hectare» (Allodehou et al., 2013). This thesis carried out an integrated analysis of seed issues in the value chains of finished products. The general objective of this thesis is to analyze the dynamics within the existing seed systems and to identify improvement options that will facilitate access to quality seeds by small producers. More specifically, this thesis has: i- carried out an analytical inventory of the rice sector of Benin; ii make a thorough diagnosis of the formal seed system of rice; iii- identified seed production and distribution mechanisms in the informal system and the reasons for their persistence; iv- proposed an integrated model for improving the efficiency of the rice seed system in Benin. This research was conducted using a participatory and transdisciplinary approach. It also used a systemic approach based on a holistic analysis approach. Data collection took place in several phases and according to the main objectives of the research. It began with the document overview phase which continued throughout the hall research. An exploratory study of the whole rice sector led us to a diagnosis of the main difficulties or constraints to the development of the different value chains of local rice in Benin. This exploratory study was carried out in 2013 in all the rice-growing basins in Benin. It shows that seed quality (germination rate, varietal purity, adaptation to ecological conditions, drought, disease and yield) is mentioned by producers as one of the main factors of productivity. Processors also identified mixed paddy, including several varieties, as a factor in low milling yield (high break rate). The traders judge the quality of the hulled grain through a visual observation, based on the homogeneity and coloring of the grains, which according to them is largely determined by varietal purity. The varietal mixture gives a bad result in cooking and an unpleasant taste to consumers. Thus, the quality of rice seed affects the entire local rice sector. The participatory diagnosis was conducted in 15 communes distributed in the various rice-growing areas in Benin with the aim of better understanding the functioning of local rice value chains. The results of these investigations show that the measures that have been taken by the government, including the subsidy on seeds, fertilizers and the development of production perimeters, in response to the 2008 food crisis, have boosted paddy production. (73,000 tons in 2008 to 220,000 tons in 2012) and the development of local rice value chains. Several local rice labels have thus emerged. Since 2014, government measures aiming production increase have run out of steam and production is stagnating again. The in-depth studies focused on the operational modes of the seed systems in force and also on specific themes with well-targeted groups of actors in the three departments where research focused on Collines, Zou and Couffo departments. It is the government structures that dominate the formal seed system (SSF) in Benin. Private companies are struggling to establish themselves and prosper in a policy-interventionist environment that subsidizes seeds and creates non-competitive conditions. However, financial analyzes have shown that seed production is twice as profitable as paddy production in lowland and irrigated rice systems, and three times as much in the rainfall system. Seed producers are generally responsible for rice producers organizations. The low use of quality seed continues to find its reasons under conditions of low accessibility. The costs of disposal, the physical availability of seeds, the delay and flow of information on new varieties are often the factors involved. The formal seed system does not adequately meet the expectations of small-scale rice producers in Benin, whereas small-scale producers account for the bulk of domestic production. The modes and conditions of access to informal seeds are more varied (donation, exchanges, loans, purchases) and more adapted to the situations of smallholders. The quality of the peasant varieties meets local social and cultural norms, on the understanding that production is often used for self-consumption. The type of seed used in rice production should, in fact, be determined by the objectives pursued by the consumer rice producer and hence according to the requirements of the target market. The point is that the seed sector does not function as a real value chain serving the key players, the paddy producers and processors, as well as consumers or end users of grain. The development of the contract farming of rice production by rice mills is a condition that evolves towards a seed system integrated into value chains. The integration of seed systems into value chains is the approach that improves the use of quality seed by small producers. The proposed seed model is based on the strengths of the informal seed system, which is supported by a dynamic action-research service that regularly feeds good quality genetic material. This material will be reused for a few years (2 to 3) according to the rules of informal systems before being renewed. ; La riziculture béninoise a un défi majeur : produire du riz de qualité en quantité suffisante pour couvrir les besoins nationaux et réduire ainsi les importations. Deux faiblesses s'opposent à l'atteinte de ces objectifs : la faible productivité et la faible qualité des produits finis. Ces deux faiblesses ont un lien étroit avec l'utilisation des semences de qualité. La semence constitue un facteur de productivité qui à lui seul pourrait contribuer à 40% des améliorations des rendements (FAO, 2008). La semence porte le potentiel génétique de la variété et détermine en grande partie l'efficacité des autres intrants et conditions de production. Par conséquent, la graine est un des facteurs essentiels pour tout système de production végétale. D'autres facteurs comme l'adaptation de la variété à l'écosystème de production, le respect du calendrier de production, la qualité des intrants, les conditions de production, etc. influencent aussi largement les résultats de la production. Après plus de cinquante années de vulgarisation des semences certifiées, « le taux d'adoption de ces semences est resté en général très faible en Afrique, avec seulement 22% au Bénin » (Kinkingninhoun- Medagbe, 2013). Le Bénin dispose d'un potentiel non négligeable en ressources naturelles pouvant lui permettre d'assurer son autosuffisance en riz. La production rizicole béninoise connaît depuis ces vingt dernières années une progression quantitative sensible passant de 13 686 tonnes de paddy en 1994 à 281 428 tonnes en 2016 (FAOSTAT, 2018) Cette importante augmentation de la production rizicole de plus de 20 fois en vingt-deux ans, s'est faite en grande partie grâce à une augmentation des superficies (8 736ha à 82 351 ha). La dévaluation du franc CFA en 1994 et la crise alimentaire de 2008 ont été les déclics. Les rendements moyens ont aussi progressé mais dans une moindre mesure. Ils sont passés de 1,7 t/ha en 1994 à 3,4 t/ha en 2016. Ce niveau de rendement reste cependant inférieur à la moyenne mondiale qui dépasse aujourd'hui 4,6 t/ha mais supérieur à la moyenne de l'Afrique de l'Ouest qui est à 2,09t/h en 2016, Sénégal 3,9 t/ha et Mali 3,3 t/ha (FAOSTAT, 2018). Une réelle marge de progression existe encore. Le mélange variétal qui s'observe depuis les champs de production est la problématique principale qui se pose à travers l'accessibilité des petits producteurs (moins d'1ha) aux semences de qualité. «96% des riziculteurs du Bénin ont des emblavures de moins d'un hectare » (Allodehou et al., 2013). Cette thèse a réalisé une analyse intégrée des questions semencières dans les chaînes de valeur des produits finis. L'objectif général de cette thèse est d'analyser les dynamiques au sein des systèmes semenciers existants et d'identifier des options d'amélioration pour faciliter l'accès des petits producteurs aux semences de qualité. Plus spécifiquement, cette thèse a : i- réalisé un état des lieux analytique de la filière rizicole du Bénin ; ii- fait un diagnostic approfondi du système semencier formel du riz ; iii- identifié les mécanismes de production et de distribution des semences dans le système informel et les raisons de leur persistance et ; iv- proposé un modèle intégré pour une amélioration de l'efficacité du système semencier du riz au Bénin. Cette recherche a été conduite suivant une approche participative et transdisciplinaire. Elle a suivi une démarche systémique fondée sur une approche d'analyse holistique. La collecte des données s'est déroulée en plusieurs phases et suivant les principaux objectifs de la recherche. Elle a commencé par la phase de revue documentaire qui s'est poursuivi tout au long de cette recherche. Une étude exploratoire de toute la filière rizicole nous a conduit à un diagnostic des principales difficultés ou contraintes au développement des différentes chaînes de valeur du riz local au Bénin. Cette étude exploratoire a été menée en 2013 dans tous les bassins rizicoles au Bénin. Il en ressort que la qualité des semences (taux de germination, pureté variétale, adaptation aux conditions écologiques, sécheresse, maladies et rendement) est évoquée par les producteurs comme un des principaux facteurs de productivité. Les transformateurs ont aussi identifié le paddy mélangé, comprenant plusieurs variétés, comme facteur de faible rendement à l'usinage (taux de brisure élevé). Les commerçants, jugent la qualité du grain décortiqué à travers une observation visuelle, basée sur l'homogénéité et la coloration des grains, qui selon eux est en grande partie déterminée par la pureté variétale. Le mélange variétal donne un mauvais résultat à la cuisson et un goût désagréable aux consommateurs. Ainsi, la qualité des semences de riz influe sur tout le secteur de la riziculture locale. Le diagnostic participatif a été conduit dans 15 communes réparties dans les divers bassins rizicoles au Bénin dans le but de mieux appréhender le fonctionnement des chaînes de valeur du riz local. Les résultats de ces investigations montrent que les mesures qui ont été prises par le gouvernement, notamment la subvention sur les semences, les engrais et l'aménagement de périmètres de production, en réponse à la crise alimentaire de 2008, ont stimulé la production du paddy (73.000 Tonnes en 2008 à 220.000 Tonnes en 2012) et le développement des chaînes de valeur du riz local. Plusieurs labels de riz local ont ainsi vu le jour. Depuis 2014, les mesures gouvernementales destinées à booster la production se sont essoufflées et la production stagne à nouveau. Les études approfondies ont porté sur les modes opérationnels des systèmes semenciers en vigueur et aussi sur des thématiques spécifiques avec des groupes d'acteurs bien ciblés dans les trois départements où la recherche s'est focalisée à savoir les Collines, le Zou et le Couffo. Ce sont les structures étatiques qui dominent le système semencier formel (SSF) au Bénin. Les entreprises privées ont du mal à s'établir et à prospérer durablement dans un environnement de politique interventionniste qui subventionne les semences et qui crée de ce fait des conditions non-compétitives. Cependant, les analyses financières ont révélé que la production de semences est deux fois plus rentable que la production du paddy dans les systèmes de riz de bas-fond et de riz irrigué, et l'est trois fois plus dans le système pluvial. Les producteurs semenciers sont généralement des responsables des organisations de producteurs du riz. La faible utilisation des semences de qualité, continue de trouver ses raisons dans les conditions de faible accessibilité. Les coûts de cession, la disponibilité physique des semences, le délai et la circulation des informations sur les nouvelles variétés sont les facteurs souvent mis en cause. Le système semencier formel ne répond pas convenablement aux attentes des petits producteurs de riz du Bénin, alors que ce sont les petits producteurs qui assurent l'essentiel de la production nationale. Les modes et conditions d'accès aux semences informelles sont plus variés (don, échanges, emprunts, achats) et plus adaptés aux situations des petits producteurs de riz. La qualité des variétés paysannes obéit à des normes sociales et culturelles locales étant entendu que la production sert souvent à l'autoconsommation. Le type de semences utilisé dans la production rizicole devrait, en effet, être déterminé par les objectifs poursuivis par le producteur de riz de consommation, et donc selon les exigences du marché visé. Le constat est que le secteur semencier ne fonctionne pas comme une véritable chaîne de valeur au service des acteurs clés, c'est-à-dire les producteurs et transformateurs de paddy, ainsi que les consommateurs ou utilisateurs finaux des grains. Le développement de la contractualisation de la production du riz par les rizeries est une condition qui fait évoluer vers un système semencier intégré aux chaînes de valeur. L'intégration des systèmes semenciers aux chaînes de valeur est l'approche qui améliora l'utilisation des semences de qualité par les petits producteurs. Le modèle semencier proposé se fonde sur les points forts du système semencier informel qui reçoivent l'appui d'un service recherche-action dynamique qui réinjecte régulièrement du matériel génétique de bonne qualité. Ce matériel sera réutilisé pendant quelques années (2à3) suivant les règles des systèmes informels avant de se faire renouveler.
Against the background of a new Labor Day weekend job report that found zero job net growth for the month of August, Republican candidates held another debate, this time under the auspices of MSNBC, not Fox. It took place in the Reagan library, in Simi Valley, California, with the 1980s Air Force One plane used by Reagan looming behind them as a powerful yet incongruent décor. Texas Governor Rick Perry, who entered the race three weeks ago and has already managed to reshape it, made it a contest between himself and Mitt Romney. Jon Huntsman is now a distant third in the polls, and the rest have been consigned to the back bench. Perry has consolidated support across a large swath of the Republican base, including Tea Partiers and the Evangelical right and already has amassed a war chest of campaign funds from contributors from Texas and across the country. Interestingly enough, Karl Rove, the self appointed kingmaker of the GOP and former GW Bush closest advisor, has come out against Perry, calling some of his views "toxic".As the first fundamental tests of the Republican primary approach, the campaign clearly entered a new stage last Wednesday during a debate that was mainly a duel between two protagonists, while the rest, acting as a Greek chorus reinforcing or challenging their responses, were given very little time by hosts Brian Williams (NBC) and John Harris (Politico). The primary field as first constituted was lackluster and therefore demanded new candidates. Perry seems to have satisfied that demand for the time being. Nevertheless, after the debate there was still some discontent among establishment Republicans, so the race is still fluid and new candidates may jump in before the first deadline in October.Governor Perry, as the front-runner in the latest polls, was not surprisingly the target of most of the others throughout the night. He has executive experience, a commanding demeanor, and a record to run on. Although not completely articulate, and lacking Romney's polished eloquence, he is tough and quick in his retorts, and his rhetoric resounded with the audience, drawing the strongest applause every time. His claim that he has created more jobs in Texas than Obama has managed to create nationally may be a winner with voters, but Texas' record on almost every other issue is unflattering and thus, main ammunition for his opponents. He was reminded, for example, that of all fifty states, Texas is last on education, to which he responded that Texas' problems stem from its long border with Mexico. That probably did not go well with the Hispanic voters watching on Univisión and Telemundo, but Perry doesn't seem to care, since he is riding the wave of anti-Latino feelings around the country. Confronted with the claim that Texas has the largest number of people without health insurance than all other 49 states , he did not give a direct answer but chose instead to mumble something about how "all Texans want is to get the federal government out of their lives". Both Michelle Bachman and Rick Santorum questioned Perry's social conservatism given his policy as governor, for example, to inoculate adolescent girls against HPV, which they portrayed as a government intrusion into the family realm and a license to practice pre-marital sex. And Ron Paul, a congressman from Texas, was a constant goad on the Governor's side, reminding the public that Perry used to be a Democrat and wholeheartedly supported Al Gore on his presidential bid in 1988. Perry defended himself well as he dismissed all the charges against him with one-liners and a disdainful smile. A shrewd politician and experience campaigner, he took the initiative at every turn and was able to steer the conversation to his own record of job creation as governor of Texas, contrasting it mockingly with Romney's as governor of Massachusetts. But Romney appeared unfazed as he joked that Perry could not take credit for everything that has gone well in the State of Texas, including its wealth of oil and gas, its zero state income tax and the (related) fact that main corporations made their headquarters there long before Perry was governor. Massachusetts is a much smaller state and has none of those advantages, he added. There were several quick exchanges like this: both candidates were well prepared to respond with facts and statistics, and the perception was that they both did well, with Perry defending himself aggressively at times and Romney maintaining his smooth and relaxed demeanor, even as he waited for the opportunity to deliver a blow to his new challenger.Host Brian Williams soon gave him that opportunity by asking Perry a question about Social Security, the government pension fund that experts say, will become insolvent in the year 2036 if it is not reformed. Perry's answer, which confirmed similar statements in his recently published book, made all the headlines the next day. He called it a "Ponzi scheme' (implying a criminal enterprise) and added that it was a "monstrous lie" to tell young people under thirty that they would get their Social Security when their time comes for them to retire: they won't. This statement has been reported by the Romney campaign as Perry's Waterloo: no candidate will win an election by making this kind of claim against the "third rail" of politics, a cherished and untouchable public trust; to do so is pure political suicide. Similar claims had prompted Karl Rove's comment about Perry's toxicity and spurred doubts about his electability. Ironically, it is the rhetoric and not the substance that separates the two candidates on this issue: as presidents, both would likely propose some privatization of Social Security, perhaps in the form of personal retirement accounts that can be managed by the workers themselves and would allow them to invest in the stock market. Another of Brian William's questions brought an unexpected burst of applause by the all- Republican audience even before Perry had had a chance to answer it. Williams asked how he could sleep at night knowing his state had applied the death penalty to 234 convicts, the highest rate in the nation, and some of whom were perhaps innocent. Perry said the crimes they had perpetrated deserved it, and that yes, he slept fine at night knowing that the appeals process was thorough and fair. Of course, people are entitled to their views on the death penalty, and quotes from the Bible have been used to justify it. But it is sad and even incongruous to see a purportedly well educated middle class audience of a purportedly Christian nation cheer the notion. Patti Davis, President Reagan's daughter, later said to an interviewer it was almost" blasphemous" to celebrate the death penalty at the Reagan library, given the fact that her father had approached the issue with a heavy heart and burden to his conscience, albeit accepting it as a necessary evil. Mitt Romney appeared poised, fluent on the economy and self confident. It may help him knowing that he has 250 billion dollars in his own personal account, and that he has outpaced all other candidates so far in fundraising. He seems to be the choice of the business elite and of urban and suburban Republicans (60% of his donors come from big cities and their surroundings). On the other hand, Perry's supporters say that through his ten years as governor of Texas, Perry has laid the groundwork to raise all the money he might need for a national election. He has a donor network that can "bundle" millions. Texas places no limits on how much donors can give to political campaigns, even as federal law limits donations to the derisory amount of $2,500 per person. Still, some critics say Perry would need to capture a broader donor base to compete in a national election. Michelle Bachman's adventure into the Republican primary may be coming to an end as her star fades and Tea Partiers and Evangelicals transfer their support to Rick Perry. Her campaign is in disarray over fundraising and strategy. Ed Rollins, a veteran GOP operative who managed Reagan's 1984 campaign, resigned as her advisor after Bachman could not be persuaded to focus on campaigning in Iowa only (where the first primary caucus will take place and where she won a straw poll a few weeks ago), instead of trying to run a national campaign. She hasn't been able to raise enough money outside Iowa and that limits her campaign's choices. Perry has taken her thunder. It doesn't help that the Congress woman keeps repeating her Manichean views on every single issue, insisting for example again during this debate, that it was wrong for the US to intervene in Libya because there was no national interest involved in the region, a position that nobody in the GOP establishment shares, especially now that Qaddafi is all but defeated.On Thursday, after two changes in schedule were forced on the White House (one due to the GOP debate on Wednesday, the other due to the opening of the NFL season shown at prime time on Thursday night), President Obama delivered his much awaited jobs creation speech. He unveiled a $ 447 billion plan, a mixture of tax cuts and new spending programs. It includes extending cuts in payroll taxes to individuals and employers, new infrastructure spending, a new mortgage refinancing program, retraining for the unemployed and tax credits to businesses that employ those who have been out of a job for over six moths. He also talked about a private-public infrastructure bank and emphasized that all this new spending would be coupled with more cuts in the deficit later. This was an attempt at a new marketing of the President's measures to stimulate the economy: he was more specific, more conciliatory and avoided using the word "stimulus" that has gotten so much bad press since most people think the initial package did not help the economy one bit.The President spoke with new confidence and conviction; he sounded re-energized and optimistic, and evoked in the public memories of "Obama the candidate". The next morning he was on the road to sell his plan to voters first in Virginia, speaking to 9,000 people gathered at the University of Richmond. Virginia, Ohio and North Carolina are the three states the President strategically chose to visit. Obama won all three in the 2008 election but they each voted Republicans to their legislatures in last year's mid-term elections. The Republican response in Congress was cautiously positive. Indeed, even as Obama's numbers in the polls continue to drop (44% approval rate of his person, with 59% disapproving of his handling of the economy, is the latest), approval of Congress is at an all time low of 13%. A change is tone has registered as Republicans realize that their do-nothing strategy has gone too far and it is time to stop playing the political game and address economic recovery in earnest. It is indeed refreshing, after the acerbic debt ceiling fights, to hear House majority leader Eric Cantor say it's time to build consensus and work together. Their brinkmanship has infuriated their constituents and put at risk all the gains made in last year's mid-term elections.It remains to be seen whether the electorate's disgust with excessive conflict and confrontation within the DC belt also extends to the presidential primary. Will voters choose the bold and aggressive governor from Texas who better reflects their anger with his provocative language (he wants to cut the "head off the snake" (meaning the federal government's interference with states policies), or the cooler, more cerebral, more conciliatory (indeed, in some ways, more Obama-like) candidate from Massachusetts that wants moderation and speaks to the middle class? In this head-to-head contest between Perry and Romney, one can assume people will ultimately choose the one they see can solve their problems, end the paralysis and get the country moving again. But the country's social fabric is torn by unemployment, anger and frustration with government and hopelessness about the future. As the more aggressive candidate, Perry may well be the one that embodies the spirit of the times.In his first national appearance, the Texan did not make any major mistakes. He has dislodged Romney from top in national polls, but not in New Hampshire, where Romney still leads by a wide margin. From now on, the calendar will drive the candidates' strategies. If Perry wins Iowa and Romney New Hampshire, it will definitely become a two person race going forward into South Carolina, where Baptists most likely will choose a Texan Evangelist over a New Englander Mormon. That might interrupt Romney's momentum. Then comes Florida, where there is a big number of Tea Partiers and an even larger number of retirees. The vote of these two groups will be decisive. Perry could lose the retirees on his Social Security attacks, which were mainly addressed to young voters who don't vote in primaries. But there is plenty of time to adjust his views and rectify his blunders so as to become more electable.Cocky, dark and handsome, a cross between Johnny Cash and John Wayne, Perry has a formidable presence that makes a good impression on voters. Blunt and direct in his speech, with a distinct Southern accent, his peculiar kind of charisma compensates for his lack of polish. He is tough and rugged, doesn't back down, and appeared solid in his philosophy of "detax, deregulate and delitigate". He is clearly the candidate that can win the Mid-West and the Deep South. The question is whether he will withstand the deeper scrutiny of a presidential race he entered late, and whether he can refine his arguments and still be reassuring. Romney still appears as the more electable candidate in a national election and the one that can more easily confront Obama. But he has two main weak points: his religion (he is a Mormon, a religion that has a bad name among other Christian denominations) and the Massachusetts health care law he signed when he was governor, that his rivals claim is a replica of what they disdainfully call "Obamacare", which all candidates, including Romney, have avowed to repeal as soon as they get to the White House. Will the race become a two-man contest from this point on? Americans should not hold their breath; there is still talk about new candidates entering the race: Sarah Palin and Rudy Giuliani seem to be waiting on the sidelines, ready to jump into the race at any time if prompted to do so by the polls or by the GOP establishment. The current survivors may still be challenged by others with more staying power and reality show experience.Senior Lecturer, Department of Political Science and Geography Director, ODU Model United Nations Program Old Dominion University, Norfolk, Virginia
{EM}INTERNATIONAL COUNCIL OF SCIENTIFIC UNIONS - ICSU{/EM}{/p} {P}{B}SCIENCE INTERNATIONAL Newsletter No. 69, December 1998{/B}{/P} {P}{B} Code Number:NL98004 {BR} Sizes of Files: {BR} Text: 145K {BR} Graphics: Line drawings (gif) - 32K{BR} Photographs (jpg) - 52K {/B}{P} {P}{B}WORLD CONFERENCE ON SCIENCE{/B}{BR} {I}Budapest, Hungary, 26 June - 1 July 1999{/P} {/I} {P}{B}Science for the 21st century: {I}A new commitment{/B}{/P} {/FONT}{P}{/P} {/I}{P}The main goal of this important meeting, which around 2,000 participants are expected to attend, is to bring together policy makers from both the political and the administrative world, and members of the scientific community at large, to reflect together on the future of scientific research, its impact on society and the demands of society on science.{/P} {B}{P}Vostok Lake, Antarctica{/P} {/B}{P}Dr Peter D. Clarkson Research,{BR} {P}A common perception is that Antarctica is a frozen continent and that is predominantly correct. In the more northerly coastal regions of the continent, particularly in the Antarctic Peninsula, summer temperatures may rise above 0C and, on warm sunny days, streams may flow from melting glaciers and snow fields. Not surprisingly, therefore, there are many small lakes and ponds that can lose their ice cover during the summer. What is surprising, however, is that the largest known lake in Antarctica is about twenty-five times the area of Lake Geneva in Switzerland (or somewhat smaller in area than Lake Ontario on the United States-Canada border, but it has a larger volume of water) and it is sandwiched between the bedrock of the continent and about 4 km of the overlying ice sheet.{/P} {P}{B}Harmful Algal Blooms{/B}{/P} {P}A new International Programme on Global Ecology and Oceanography{/P} {/B} {P}Elizabeth Gross,{/P} {P}The last two decades have been marked by an extraordinary expansion in the occurrence of the marine phenomenon we now call "harmful algal blooms". These blooms of toxic or harmful micro-algae, often inaccurately referred to as "red tides", represent a significant and expanding threat to human health and fisheries resources throughout the world. They take many forms, ranging from massive accumulations of cells that discolor the water, to dilute, inconspicuous populations that are noticed only because of the harm caused by the highly potent toxins these cells contain. The impacts of these phenomena include: mass mortalities of wild and farmed fish and shellfish; human poisonings and fatalities from the consumption of contaminated shellfish or fish; alterations of marine ecosystem structure through adverse effects on larvae and other life history stages of commercial fisheries species; and the death of marine mammals, sea birds, and other animals. On this last point, there is now a growing appreciation of the extent to which HABs impact resources other than shellfish and fish. Human illnesses and fatalities due to five syndromes associated with harmful algae are being recorded around the world in increasingly large numbers.{/P} {B} {P}The Fifth IGBP Scientific Advisory Council Meeting{BR} Nairobi, Kenya, {/FONT}{I}1 to 7 September 1998{/P} {/B}{/I}{P}Sheila Lunter, {/P} {P}Despite a postponement and a preparation that was marked by adversity, a successful Fifth Scientific Advisory Council (SAC-V) Meeting of IGBP was held in Kenya. Many African scientists attended the meeting, which had a total participation of some 170 scientists. SAC-V was hosted by the Kenyan National Academy of Science (KNAS), with the United Nations Environment Programme (UNEP) generously offering the use of the conference facilities at their headquarters in Gigiri, just outside Nairobi.{/P} {P}{B}NEW RESEARCH PROJECT UNDERWAY{/P} {P}Health and the environment{/P} {/B}{/FONT}{P}Heike Schroeder, {/P} {P}Health has become one of the major new integrative global change research areas, and indeed the links between environment and health are becoming increasingly visible and complex. Extreme weather patterns highlighted by the recent El Niño cycle, emergent diseases, viral mutations and environmental degradation are all contributing to this development.{/P} {P}{B}DIVERSITAS/IBOY{/B} {br}An International Biodiversity Observation Year{/P} {P} H.A. Mooney, C.S. Adam, A. Larigauderie and J. Sarukhan.{/P} {P}{B}What is DIVERSITAS?{/B}{/P} {/B}{P}DIVERSITAS is an international programme of biodiversity science which was created in 1991. It is cosponsored by six international scientific organisations: the International Union of Biological Sciences (IUBS), the Scientific Committee on Problems of the Environment (SCOPE), the United Nations Educational, Scientific and Cultural Organisation (UNESCO), the International Union of Microbiological Societies (IUMS), the International Council for Science (ICSU), and the International Geosphere-Biosphere Programme (IGBP).{/P} {B}{P}DIVERSITAS - START - WCRP - IGBP - IHDP{/P} {P}Chair & Directors Forum{/P} {/B}{P}Heike Schroeder,{/P} {P}Global Change System for Analysis, Research and Training (START) and the Global Environmental Change (GEC) programmes held their annual Chairs and Directors Forum on 14-16 August 1998, in Bonn, Germany. The purpose of this Forum is to provide an opportunity for the programmes' Executive Directors and Scientific Chairs to exchange information on an informal basis and discuss new and ongoing activities and ways for the programmes to enhance collaboration and streamline their research efforts.{/P} {P}{BR} {I}{B}Spotlights on science{/I}{/B} {/P} {P}{B}The International Union of Crystallography{/B}{/P} {/B}{P}M. Dacombe{/P} {P}The International Union of Crystallography (IUCr) was formed in 1947 and formally admitted to ICSU on 7 April in that year. Its main objects are: to promote international cooperation in crystallography; to contribute to the advancement of crystallography in all its aspects; to facilitate international standardization of methods, of units, of nomenclature and of symbols used in crystallography; and to form a focus for the relations of crystallography to other sciences. It does this primarily through its publications, the work of its Commissions and Sub-Committees, and its triennial Congresses.{/P} {P}{B}International Union for Pure and Applied Biophysics {br}IUPAB{/P} {/B}{P}A.C.T. North,{/P} {P}Most biophysicists have probably had the same experience as me and been faced by a look of blank incomprehension after giving the answer "biophysics, "to the question "what is your subject?".{/P} {B}{I}Meeting reports{/P} {/I}{P}ICSU/CODATA{BR} 16th Biennial International CODATA Conference and General Assembly{/P} {I}{P}Habitat Center, New Delhi, India,{BR} Nov. 8 - 14, 1998{/P} {/B}{/I}{P}Report by Professor Paul G. Mezey, {P}{B}SATELLITE MEETINGS{BR} {/B}The Conference was preceded by two CODATA Task Group Satellite Meetings and Symposia, held at the Indian National Science Academy, New Delhi. On November 6 and 7, 1998, the CODATA Task Group for Data Sources in Asia-Oceania held a Meeting and Seminar, whereas on November 7, 1998, the CODATA Task Group for Data/information and Visualization held a Study-Tutorial Workshop on "Information, Visualization, and Management of Heterogeneous Systems". Both meetings were well attended. The high scientific level and the special Tutorial feature of the Data/Information and Visualization Task Group Symposium provided inspiration for future, similar meetings.{/P} {P}{/P} {B}{P}Electronic Publishing in Science {br}Report on a joint AAAS/ICSU Press/UNESCO Workshop in Paris{/P} {/B}{P}D.F. Shaw, {BR} {P}Forty-three participants accepted invitations from the joint organising committee and represented an international range of interests covering the Universities, Learned Societies, National Science Academies, National and Institutional Libraries and STM Publishers, as well as commercial information brokers and consultants.{/P} {B}{P}Dairy Foods in Health{BR} International Conference, Wellington, New Zealand{/P} {/B} {P}Specialists from 22 countries as far apart as Canada, Finland, Japan and Thailand attended the International Dairy Federation's Nutrition Week from 9-11 March 1998. The New Zealand hosts, the Milk and Health Research Centre of Masey University and the New Zealand Dairy Research Institute, welcomed 191 participants to an ambitious programme with leading nutrition scientists from all around the world. A dinner cruise was arranged on Wellington Harbour for participants. The kind weather and the festival atmosphere in Wellington combined to make the event enjoyable for all.{/P} {B}{I}{P}Calendar{/P}{/B}{/I} Details of forthcoming events from 1 January 1999 - 25 March 1999 {B}{P}ICSU/IGFA{BR} Global Change Research{/B}{/P} {P}The International Group of Funding Agencies for Global Change Research (IGFA) is an informal body of representatives of agencies and ministries of 21 countries plus the European Union responsible for the funding of global change research.{/P} {B}{P}{I}Science and technology{/I}{/B}{/P} {P}{B}Identification of science and technology priorities for Asian Regional Cooperation{/B}{/P} {P}B. Babuji{/P} {P}The following topics were presented for discussion:{/P} {LI}Country presentations on S & T status {/LI} {LI}Current and emerging global S & T senario {/LI} {LI}Identification of priority areas for Asian regional cooperation {/LI} {LI}Modes of cooperation {/LI} {LI}Resource mobilisation and way forward{/LI} {/P} {P}{B}Easing the burden on young scientists{/B}{/P} {/B}{P}Daniel Schaffer, {/P} {P}Two of the principal aims of the Third World Academy of Sciences (TWAS) are to promote the careers of young scientists in the developing world and to help scientific institutions in the South to strengthen their decision-making and research capabilities. These two goals came together in the TWAS Prize for young scientists.{/P} {P}{B}South's Centres of Excellence{/B}{BR} {/B}(New volume published){/P} {P}Daniel Schaffer,{/P} {P}The Third World Network of Scientific Organizations (TWNSO), in collaboration with the South Centre and Third World Academy of Sciences (TWAS), has announced the publication of the second edition of Profiles for Scientific Exchange and Training in the South. With more than 430 entries, the book represents a unique inventory of the capabilities and accomplishments of the most prominent research and training centres in the developing world.{/P} {B}{I}{P}news in brief{/I}{/B}{/P} {P}{B}Fields Medal and the Nevanlinna Prize {br}International Congress of Mathematicians, Berlin 1998{/P} {/B}{P}In physics or literature they have the Nobel Prize, and in mathematics there is the "Fields Medal". This highest scientific award for mathematicians was presented at the opening ceremony of the "International Congress of Mathematicians" to Richard E. Borcherds, Maxim Kontsevich, William Timothy Gowers and Curtis T. McMullen. The International Mathematical Union also awarded the "Nevanlinna Prize" for outstanding work in the field of theoretical computer science to the mathematician Peter Shor.{/P} {B}{P}Food Security {I}{br}What have Sciences to Offer?{/P} {/B}{/I}{P}David Hall,{/P} {P}The author of this report was asked to examine what opportunities exist for the sciences to play in ensuring food security in the next century. In parallel to this, would there be a role for ICSU members and scientists of varied disciplines to play, which would be effective and not duplicate existing efforts?{/P} {B}{I}{P}Electronic Journal Publishing{/P} {/I}{P}A Reader{/P} {/B}{P}To further support our work in the strengthening and development of the dissemination of research results, we are in the process of bringing together a series of articles and Internet documents which we have found interesting and insightful.{/P} {/I}{B}{P}INASP adds new section to its web site{/P} {P}{/P} {/B}{P}INASP Links and Resources "Access to Information"{/P} {B}{P}Discovery of Polonium and Radium{/P} {P}{/P} {/B}{P}An International Conference on {I}The Discovery of Polonium and Radium: its scientific and philosophical consequences, benefits and threats to mankind {/I}was organized by the Polish Government in Warsaw in September 1998.{/P} {B}{P}TREASURER OF THE IUBMB RESIGNS{/P} {/B}{P}Dr R. Brian Beechey, the Treasurer of IUBMB, has tendered his resignation as from 31 December 1998, citing his wish to pursue other interests.{/P} {B}{I}{P}Book Marketing and Distribution:{/P} {/I}{/B}{P}A practical handbook for publishers in developing countries and related training programmes{/P} {B}{P}New edition of ICSU's blue book{/B} {br}UNIVERSALITY OF SCIENCE:{/P} {P}{/P} {P}A new edition of the handbook of ICSU's Standing Committee on Freedom in the Conduct of Science SCFCS has been printed.{/P} {B}{I}house news{/P} {/I}{P}New Environmental Science Officer appointed at ICSU{/B}{/P} {P}Anne Lorigouderie joined the ICSU Secretariat as Environmental Sciences Officer in September.{/P} {B}{P}Qiu Wei joins us from CAST{/P} {/B}{P}Qiu Wei succeeds Zhang Hong, on secondment from the China Association for Science and Technology for another period of six months as of November 1998. {/P} {B}{P}Catherine moves on{/P} {/B}{P}After four years at the ICSU Secretariat, Catherine Leonard left in December. During her time at ICSU, Catherine's responsibilities have included administering the ICSU Grants Programme and editing the ICSU Year Book. {/I}{P}{B}ICSU Grants Programme for 1999{/B}{/P} {P}ICSU is pleased to announce that around one million dollars has been awarded to ICSU bodies under the ICSU grants programme for 1999. Almost half that amount has been allocated to category I grants in the $50,000 - $100,000 range for new innovative projects of high profile potential.{/P} {B}{P}Looking ahead to the millennium{/P} {P}{/P} {/B}{P}For 2000, ICSU is opening up its Category I grants programme to all of ICSU's Joint Initiatives - as it did for the 1999 Programme- and to all ICSU Scientific Associates.{/P} {B}Obituary{/B}{/P} {/I}{P}Lars Ernster 1920-98{I} {/P} {/B}{/I}{P}Lars Ernster died in his 79th year in November. Although born in Budapest he spent almost all his working life in Sweden and most of his academic life at the University of Stockholm. He began a close and long association with ICSU in 1969 when he was appointed Secretary of the Swedish National Committee on Biochemistry and this led to greater demands on his organizational talents when shortly after this he took over the Chairmanship of the Organizing Committee for the highly successful 9th International Congress on Biochemistry, which was held in Stockholm in 1973.{/P} {B}{P}New Directions in Chemistry{/P} {P}15-17 July 1999, Hong Kong{/P} {P}{/P} {/B}{P}The first IUPAC Workshop on Advanced Materials: Nanostructured Systems (IUPAC-WAM-1) will be held on the campus of the Hong Kong University for Science and Technology from 15-17 July 1999.{/P} {P}Copyright 1998 ICSU Press
AGREEMENT SHEET This is to certify that the Journal with the title "AN ANALYSIS OF ENGLISH TEXTBOOK FOR FIRST GRADERS OF SENIOR HIGH SCHOOL "BAHASA INGGRIS UNTUK SMA/MA DAN SMK/MAK KELAS X" PUBLISHED BY PUTRA NUGRAHA AND USED IN SMAN 18 SURABAYA BASED ON BASIC COMPETENCES OF CURRICULUM 2013" written by ABU DARRIN (NIM.102084005) has been thoroughly checked and fulfilled the requirements for Yudisium. Surabaya, January 2014 Advisor Drs. Fahri, M.A. NIP. 19640819 199003 1 003 AN ANALYSIS OF ENGLISH TEXTBOOK FOR FIRST GRADERS OF SENIOR HIGH SCHOOL "BAHASA INGGRIS UNTUK SMA/MA DAN SMK/MAK KELAS X" PUBLISHED BY PUTRA NUGRAHA AND USED IN SMAN 18 SURABAYA BASED ON BASIC COMPETENCES OF CURRICULUM 2013 Abu Darrin English Education Department, Language and Art Faculty, Surabaya State University Email: abudarrin92@gmail.com Drs. Fahri, M.A. English Education Department, Language and Art Faculty, Surabaya State University. Email: fahri@unesa.ac.id Abstrak Kurikulum adalah sebuah alat untuk mengontrol implementasi dari pendidikan di semua negara tidak terkecuali Indonesia. Di tahun 2013, pemerintah Indonesia telah menerbitkan kurikulum yang baru yaitu kurikulum 2013. Kurikulum ini diklaim dapat meningkatkan kualitas pendidikan di Indonesia. Berkaitan dengan pentingnya hal tersebut, kesesuain antara materi di dalam buku pelajaran dengan kompetensi dasar di dalam kurikulum 2013 juga sangatlah penting. Hal ini juga didukung oleh fakta bahwa kebanyakan guru menggunakan buku pelajaran sebagai sumber utama pengajaran di dalam kelas karena pelatihan guru tentang kurikulum baru ini masih minim sekali. Penelitian ini dilakukan untuk mengetahui apakah komtensi dasar di dalam buku pelajaran dengan judul "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" yang diterbitkan oleh Putra Nugraha sesuai dengan kompetensi dasar yang tercantum di dalam silabus bahasa inggris kurikulum 2013. Selain itu, penelitian ini juga dilakukan untuk mengetaui dan mendeskripsikan materi-materi apa saja di dalam buku pelajaran tersebut diatas yang sesuai dengan kompetensi dasar di dalam silabus kurikulum 2013. Dengan menggunakan konsep deskriptif kualitatif, penelitian ini menggunakan field notes yang diadaptasi dari garis besar evaluasi buku pelajaran di dalam BSNP (Badan Standar Nasional Pendidikan). Materi di dalam buku pelajaran ini dianggap sesui apabila telah memenuhi indikator materi urutan dari kompetensi dasar kurikulum 2013. Dari hasil penelitian, dapat diketahui bahwa semua kompetensi dasar di dalam buku pelajaran sesuai dengan kompetensi dasar di dalam silabus kurikulum 2013. Selain itu, diketahui juga bahwa kebanyak materi di dalam buku pelajaran tersebut tidak sesuai dengan kompetensi dasar di dalam silabus kurikulum 2013. Materi yang sesuai antara lain adalan materi di dalam bab 1, 2, 3, 5 dan 7. Ketidaksesuain tersebut kebanyakan disebabkan oleh ketidaksesuaian urutan materi di dalam buku pelajaran dengan kompetensi dasar kurikulum 2013.Kata Kunci: Buku Pelajaran Bahasa Inggris, Kompetensi Dasar kurikulum 2013, kesesuaian. Abstract Curriculum is a tool to control the implementation of education in the country including Indonesia. In 2013, the Indonesian government has issued a new curriculum, namely, curriculum 2013. It is claimed as improving the education in Indonesia. Since it is very important, the conformity between the materials in the textbook to the 2013 English basic competence is also taking a vital role in implementing this new curriculum. It is supported by the fact that mostly the teachers uses textbook to deliver the material in the class because they are not well introduced yet to it. This research is conducted to figure out whether the basic competences in the textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha conform to the basic competences in the syllabus of English curriculum 2013 or not. Besides, this also figure out whether the materials in the textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha conform to the basic competences in the syllabus of English curriculum 2013 or not. By employing the concept of descriptive qualitative study, this research uses the field notes which are adapted from BSNP textbook evaluation guideline as the research instrument. The textbook is claimed as representing the basic competence of the syllabus in the curriculum if the materials completely conform to the basic competences and its sequence. The results of this study show that all of the basic competences in the textbook conform to the basic competences for first graders of Senior High School in the first semester syllabus of English curriculum 2013. Besides, it also shows that most of the materials in the textbook do not conform to the basic competences in the syllabus of English curriculum 2013. Few of the relevant materials are there in chapter 1, 2, 3, 5 and 7. In addition, most of the inconformity of the materials in the textbook is because they are not in the right sequence as mentioned in the Syllabus of English curriculum 2013. Key Words: English textbook, 2013 English basic competences, conformity. INTRODUCTION Students of all ages are learning to speak English all around the world (Harmer 2007). That is the evidence of the fact that English is the most popular International language used in the world. This language is used as a tool to transfer many kind of information from the others language. It is used to communicate importantly when the people do not know the certain unpopular international or even non international language. For the example; Indonesian that would like to communicate with Japanese, in case, both of them cannot speak Indonesian or Japanese, they can use English. It is rationally because English is the popular international language that mostly used by the people around the world both, in target language community or even in somewhere it is one of the main languages of culture or commerce. Target-language community is a place where English is used as the national language- e.g. Britain, Canada, New Zealand, etc. besides, India, Pakistan, Nigeria are the example of the countries where English is one of the main languages of culture and commerce (Harmer 2007). Those examples show us that English has widely used almost all around the world referring to the fact that the origin of English is from Germany. Besides, people can take a look on the point of view of education field and work field. English as a subject taught in school and college deals with the student's understanding and use of language (Guth 1973). Furthermore, the transfer of information and knowledge has been easily accessed whenever and wherever, seems there is not any limitation of time and place anymore. As the example, people can easily get the information from social media or internet. As long as they could use English to communicate, they could keep in touch with whoever or whatever around the world. As the concrete example, the student could use international references in doing their project or research. Moreover, it is not surprising news anymore knowing the transfer of the students around the world. According to the fact, it seems like not enough to study in the country for the specific purposes of certain people. They would rather choose to continue their study abroad than in their own country. This opportunity leads to make the use of English being more and more important than the other foreign language. Looking to another point of view, the use of English essentially spreads widely in the international business sector, so much so that English has become the standard language of world business (Yoneda 2008). Relating to the development of some international development, the use of English is also getting more important. For the example is the implementation of ASEAN Economic Community (AEC) in 2014. This agreement among ASEAN countries about free economic market in ASEAN open a new opportunity for every people in ASEAN countries to work in certain country in ASEAN (Community 2008). This also shows us that the role of English is very fundamental according to the fact that the countries in ASEAN have their own language. English as international language relates the people of ASEAN to communicate each other, so that there are not any difficulties anymore in term of communication of those different language countries. In addition, we can easily find the requirements of job field in our country that requires English whether written or oral skill to fulfill. In this circumstance, English also take a great importance in human social life even though it is not in English-native speaker country. Those great importance of English in daily life of the society and its prospect in the future lead the governance to put English as a major material begin in junior high school and senior high school. As the higher continuant education, senior high school has a significant role to build the extensive foundation of the student competence of English after the very basic level in elementary and junior high school. In this level, English is delivered more seriously and being a component of the syllabus of curriculum in Indonesia as stated in constitution of Indonesia number 68 2013. This curriculum has been launched in 2013. It has been used and being implemented in certain school all around Indonesia starts from the first class of junior and also senior high school. This curriculum was built based on two major challenges. Those are internal and external challenges (Permendikbud 2013a). The internal challenge is that the human resources of Indonesia are getting large and large. As the response of the government, the curriculum 2013 was build to increase the competence of the people itself. Furthermore, the global change and development are acting as the external challenge that encourages the development and the existence of curriculum 2013. The curriculum 2013 actually is developed from standard-based curriculum and competence based curriculum, that is why, the difference between this curriculum and the previous curriculum can be clearly seen from the format of the curriculum itself. In the other hand, textbook is getting a great role in education related with the implementation of the curriculum (Permendikbud 2013b). It is also supported by the fact that nowadays, there is a change of education paradigm. Begin with teacher as a center in learning in the class to the students as the center in the class. That is why, textbook as the main source of knowledge which is stated in the curriculum besides the teacher is holding a fundamental role in the education. A little bit different with the previous curriculum, especially in English object, the curriculum 2013 uses thematic approach. Based on the English textbook published by Putra Nugraha entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X", there is not any skill dividing such as in the English textbook of the previous curriculum. The skill such as listening, reading, writing and speaking are no longer used to divide the competences in the textbook. It uses the thematic approach that integrates those kinds of skill to be one competence. Those differences lead the researcher to figure out a problem, does the content of the textbook really conform to the content of the syllabus of curriculum 2013?. In addition, this textbook is published in 2013 and used in SMAN 18 Surabaya. It is the only one which is found in the field. Even though the English curriculum 2013 has been implemented, only SMAN 18 Surabaya that uses the English textbook to deliver the English material. The gap exists in the previous study also supports the researcher to conduct the research to answer the question. There are a lot of researches about textbook analysis of previous curriculum textbook such as a research conducted by the graduate of state University of Surabaya. The title is "An Analysis of Listening Material of English Textbook Entitled Get Along With English for Vocational High School Grade X Based on 2006 English Standard Competence" (Widiyawati 2012). This descriptive qualitative research is conducted to evaluate the book in the point of listening skill competence based on the 2006 English Standard Based Competence. The researcher take the Listening skill as the competence to be evaluated in the book because, in fact the book was made based on curriculum 2006 that still uses skill competence to divide the material in the book. Another one is a research conducted by Meta Chairani (2011) the graduate of Muria Kudus University entitled "The Analysis of English Textbook based on Competence Based Curriculum (CBC) for The First Year of Senior High School Published by Penerbit Erlangga and PT. Intan Pariwara. This research also analyzes the textbook of previous curriculum that is Competence Based Curriculum (CBC). So far, none of the researchers conduct a research of the textbook of curriculum 2013 that has been implemented since 2013. Recognizing this gap and urgency that it is a must for the content of the English textbook to conform with the Syllabus of the curriculum 2013, the researcher is supported to conduct this research. In addition, the researcher will use the instrument based on Badan Nasional Standart Pendidikan (BSNP) with also referring to another theory. This is to check the conformity between the basic competences in the syllabus of curriculum 2013 and the basic competences in the textbook and also the conformity between the materials in the English textbook to the basic competences in the syllabus of curriculum 2013. Based on the background and the reason above, it shows that conformity between the book and the basic competence is an urgent and important thing in the implementation of curriculum 2013. Based on the Background above, the researcher decide to research questions of this study are: How is the conformity between the basic competences in the English textbook for first graders of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha and the basic competences in the syllabus of curriculum 2013? And How is the conformity between the materials in the English textbook for first graders of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha and the basic competences in the syllabus of curriculum 2013? The result of this study is expected to give more information and input to the teacher in using the English textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X". It is expected to give them a brief overview of the textbook, so that they would know the appropriate use of it, whether they have to add some material of the syllabus that does not exist in the textbook or even skip some contents in the textbook that does not included in the syllabus of curriculum 2013. Furthermore, this research is also introduced to the writer and the editor of the textbook in order to give them input and guideline in making the next English textbook which is more relevant to the curriculum 2013. In addition, the researcher focuses on the English textbook for the first grade of senior high school entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" used in SMAN 18 Surabaya only to check the conformity of it to the basic competences of the syllabus of curriculum 2013. REVIEW LITERATURE Curriculum is a set of planning and setting of the objectives, contents, and the material of the teaching and learning process that is used as a guideline in realization of the teaching to achieve the goal of the certain education (UU No. 20 Th. 2003 Tentang Sistem Pendidikan Nasional). Besides, Tanner (1980) defined curriculum as "the planned and guided learning experiences and intended outcomes, formulated through the systematic reconstruction of knowledge and experiences under the auspices of the school, for the learners' continuous and willful growth in personal social competence". It is used to develop and increase the even distribution of education. Every country usually has each own standard of the curriculum because it is related with the development of the country itself. Besides, it also depends on the students' needs in the each country. Since it depends on the students needs the curriculum always having the improvement time by time. It is caused by the global change that occur influence the needs of the learner. In case of English curriculum, there have been some changes or improvement of it in Indonesia. The changes are stated as follows: Old style, Grammar Translation Based Curriculum (1945), New Style, Audio Lingual Based Curriculum (1958), Revision, Audio Lingual Based Curriculum (1975), Structure Based Curriculum (1984), Communicative Based Curriculum (1994), Competency Based Curriculum (2004), Unit Level in Education Curriculum (2006) and Integrated English Curriculum (2013). The most recent curriculum is curriculum 2013 that has been launched in 2013. The English curriculum in it is no longer using skill as the point to divide the competence. It is integrated and thematic. Furthermore, Curriculum 2013 has been launched by the ministry of education and culture of Indonesia in more than 6000 schools all around Indonesia. This is the next step of the ministry of education and culture after holding some process- target teacher and instructor teacher training about curriculum 2013 (Sutiana 2013). Actually, the main substance of curriculum 2013 is the review of internal factors as a demand of education that refers to the 8 national education standards. Those include the management standard, expense standard, infrastructure standard, teacher standard, content standard, assessment standard and the competence standard of the alumnus. The other internal challenges are related with the development of Indonesia from the citizen productive age point of view (in 2020-2035 the productive age is abundant). Besides, the external challenge is also taking a role, the demand of the globalization that comes up with certain goals to achieve through future competence. Those are; communication competence, critical thinking competence, the competency to see the moral values of the problem, ready to work and the ability to live in global society, and etc (Permendikbud 2013a). So far, the global challenge in the society, especially in the future of work field that soon will be globalized, is the basic philosophical framework of this curriculum beside the past and the current condition of Indonesia. Those three values of point of view are taken to build the strength of the mental thinking of Indonesian to face the globalization above. Since the implementation of this curriculum is step by step, it is implemented in the first grade of junior high school. Based on the basic framework of this curriculum from the ministry of education and culture of Indonesia the description of English curriculum is something like the explanation as follows (Sutiana 2013). As stated in the constitution, there is a significant change in this curriculum 2013. That is the graduate standard competence or "standart kompetensi lulusan (SKL)" that related with all of the subjects. It means that the implementation of all subjects must refer to the standard. In the other side, the graduate standard competence itself is depending on the student's needs in the future that focusing on the balance soft skills and hard skills. Furthermore, the main competence is related with the basic competence that exists in every subject. In addition, the text distributing that will be the content in the linguistic material are:Interpersonal Text, Private expression such as greeting and the responds, leave taking and the responds, thanks giving and the responds, and apologizing and the responds; Transactional Text, asking and giving the information about the fact and feeling and also offering things and service; Special Functional Text, such as: name label, List (list of thing in one group), instruction, sign or traffic light, warning sign and song; Public Functional Text, such as: names of the day, month, time in a day, time in form of number, dates and years, self introduction, names of animal, things and public building, the characteristic of human, animal and things. The attitude/action/function of human/animal/things. Descriptive (human, things, and animal); Conversation Topic: related with human self and the social and natural environment around the house and school. Teaching process in curriculum 2013 using scientific approach, through some steps of the process: observing: the student read/watch/listen to the examples of texts that is being learned from many kind of sources, directly/ or using a recording that concerning to the social function, text structure, linguistic element or the delivery format or the writer; asking : through questions from the teacher, the students are asking many things based on the topic/ teaching material, such as social function, expression and text structure and etc; Exploration/ experiment : reading/watching/ listening the other examples of the text they learn; associating/analyzing : in an under control group work, the students are learning to mention the social function, expression and text structure, linguistic element, and the writing format of the type of text they learn. The feedback from the teacher and students in every result of group work are delivered. The last is, communicating: reading, listening, presenting/publishing/ speaking/reading the text they learn. In the other hand, 2006 English curriculum is unit level in education curriculum (KTSP). In this curriculum, each school in Indonesia has each own authority to develop the material based on the students' needs (Nahrowi 2013). Furthermore, this curriculum also concern on the skills as the point to deliver the competences in English such as listening, speaking, reading, and writing. It is completely different with the curriculum 2013. The government standardizes the curriculum as the same one for every school. It means that there is not any differences for every school in Indonesia, in fact, the condition of schools are different each other. Besides, the curriculum 2006 divides the competences into several point based on the skills. Then, The curriculum 2013 is integrated (Nahrowi 2013). This difference of course is included as a significant difference that also could significantly differentiate the previous textbook of the curriculum to the textbook of curriculum 2013. The textbook of curriculum 2013 is no longer divided based on the skill competence, but it is divided based on the theme as shown in the textbook of curriculum 2013 published by Putra Nugraha entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X". Textbook is used as a main guideline in language teaching especially where the teacher is least capable to deliver the material, but the fact said that not all the textbook can reflect the materials well (Williams 1983). This situation of also happens in Indonesia where the EFL classrooms are applied. Furthermore, the existence of the textbook also causes some questions. What the textbook actually is, what advantages of disadvantages of the textbook are, how to create the textbook, how to evaluate it, and also, the most important is, what the relationship between the textbook and the curriculum actually is. Textbook generally is a book contains some material of certain subject to learn by the students in the school. It is used as a main component to deliver the material framework designed in the curriculum. They may deliver the foundation for the content of the lessons, the balance of skills taught and the types of language practice the students take part in. In other hand, the textbook may provide primarily to supplement the teacher's instruction (Richards 2013). Besides, sauvignon (1983) stated that textbook contains a collection of written or oral texts with accompanying explanations that are selected and sequenced for the learners as cited in the previous study (Widiyawati 2012). As the definition above, we can see that actually, textbook can varies based on the language teaching stakeholders. It can adapt the curriculum, the teacher needs, and also the students' needs. That is why, we can find a different textbook used in a different schools. This chosen textbook is used as a basic guideline in teaching and learning process. It is stack because the teacher should follows the curriculum framework designed by the government beside they could adjust their needs. This textbook is very helpful because it contains the material instruction for the teacher that also can support the students to learn by themselves whenever and wherever they want. The material instructions usually could be varied as the curriculum framework. It could be in form of oral or written text, sounds for listening in form of CD that is very practice to use. The existence of the textbook is very crucial in language teaching. It has so many advantages to support the language learning and teaching process, but as the creation of human being, it also has some disadvantages. As the evidence, the textbook evaluation and its revision always applied time by time. The advantages and the advantages of the commercial textbook also depends on the how they are used and the contextual factors and the advantages are stated as (Richards 2013): It is providing structure and a syllabus for a program. Without textbooks a program may have no central core and learners may not receive the material as stated in the syllabus that has been systematically planned and developed by the government; It is helping standardize instruction. The textbook helps the government to implement the even distribution of the education by the similarity of the material taught in each school or even in each class; It is maintaining quality. If a good textbook is used, students are exposed to a tried and tested, that are based on certain pointed learning principles, and that are skipped appropriately; It is providing a variety of learning resources. Textbooks are usually accompanied by workbooks, CDs and cassettes, videos, CD ROMs, and comprehensive teaching guides, providing great resource for teachers and learners; It is efficient. The textbook save teachers' time, enabling teachers to devote time to teaching rather than material's delivering; It is providing effective language models and input. Textbooks can provide supports for non-native teachers and who may not be able to produce accurate language input on their own; They can train teachers. It can be a medium of initial teacher training or a limited teaching experience teacher; It is usually appealing. Commercial textbooks usually have high standards of design and production and hence are appealing to learners and teachers. Contradictory to that, the potential negative effects of the use of textbooks are: It may contain inauthentic language. Textbooks in some cases present inauthentic language since texts, dialogs and other aspects of content tend to be specially written to incorporate teaching points and are often not representing real language use; It may distort content. Textbooks often deliver an idealized view of the world or fail to represent real issues. In order to make fail represented view of material, controversial topics are avoided; It may not reflect students' needs. Textbook are produced in mass amount. That is why; usually the textbook doesn't match the certain needs of the students; It can deskill teachers. If the teacher just use the textbook as an over dominant centered, it can de skill the teacher. It occurs when the teacher is not having improvement in experiencing the class; It is expensive. Commercial textbook that is usually expensive can burden the students in low financial level; Those advantages and advantages gives the redline review for the teacher. If the disadvantages side of the textbook takes a dominant position in the class. The alternative action should be taken, such as adding some materials if there are some of them do not exist in the textbook and etc. Furthermore, what does differentiate the previous textbook curriculum and the textbook of curriculum 2013 especially in language teaching is the approach. The previous curriculum divide each skill competences in the material delivery, but, significantly different to that, the curriculum 2013 use an integrated approach that divide the material into several theme. This is considered more effective in language teaching just like the idea of Oxford (2001) that stated, the integrated approach in foreign language teaching must focus on the integration of language elements like vocabulary, pronunciation and the structure that support the language skill (sundayana 2013). Those two significance differences lead to the textbook construction difference. The textbook of previous curriculum uses the skill in dividing the material in the textbook, they divide listening, speaking, reading, and writing in every material. For the example, descriptive text teaching that is delivered by listening to the descriptive text sound, descriptive speech, descriptive reading, and descriptive writing. Different to that, based on the curriculum 2013framework that has been explained above, the textbook of English curriculum 2013 is constructed by referring to the basic competence in the syllabus. It is constructed as an integrated language material that integrates all language skill such as listening, speaking, reading, and writing into one thematic material. For the example, the language teaching in the first grade of senior high school with the theme "I am going to…". In this theme the material is given to lead the students to explore their language skill. By this theme, the teacher indirectly teaches listening, speaking, reading, and writing in the same time. In condition where there it is lack of trained Teacher, textbook has a vital position in language teaching (Williams 1983). This statement also strengthens the urgency of a well evaluated textbook because of the importance of the existence of textbook itself in the language teaching. The criteria of evaluating the textbook is also take a big role in defining and evaluating the textbook for the betterment of the language teaching. The criteria to build the instrument should be relevant and based on the trusted sources. Since it is important, this evaluation of the textbook should be done especially for the stakeholder of the teacher. The teacher could be given some practices in evaluating the textbook in order to figure out whether the organization of materials is consistent with the objectives of given English curriculum (Williams 1983). The statement of this English education scientist indirectly also shows us that the consistency between the objectives of given English curriculum and the organization of materials is holding an important urgency in the English language teaching. This could be the foundation in making an instrument to define an appropriate textbook based on the curriculum. Besides, there is a valid instrument for evaluating the textbook, including English textbook for senior high school. This instrument that is made by BSNP (Badan Standard Nasional Pendidikan) contains some components of textbook which are arranged based on characteristic of English learning and the criteria of English textbook development (Widiyawati 2012) . The textbook evaluation instrument made by BSNP consists of three main components; the feasibility of the content of the evaluated textbook, the feasibility of the language use of the evaluated textbook, and the feasibility of the presentation of the evaluated textbook. Furthermore, there are sub-components for each component of this evaluation instrument (BSNP 2007), they are: the feasibility of the content of the evaluated textbook; The feasibility of the language use of the evaluated textbook; the feasibility of the presentation of the evaluated textbook. Curriculum is a fundamental substance in the educational system. It drives how the education would look like and it controls the whole unit of education. For the betterment of education in Indonesia for example, the governance does not just revise improve the front liner of education here is the teacher, the facility, and the maintenance but also, the regular revision of curriculum. This fact leads us to understand that the basic change of education improvement is led by the curriculum. In addition, the recent curriculum has taken a serious focus on the equality of education. The equality of education support the potential talent (Rajakumar 2006). It is also reflected by this new policy of education that equal all the material for all school implemented with the standardized standard competence. This basic competence is the main reflection of the curriculum 2013 itself. All of the material guidelines are stated in this standard competence. Furthermore, as the competition of this new curriculum implementation, the teacher mostly uses the textbook as the main material in English teaching. It is caused by the less trained teacher that wants to give the most appropriate material based on the curriculum. Moreover, the well trained teacher uses the textbook as well as the main guideline based on many kind of reason. This idea is strengthen by the language researcher that stated "They can be given practice in analyzing textbooks in order to find out whether the organization of materials is consistent with the objectives of a given English language curriculum" (Williams 1983). Form this view, it can be seen that the role of appropriate textbook of curriculum 2013 is very fundamental and indirectly it also shows that their relationship is very close and can't be divided each other. There have been some previous studies about the textbook analysis, and some of them found that in certain point, there are irrelevancies between the textbook and the goals of English teaching as included in the curriculum. Those findings are clearly proves that the textbook used by school as a teaching guideline has a possibility to have the irrelevancy between the curriculum and the materials in the textbook itself. As the first example, a research conducted by a graduate of State University of Surabaya have found that there are some speaking indicators that are not covered in each unit of the textbook entitled " Mandiri: Practice your English Competence". For example, two indicators of basic competence 2.4 in Chapter 3; and two indicators of basic competence 2.3 in Chapter 6 (Xingli 2013). The second research is also conducted by the graduate of State University of Surabaya. Several text in the textbook entitled "kumpulan kegiatan siswa Bahasa Inggris" designed by Surabaya MGMP team have not fulfilled yet the requirement of the generic structures and the linguistic features yet as stated in 2004 English Curriculum (Sari 2007). Then, the last example of research is conducted by Meta Chairani, the undergraduate of Muria Kudus University (UMK) entitled "The Analysis of English textbook Based on Competence based Curriculum (CBC) for the First Year of Senior Higfh School Published by penerbit Erlangga and PT. Intan Pariwara. Different with the two previous research example, this research was comparing two different textbook to know which one is more appropriate to the curriculum. The result of this study is both of the textbook are fairly good, but only the book of PT. Intan Pariwara entitled "Bahasa Inggris Kelas 1 SMU" was appropriate in content and evaluation to cover the objective of Competence Based Curriculum (Chairani 2011). So far, based on the examples of researches above, it has been clearly found that there are some irrelevance between the textbook and the curriculum starts from Competence Based Curriculum (CBC) that was implemented since 2004 to 2006, and the Unit Level of Education Curriculum (KTSP) that was implemented in 2006 to 2013. This kind of evidences shows us that there is a big possibility of the textbook published by the Government that does not match with the curriculum in certain point. Of course, it is included the textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha as a guideline to implement the Curriculum 2013. This is the main reason why the researcher would like to conduct this study. RESEARCH METHODOLOGY Research Design This study is designed to answer the research question as stated in the Chapter I. It focuses on analyzing the conformity of the material in English textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha to the basic competencies in the syllabus of curriculum 2013. This English textbook is used by SMAN 18 Surabaya in the first year of curriculum 2013 implementation. Based on the objectives and the aim of the study above, this research is designed to analyze the English textbook that has been a phenomenon. Until nowadays, there is not any legal curriculum 2013 English textbook for senior high school published by the government. Since this study is descriptive qualitative research, the analysis of the study is presented in form of words rather than numbers without any statistical calculation (Fraenkel JR & Wallen, NE 1990; McMillan (as cited in Widiyawati 2012). Besides, this study is also documentary analysis research in which it describes the data gotten from the research instrument in detail and deeply. Object of the Study The Subject of this study is the English textbook for the first graders of Senior High School entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha. It was published in 2013. The materials in the textbook are organized in form of chapter in which the four skills of English such as Listening, Speaking, Reading, and writing are integrated to be one thematic chapter. There are seven chapters that cover one semester material, they are: I Live in Semarang, Wow! You Look So Pretty! , Are You Ok? , I'm Going to…, Congratulations, Simple Past Tense and Simple Present Perfect Tense, Descriptive Text. As stated above, those themes provide integrated English materials that also integrate the four skills of English. Data of the Study The data of this study are all of the English learning material presented in this textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha that covers one semester program of the first grade. The data are in the form of dialogues, passages, monologues, tasks, activities, instructions, tables, and etc. The textbook that is being analyzed contains seven chapters that are elaborated into 64 pages. Research Instruments As a device to collect the data, the research instrument is very important. It is a device to collect the data from the object of the study. As a descriptive qualitative study, the data of this study are in form of words rather than numbers in which the researcher is the main instrument. The main role of the researcher as the instrument in this study is profoundly to collect and analyze the data as deep as possible. However, the researcher cannot work alone. The researcher is assisted by the other research instruments; here is the field note. Others contrast field notes with data, defining field notes more along the lines of Field note is a daily input made in a field journal to record thoughts, impressions, initial ideas, working hypotheses, issues to pursue and so on. Besides, it is also everything collected in the fieldwork —the fieldwork journal, transcripts of conversations and interviews, photographs, audiotapes and videotapes, copies of documents, and artifacts (Schwandt 2007). In this study, the field note is used help the researcher to record the verbal data of the object of the study and verify the conformity of the materials in the textbook and the basic competences of curriculum 2013. The field notes are in form of table which contain the analyzed data and also the evidence of the materials. The first table of field note contains basic competences in the syllabus of curriculum 2013, basic competence in the analyzed textbook and relevant or irrelevant column. Besides, the second table of field note contains basic competences of curriculum 2013, main materials based on the Syllabus of English curriculum 2013, relevant or irrelevant column and the evidence of materials. Data Collection Technique In this study, the technique to collect the data is document analysis based on the checklist. The analysis deals with the conformity between the English learning material and the 2013 English basic competencies. There are two steps that use two tables in this study. The first is the researcher checks the conformity between the basic competences in the textbook to the basic competences in the syllabus of English curriculum 2013. The second is the researcher checks the conformity between the English materials in the textbook to the basic competences of English curriculum 2013. While it is done, the verbal data is also written in the field notes. After those two steps, the researcher collects the data and the result from the instrument table, after that, those data are analyzed and elaborated. Data Analysis Technique Since the English material in the textbook are integrated, the researcher directly describe the results of the study without any skill dividing in form of words rather than numbers. In addition, there are two steps in this study analysis. The first is describing conformity between the basic competences in the analyzed textbook and the basic competences in the syllabus of curriculum 2013. The second is describing the conformity between the materials in the textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra Nugraha English and the basic competences in the 2013 English curriculum. RESULTS AND DISCUSSION The results of this study are divided into two parts. The first is describing the conformity field note of the basic competences in the textbook for the first grade of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" to the Basic competences in the syllabus of curriculum 2013. The second is describing the conformity field note of the content in the textbook for first graders of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" to the Basic competences in the syllabus of curriculum 2013. The Conformity of the English Basic competences in the textbook to the English Basic Competences in the Syllabus of C urriculum 2013 This part of the results aims to describe the conformity of the basic competences in the textbook for first grader of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" to the basic competences in the syllabus of curriculum 2013. This part is describing the example of field note of Chapter 1 and 2 analyses in which it is described into words to be more specifically explained. The Conformity of the Basic Competences in the Textbook Chapter 1 to the Basic Competences in the Syllabus No. Basic Competence in the Syllabus of Curriculum 2013 Basic Competences in the textbook Conformity 1. 1.1. Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar. 1.1. Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar. relevant 2. 2.2. Menunjukkan perilaku jujur, disiplin, percaya diri, dan bertanggung jawab dalam melaksanakan Komunikasi transaksional dengan guru dan teman. 2.2. Menunjukkan perilaku jujur, disiplin, percaya diri, dan bertanggung jawab dalam melaksanakan Komunikasi transaksional dengan guru dan teman. relevant 3. 3.1. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan dari teks pemaparan jati diri, sesuai dengan konteks penggunaannya. 3.1. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan dari teks pemaparan jati diri, sesuai dengan konteks penggunaannya. relevant 4. 4.1 Menyusun teks lisan dan tulis sederhana, untuk memaparkan, menanyakan, dan merespon pemaparan jati diri, dengan memperhatikan fungsi sosial, struktur teks, dan unsur kebahasaan, secara benar dan sesuai dengan konteks. 4.1 Menyusun teks lisan dan tulis sederhana, untuk memaparkan, menanyakan, dan merespon pemaparan jati diri, dengan memperhatikan fungsi sosial, struktur teks, dan unsur kebahasaan, secara benar dan sesuai dengan konteks. relevant As can be seen above, all of the Basic competences in chapter 1 are relevant to what they are stated in the syllabus of English curriculum 2013. The basic competences are stated in the beginning of the chapter in the textbook. They are Basic Competences 1.1, 2.2, 3.1 and 4.1. The evidence of this analysis is a picture taken from the analyzed textbook as follows: The Basic Competences in Chapter 1 of the Textbook The picture above shows some basic competences in chapter 1 of the textbook. The basic competences in the textbook above conform to the basic competences in the syllabus as shown in table 4.1. The Conformity of the Basic Competences in the Textbook Chapter 2 to the Basic Competences in the Syllabus No. Basic Competence in the Syllabus of Curriculum 2013 Basic Competences in the textbook Conformity 1. 1.1 Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar. 1.1. Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar. relevant 2. 2.1. Menunjukkan perilaku santun dan peduli dalam melaksanakan Komunikasi interpersonal dengan guru dan teman. 2.1. Menunjukkan perilaku santun dan peduli dalam melaksanakan Komunikasi interpersonal dengan guru dan teman. relevant 3. 3.2. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan pada ungkapan memuji bersayap serta responnya, sesuai dengan konteks penggunaannya 3.3. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan pada ungkapan memuji bersayap serta responnya, sesuai dengan konteks penggunaannya. relevant 4. 4.2. Menyusun teks lisan dan tulis untuk mengucapkan dan merespon pujian bersayap, dengan memperhatikan fungsi sosial, struktur teks, dan unsur kebahasaan yang benar dan sesuai konteks. 4.2 Menyusun teks lisan dan tulis untuk mengucapkan dan merespon pujian bersayap, dengan memperhatikan fungsi sosial, struktur teks, dan unsur kebahasaan yang benar dan sesuai konteks. relevant Besides, the Filed note above also shows that all of the Basic competences in the chapter 2 are relevant to what they are stated in the syllabus of English curriculum 2013. The basic competences are stated in the beginning of the chapter in the textbook. They are Basic Competences 1.1, 2.1, 3.2 and 4.2. The evidence of this analysis is a picture taken from the analyzed textbook as follows: The Basic Competences in Chapter 2 of the Textbook The picture above shows some basic competences in chapter 2 of the textbook. It can be seen that the basic competences in the textbook above conform to the basic competences in the syllabus as shown in table 4.2. Overall, the study results that all of the basic competences in the textbook for first graders of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" conforms to the basic competences in the syllabus of English Curriculum 2013 (see appendix 1). The conformity of the Materials in the Textbook to the Basic Competences in the Syllabus The textbook entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" published by Putra nugraha are claimed as representing the English Curriculum 2013. This book uses thematic and integrated material in delivering four English skills. Since it is integrated, no more skill dividing found in this book. The thematic and integrated material are delivered into seven chapters, they are: I Live in Semarang, Wow! You Look So Pretty, Are You Ok?, I'm Going to…, Congratulations, Simple Past Tense and Simple Present Perfect Tense and Descriptive Text. This part of the study explains and describes the result of the instrument to figure out whether or not materials in the English textbook for first graders of senior high school used in SMAN 18 Surabaya entitled "Bahasa Inggris Untuk SMA/MA dan SMK/MAK Kelas X" conforms to the Basic competences in the Syllabus of Curriculum 2013. The data collection uses table of conformity (see Appendix 2) and the descriptions are divided chapter per chapter. The table analysis of the first and second chapter is presented as the example below: The Conformity of Materials in Chapter 1 to the Basic Competences in the Syllabus NO. Basic Competences in the Syllabus Main Materials Based on the Syllabus Conformity Evidence 1. 1.1. Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar 2.2. Menunjukkan perilaku jujur, disiplin, percaya diri, dan bertanggung jawab dalam melaksanakan Komunikasi transaksional dengan guru dan teman. 3.1. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan dari teks pemaparan jati diri, sesuai dengan konteks penggunaannya. 4.1. Menyusun teks lisan dan tulis sederhana, untuk memaparkan, menanyakan, dan merespon pemaparan jati diri, dengan memperhatikan fungsi sosial, struktur teks, dan unsur kebahasaan, secara benar dan sesuai dengan konteks. Simple spoken text to explain self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. irrelevant Simple spoken text to ask about self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. irrelevant Simple spoken text to respond self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. irrelevant Simple written text to explain self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. relevant Simple written text to ask about self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. irrelevant Simple written text to respond self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. irrelevant The table above shows that most of the materials in the textbook do not conform to the basic competences in the syllabus of Curriculum 2013. There is only one material in chapter 1 of the textbook that conform to the basic competences in the syllabus. It is as seen in the picture below. Simple Written Text of self Introduction The picture above shows a simple written text of introduction taken from the analyzed textbook. It conforms to the fourth main material in chapter 1 that represents the basic competences in the syllabus of curriculum 2013. The main material in chapter 1 is Simple written text to explain self introduction which concerns on right social function, text structure and linguistic element that is appropriate with the context. The simple written text of introduction above fulfills the social function, text structure and linguistic element. The text above reflects the social function in which the students are hoped to get into a relationship among others. The text structures are reflected in form of expressions such as "My name is Arai", and "I am a student in Gemilang senior School". The last is linguistic element is reflected by the topic about family and brotherhood relationship, hobbies, occupation and the text is using simple present tense. The Conformity of Materials in Chapter 2 to the Basic Competences in the Syllabus NO. Basic Competences in the Syllabus Main Materials Based on the Syllabus Conformity Evidence 1. 1.1. Mensyukuri kesempatan dapat mempelajari bahasa Inggris sebagai bahasa pengantar Komunikasi internasional yang diwujudkan dalam semangat belajar. 2.1. Menunjukkan perilaku santun dan peduli dalam melaksanakan Komunikasi interpersonal dengan guru dan teman. 3.2. Menganalisis fungsi sosial, struktur teks, dan unsur kebahasaan pada ungkapan memuji bersayap serta responnya, sesuai dengan konteks penggunaannya. 4.2.&nb
A comprehensive examination of the relevant facts in the article shows that Turkey was one of the first to recognize the independence of Armenia, but no diplomatic relations were established between the countries, since Ankara presented the Armenian authorities some preconditions: not to mention the 1915 Armenian Genocide, to renounce claims officially, to put pressure on to stop the struggle for Nagorno-Karabakh, to recognize the sovereignty and territorial integrity of Azerbaijan. At the same time, Turkey demanded that the Republic of Armenia refrain from actions contrary to the interests of Turkey and in any way neutralize the anti-Turkish activities of the Armenians of the Diaspora. The Republic of Armenia rejected these preconditions and requirements, which are incompatible with the international practice. Turkey, in its turn, took a pronounced anti-Armenian position, unilaterally closing the border with Armenia, continuing to keep Armenia in a blockade. Therefore, it is no coincidence that Turkey's approaches to normalizing relations with Armenia were largely conditioned by the achievements of the Armenian armed forces in Artsakh, because the more obvious these successes, the tougher Turkey's position towards Armenia became. This manifested itself during the liberation of Karvachar (early April 1993) by the armed forces of Armenia, after which Turkey not only closed the border, but also began to accumulate troops near the border with Armenia, but Russia's sharp reaction deterred Turkey from further actions. We consider it appropriate to mention that during the period under discussion, such an approach of Turkey to the issue of normalizing relations with Armenia posed a serious threat to our national security. Analyzing the influence of the economic factor of mutual interest in the Armenian-Turkish relations, it was emphasized that no matter how favorable the development of economic relations with Armenia is for Turkey, Armenia is not of serious interest for Turkey in terms of its economic development. Some activation does not give us grounds to characterize this as a serious breakthrough in the normalization of the Armenian-Turkish relations. Therefore, it is no coincidence that, given a certain perspective of the Armenian-Turkish economic cooperation, the Turkish side tried to create the illusion of some progress in the Armenian-Turkish relations with the Armenian leadership, thereby prompting the Armenian leadership to convince the diaspora to stop encouraging the process of the international recognition of the Armenian Genocide. This circumstance, of course, also testifies to the impact of the process of the international recognition of the Armenian Genocide on the Armenian-Turkish relations. As for the economic factor, the fact that the Armenian leadership did not properly analyze in previous period the initiatives of the Turkish side to intensify economic contacts between the two countries, did not even catch the moment that the economic factor and the Turkish version of the solution to the Karabakh conflict were combined. Meanwhile, with the preconditions put forward, Turkey tried to make Armenia its servant, and through it to dictate its will to the Armenians of the Diaspora. Concerning the Armenian-Turkish contacts at the level of non-governmental organizations, it was noted that the activities of such organizations were initially doomed to failure due to the extremely opposite views of the parties. The leadership of the Republic of Armenia at that time, being aware of such contacts, however, did not properly analyze their possible positive and negative consequences both for the Republic of Armenia and for the Diaspora: it did not express a clear position on this issue. Meanwhile, the subsequent course of the events showed that Turkey, using the presence of such contacts, tried to move the issue of the Armenian Genocide from the political sphere to the sphere of scientific and public discussions, once again striving to stop the process of the international recognition of the Armenian Genocide. By and large, the same goal was pursued by the slogan "zero problems with neighbors" put forward by the Turkish leadership, which, despite the specific steps taken, does not lead to the normalization of the Armenian-Turkish relations. Thus, sometimes positive glimpses in the policy of the Turkish leadership in the relations with Armenia can be explained by various geopolitical interests of Turkey, in particular, the issue of joining the European Union. Specific facts have proved that even the fact of signing the famous Zurich Protocols on October 10, 2009 could not force Turkey to fulfill its obligations, to refuse to put forward preconditions for the establishing diplomatic relations with Armenia. Analyzing the content of the Zurich Protocols, it was noted that this does not fully meet the vital interests of all Armenians, since certain provisions of the protocols, especially the provision on mutual recognition of borders, make it senseless to continue the process of the international recognition of the Armenian Genocide, as well as steps to be taken to overcome consequences. Particular attention was paid to the fact that during the period under discussion a new phenomenon was observed in the process of the international recognition of the Armenian Genocide: some European countries are adopting laws criminalizing the denial of the genocide, some of which cannot be called finalized, which also affects the process itself in future. Summing up the results of the efforts of the second president of Armenia to normalize the Armenian-Turkish relations, it was emphasized that they, like during his predecessors, did not lead to the establishment of diplomatic relations between the two countries, and Turkey, in fact, got one more chance to show the world its "passionate desire" to settle relations with Armenia. Presenting the Centennial of the Armenian Genocide and the further process of recognition in the context of the Armenian-Turkish relations, the article draws special attention to the fact that on the eve of the Centennial of the Armenian Genocide, official Turkey does not change its policy of denial of the Armenian Genocide, nevertheless, it makes some changes into the strategy. The meaning of such changes was the theses put forward by Erdogan and Davutoglu about "common grief" and "fair memory". It was emphasized that such a new manifestation of Turkish denial was no less dangerous, since it was an attempt to equate "executioner" with "victim". It was further noted that this approach of Turkey did not give tangible results, since in the context of the Centennial of the Armenian Genocide, the process of the official recognition and condemnation of the Armenian Genocide by various countries and authoritative international organizations continued. The fact that after the adoption of the resolution on the Centennial of the Armenian Genocide in the Armenian realities the issue of transferring the Genocide to the legal field, in addition to the recognition of the Genocide, and the improvement of the international law, introducing a new wording - "patricide", was not ignored. In this regard, it was emphasized that the implementation of such an idea, although welcomed, would require tremendous efforts and energy. In addition, the idea was noted that the possibility of implementing these provisions will be much greater if Armenia becomes one of the influential "players" in the region, dictating its own rules of the game. As for the further efforts of the Armenian authorities to establish diplomatic relations between the two countries, it is obvious that it was not endlessly possible to endure Turkey's destructive approach to this issue. Consequently, the speech of the President of the Republic of Armenia on September 20, 2017 at the UN General Assembly was the first logical step towards the abolition of the Zurich Protocols by the Republic of Armenia, a process that came to its logical conclusion on March 1, 2018 by the decree of the President of the Republic of Armenia "On the termination of the procedure for establishing the Armenian Turkish relations". Not only did Turkey not establish diplomatic relations with Armenia, but 100 years after the Turkish-Armenian war, on September 27, 2020, it made an attempt to forcefully resolve its precondition on the Artsakh question. Through the direct instigation and support to "fraternal" Azerbaijan, it unleashed the war against the Republic of Artsakh and the Republic of Armenia, and, through military aggression, about 75% of the territory of the Republic of Artsakh was captured, not only 7 previously liberated regions, but also Hadrut and Shushi. Not satisfied with all this, on the advice of the same Turkey, Azerbaijan, in May 2021, invaded the sovereign territory of the independent Republic of Armenia, creating a real threat to the existence of the Armenian statehood, a real "threat to the security of the Armenian people", trying to connect Azerbaijan and Turkey through the so-called Zangezur corridor through Nakhichevan for the implementation of the long-standing program of Pan-Turkism. ; Հոդվածում համապատասխան փաստերի համակողմանի քննությամբ ցույց է տրված, որ թեև Թուրքիան առաջիններից մեկը ճանաչեց Հայաստանի անկախությունը, բայց նրա հետ դիվանագիտական հարաբերություններ չհաստատվեցին, քանզի Անկարան հայկական իշխանություններին նախապայմաններ ներկայացրեց չհիշատակել 1915թ․ Հայոց ցեղասպանությունը, պաշտոնապես հրաժարվել պահանջատիրությունից, ճնշում գործադրել Լեռնային Ղարաբաղի վրա՝ դադարեցնելու պայքարը և ընդունելու Ադրբեջանի գերակայությունն ու տարածքային ամբողջականությունը։ Միաժամանակ պահանջեց, որ Հայաստանի հանրապետությունը զերծ մնա Թուրքիայի շահերին հակասող գործողություններից և ամեն կերպ չեզոքացնեի սփյուռքահայության հակաթուրքական գործունեությունը; Հայաստանի հանրապետությունը մերժեց միջազգային պրակտիկային անհարիր այս նախապայմաններն ու պահանջները։ Թուրքիան իր հերթին որդեգրեց ընգծված հակահայկական դիրքորոշում, միակողմանիորեն փակելով ՀՀ-ի հետ սահմանը, շարունակելով շրջափակման մեջ պահել Հայաստանը։ Ուստի պատահական չէր, որ Թուրքիայի մոտեցումները՝ ՀՀ-ի հետ հարաբերությունները կարգավորելու հարցում մեծապես պայմանավորված էին նաև Արցախում հայկական զինված ուժերի ձեռքբերումներով, քանզի որքան ակնառու էին այդ հաջողությունները, այնքան ավելի էր կոշտանում Թուրքիայի դիրքորոշումը ՀՀ-ի նկատմամբ։ Դա դրսևորվեց հայկական զինված ուժերի կողմից Քարվաճառի (1993թ․ ապրիլի սկզբին) ազատագրման ժամանակ, որից հետո Թուրքիան ոչ միայն փակեց սահմանը, այլև Հայաստանի հետ սահմանաներձ շրջանում զորքեր սկսեց կուտակել, սակայն Ռուսաստանի կտրուկ անդրադարձը Թուրքիային հետ պահեց իր հետագա գործողություններից։ Կարծում ենք սխալված չենք լինի, եթե նշենք, որ քննարկվող ժամանակաշրջանում Թուրքիայի նման մոտեցումը ՀՀ-ի հետ հարաբերությունները կարգավորելու հարցում լուրջ սպառնալիք էր մեր ազգային անվտանգությունը։ Վերլուծելով հայ-թուրքական հարաբերություններում երկուստեք հետաքրքություն ներկայացնող տնտեսական գործոնի ազդեցությունը , շեշտվել է այն հանգամանքը, որ որքան էլ ՀՀ-ի հետ տնտեսական շփումների զարգացումը ձեռնտու էր Թուրքիային, այդուհանդերձ, Հայաստանն իր տնտեսական զարգացման մակարդակով Թուրքիայի համար լուրջ հետաքրքրություն չէր ներկայացնում և հայ-թուրքական շփումներում նկատվող որոշակի աշխուժացումը, մեզ բավարար հիմք չի տալիս բնութագրել այն որպես լուրջ բեկում հայ-թուրքական հարաբերությունների կարգավորման հարցում: Ոստի, ամենևին էլ պատահական չէր, որ հայ- թուրքական տնտեսական փոխհամագործակցության որոշակի հեռանկարով թուրքական կողմը փորձում էր ՀՀ ղեկավարության մոտ հայ-թուրքական հարաբերություններում որոշակի առաջընթացի պատրանք ստեղծել և դրանով իսկ շահագրգռել ՀՀ ղեկավարությանը' համոզելու Սփյուռքին ևս հետ կանգնելու Հայոց ցեղասպանության միջազգային ճանաչմանը հետամուտ լինելուց: Այս հանգամանքն, անշուշտ, վկայում է նաև Հայոց ցեղասպանության միջազգային ճանաչման գործընթացի հայ-թուրքական հարաբերությունների վրա ունեցած ազդեցության մասին: Տնտեսական գործոնի առումով կարևորվել է նաև այն հանգամանքը, որ ժամանակին ՀՀ ղեկավարությունը պատշաճ վերլուծության չենթարկելով թուրքական կողմի երկու երկրների միջև տնտեսական շփումները ակտիվացնելու նախաձեռնությունները, չէր էլ նկատում, որ դրանցում, փաստորեն, մեկտեղվում էին տնտեսական գործոնն ու ղարաբաղյան հիմնահարցի լուծման Թուրքիայի տարբերակը: Մինչդեռ, Թուրքիան իր կողմից առաջադրած նախապայմաններով փորձում էր ՀՀ-ին դարձնել իր կամակատարը և նրա միջոցով իր սեփական կամքը թելադրել նաև սփյուռքահայությանը: Անդրադարձ կատարելով հասարակական կառույցների մակարդակով հայ-թուրքական շփումներին, նշվել է, որ նման կառույցների գործունեությունն ի սկզբանե դատապարտված էր ձախողման' կողմերի ծայրահեղ հակադիր հայացքների պատճառով: Ժամանակի ՀՀ ղեկավարությունը, տեղյակ լինելով նման շփումներին, այնուամենայնիվ, պատշաճ վերլուծության չէր ենթարկել դրանց հնարավոր դրական և բացասական հետևանքները ինչպես ՀՀ-ի, այնպես էլ Սփյուռքի համար և չուներ հստակ դիրքորոշում այդ հարցում: Մինչդեռ, իրադարձությունների հետագա ընթացքը ցույց է տվել, որ Թուրքիան, շահարկելով նման շփումների առկայությունը, փորձել է Հայոց ցեղասպանության հարցը քաղաքական հարթությունից տեղափոխել գիտական և հասարակական քննարկումների ոլորտ' հերթական անգամ նպատակ ունենալով այդ կերպ հնարավորինս կասեցնել Հայոց ցեղասպանության միջազգային ճանաչման գործընթացը: Մեծ հաշվով, նույն նպատակն էր հետապնդում նաև Թուրքիայի ղեկավարության կողմից առաջ քաշված «զրո խնդիր հարևանների հետ» կարգախոսը, որը, չնայած ձեռնարկած կոնկրետ քայլերին, այդպես էլ չի հանգեցնում հայ-թուրքական հարաբերությունների կարգավորմանը: Ուստի, ՀՀ- ի հետ հարաբերությունների հարցում թուրքական ղեկավարության որդեգրած քաղաքականության մեջ երբեմն առկայծող դրական միտումները կարելի է բացատրել Թուրքիայի աշխարհաքաղաքական զանազան շահախնդրություններով և, մասնավորապես, Եվրամիությանն անդամակցելու խնդրով: Կոնկրետ փաստերով ապացուցվել է, որ անգամ 2009 թ. հոկտեմբերի 10- ին ցյուրիխյան հայտնի արձանագրությունների ստորագրումն ի զորու չի լինում ստիպելու Թուրքիային կատարել իր կողմից ստանձնած պարտավորությունները և հրաժարվել Հայաստանի հետ դիվանագիտական հարաբերություններ հաստատելու հարցում նախապայմաններ առաջադրելուց: Վերլուծելով ցյուրիխյան արձանագրությունների բովանդակությունը նշվել է, որ այն իր ամբողջության մեջ չէր բխում համայն հայության կենսական շահերից, քանզի արձանագրություններում առանձին դրույթներ և, հատկապես սահմանների փոխադարձ ճանաչման դրույթը, մեծ հաշվով անիմաստ էր դարձնում ինչպես Հայոց ցեղասպանության միջազգային ճանաչման գործընթացին հետամուտ լինելը, այնպես էլ հետագայում դրա հետևանքների հաղթահարմանն ուղղվելիք քայլերը: Հատուկ ուշադրություն է դարձվել նաև այն փաստին, որ քննարկվող ժամանակահատվածում Հայոց ցեղասպանության միջազգային ճանաչման գործընթացում նկատվում է նաև նոր երևույթ՝ առանձին եվրոպական երկրներ ընդունում են ցեղասպանության ժխտումը քրեականացնող օրենքներ, որոնց մի մասի անկատար լինելու հանգամանքն իր ազդեցությունն է թողնում դրանց հետագա ճակատագրի վրա: Ամփոփելով հայ-թուրքական հարաբերությունների կարգավորմանն ուղղված ՀՀ երկրորդ նախագահի գործադրած ջանքերի արդյունքները, շեշտվել է, որ դրանք ևս, իր նախորդների նման, չեն հանգեցրել երկու երկրների միջև դիվանագիտական հարաբերությունների հաստատմանը, մինչդեռ Թուրքիան, փաստորեն, կրկին հնարավորություն ստացավ աշխարհին ցույց տալ ՀՀ-ի հետ հարաբերությունները կարգավորելու իր «բուռն ձգտումը»: Հայոց ցեդասպանության 100-ամյակն ու ճանաչման հետագա ընթացքը ներկայացնելով հայ թուրքական հարաբերությունների համատեքստում, հատուկ ուշադրություն է դարձնում այն հանգամանքին, որ Հայոց ցեղասպանության 100-ամյակի նախաշեմին, պաշտոնական Թուրքիան չհրաժարվելով Հայոց ցեղասպանության ճանաչման հարցում իր որդեգրած ժխտոոական դիրքորոշումից, այնուամենայնիվ, որոշակի փոփոխություններ է կիրառում այդ հարցում իր ռազմավարության մեջ: Նման փոփոխությունների իմաստը հանգում էր Էրդողանի և Դավութօղլուի կողմից առաջ քաշած «համատեղ վշտի» և «արդար հիշողության» թեզերին: Ընդգծվել է, որ թուրքական ժխտողականության նման նոր դրսևորումը պակաս վտանգավոր չէր, քանի որ դրանով փորձ էր արվում հավասարության նշան դնել «դահճի» և «զոհի» միջև: Այնուհետև նշվել է, որ Թուրքիայի նման մոտեցումը շոշափելի արդյունք չի տվել, քանի որ Հայոց ցեղասպանության 100-ամյակի համատեքստում շարունակվում էր աշխարհի տարբեր երկրների և միջազգային հեղինակավոր կազմակերպությունների կողմից Հայոց ցեղասպանության պաշտոնական ճանաչման և դատապարտման գործընթացը: Չի անտեսվել նաև այն փաստը, որ Հայոց ցեղասպանության 100-ամյակի հռչակագրի ընդունումից հետո, հայ իրականության մեջ որպես ՀՀ արտաքին քաղաքական առաջնահերթություններ առաջ են քաշվում Ցեղասպանությունը ճանաչման դաշտից բացի, իրավական դաշտ փոխադրելու և միջազգային իրավունքը նոր հայրենազրկում «պատրիոցիդ» իրավական ձևակերպումով բարելավելու խնդիրը: Դրա հետ կապված շեշտվել է, նման գաղափարի իրագործումը ողջունելի լինելով հանդերձ պահանջելու է վիթխարի ջանք ու եռանդ: Բացի այդ, կարևորվել է նաև այն գաղափարը, որ նշված դրույթների կենսագործման հնարավորությունը շատ ավելի կմեծանա, եթե Հայաստանը դառնա տարածաշրջանի ազդեցիկ «խաղացողներից» մեկը՝ թելադրելով խաղի սեփական կանոնները: Ինչ վերաբերում է երկու երկրների միջև դիվանագիտական հարաբերություններ հաստատելու ՀՀ իշխանությունների հետագա ջանքերին, ապա ինքնին հասկանալի է, որ հնարավոր չէր անվերջ հանդուրժել Թուրքիայի ապակառուցողական մոտեցումն այդ հարցում և միանգամայն տրամաբանական էր, որ արդեն 2017 թ. սեպտեմբերի 20-ին ՄԱԿ- ի Գլխավոր ասամբլեայի նստաշրջանի ամբիոնից ՀՀ նախագահի ելույթը դարձավ առաջին քայլը ՀՀ-ի կողմից ցյուրիխյան արձանագրությունների չեղարկման ճանապարհին, գործընթաց, որն իր տրամաբանական ավարտին հասավ 2018 թ. մարտի 1-ին՝ ՀՀ նախագահի «Հայ- թուրքական հարաբերությունների կնքման ընթացակարգը դադարեցնելու վերաբերյալ» հրամանագրով: ; Всестороннее рассмотрение соответствующих фактов в статье показывает, что Турция одной из первых признала независимость Армении, но никаких дипломатических отношений между странами установлено не было, поскольку Анкара представила властям Армении предварительные условия: не упоминать Геноцид армян 1915 года, официально отказаться от претензий, оказать давление на то, чтобы остановить борьбу за Нагорный Карабах, признать суверенитет и территориальную целостность Азербайджана. При этом Турция потребовала от Республики Армения воздержаться от действий, противоречащих интересам Турции и любым способом нейтрализовать антитурецкую деятельность армян диаспоры. Республика Армения отвергла эти предварительные условия и требования, несовместимые с международной практикой. Турция, в свою очередь, заняла ярко выраженную антиармянскую позицию, в одностороннем порядке закрыв границу с Арменией, продолжая держать Армению в блокаде. Поэтому не случайно подходы Турции к нормализации отношений с Арменией во многом были обусловлены достижениями армянских вооруженных сил в Арцахе, ведь чем очевиднее были эти успехи, тем жестче становилась позиция Турции по отношению к Армении. Это проявилось во время освобождения Карвачара (начало апреля 1993 г.) вооруженными силами Армении, после чего Турция не только закрыла границу, но и начала накапливать войска у границы с Арменией, но резкая реакция России удержала Турцию от ее дальнейших действий. Считаем уместным упомянуть, что в обсуждаемый период такой подход Турции в вопросе нормализации отношений с Арменией представлял серьезную угрозу нашей национальной безопасности. Анализируя влияние экономического фактора, представляющего взаимный интерес, в армяно-турецких отношениях, было подчеркнуто, что каким бы благоприятным ни было развитие экономических отношений с Арменией для Турции, Армения не представляет серьезного интереса для Турции с точки зрения ее экономического развития. Некоторая активизация не дает нам оснований охарактеризовать это как серьезный прорыв в нормализации армяно-турецких отношений. Поэтому не случайно при определенной перспективе армяно-турецкого экономического сотрудничества турецкая сторона пыталась создать иллюзию некоторого прогресса в армяно-турецких отношениях с руководством Армении, тем самым побуждая руководство Армении убедить диаспору прекратить поощрение процесса международного признания Геноцида армян. Это обстоятельство, безусловно, также свидетельствует о влиянии процесса международного признания Геноцида армян на армяно-турецкие отношения. Что касается экономического фактора, то тот факт, что руководство Армении не проанализировало в свое время должным образом инициативы турецкой стороны по активизации экономических контактов между двумя странами, даже не уловило тот момент, что экономический фактор и турецкая версия решения Карабахского конфликта были комбинированными. Между тем, с выдвинутыми предварительными условиями Турция пыталась сделать Армению своим прислужником, и через нее диктовать свою волю также армянам диаспоры. Касаясь армяно-турецких контактов на уровне неправительственных организаций, было отмечено, что деятельность таких организаций изначально была обречена на провал из-за крайне противоположных взглядов сторон. Руководство Республики Армения в то время, зная о таких контактах, однако не проанализировало должным образом их возможные положительные и отрицательные последствия как для Республики Армения, так и для диаспоры: оно не выразило четкой позиции по этому вопросу. Между тем последующий ход событий показал, что Турция, используя наличие таких контактов, пыталась вывести вопрос Геноцида армян из политической в сферу научных и общественных дискуссий, в очередной раз стремясь остановить процесс международного признания Геноцида армян. По большому счету, той же цели преследовал выдвинутый турецким руководством лозунг «ноль проблем с соседями», который, несмотря на предпринятые конкретные шаги, не приводит к нормализации армяно-турецких отношений. Таким образом, позитивные иногда проблески в политике турецкого руководства в отношениях с Арменией можно объяснить различными геополитическими интересами Турции, в частности, вопросом вступления в Евросоюз. Конкретными фактами доказано, что даже факт подписания 10 октября 2009 года знаменитых Цюрихских протоколов не смог заставить Турцию выполнить взятые на себя обязательства, отказаться от выдвижения предварительных условий для установления дипломатических отношений с Арменией. Анализируя содержание Цюрихских протоколов, было отмечено, что это не полностью отвечает жизненно важным интересам всех армян, поскольку определенные положения протоколов, особенно положение о взаимном признании границ, делают бессмысленным продолжение процесса международного признания Геноцида армян, а также шаги, которые необходимо будет предпринять для преодоления последствий. Особое внимание было уделено тому факту, что в обсуждаемый период в процессе международного признания Геноцида армян наблюдается новое явление: некоторые европейские страны принимают законы, криминализирующие отрицание геноцида, некоторые из которых нельзя назвать доработанными, что также влияет на сам процесс в будущем. Подводя итоги усилий второго президента Армении по нормализации армяно-турецких отношений, было подчеркнуто, что они, как и при его предшественниках, не привели к установлению дипломатических отношений между двумя странами, а Турция, по сути, снова получила шанс показать миру свое «страстное желание» урегулировать отношения с Арменией. Представляя 100-летие Геноцида армян и дальнейший процесс признания в контексте армяно-турецких отношений, в статье обращается особое внимание на то, что накануне 100-летия Геноцида армян официальная Турция не отказывается от своей политики отрицания Геноцида армян, тем не менее, вносит некоторые изменения в свою стратегию. Смыслом таких изменений стали выдвинутые Эрдоганом и Давутоглу тезисы о «совместной скорби» и «справедливой памяти». Было подчеркнуто, что такое новое проявление турецкого отрицания было не менее опасным, поскольку это была попытка приравнять «палача» к «жертве». Далее было отмечено, что такой подход Турции не дал ощутимых результатов, поскольку в контексте 100-летия Геноцида армян продолжался процесс официального признания и осуждения Геноцида армян различными странами и авторитетными международными организациями. Тот факт, что после принятия резолюции 100-летия Геноцида армян в армянских реалиях не был оставлен без внимания вопрос переноса Геноцида в правовое поле помимо признания Геноцида, и совершенствования международного права, внеся новую формулировку - «патрицид». В этой связи было подчеркнуто, что реализация такой идеи, хотя и приветствуется, потребует огромных усилий и энергии. Кроме того, была отмечена идея о том, что возможность реализации этих положений будет намного больше, если Армения станет одним из влиятельных «игроков» в регионе, диктующих свои правила игры. Что касается дальнейших усилий властей Армении по установлению дипломатических отношений между двумя странами, то очевидно, что терпеть деструктивный подход Турции к этому вопросу бесконечно не представлялось возможным. Следовательно, выступление Президента Республики Армения 20 сентября 2017 года с трибуны Генеральной Ассамблеи ООН стало первым логическим шагом на пути к отмене Цюрихских протоколов Республикой Армения, процесс, который пришел к своему логическому завершению 1 марта 2018 года указом Президента РА «О прекращении процедуры установления армяно-турецких отношений». Мало того, что Турция не установила дипломатические отношения с Арменией, но и через 100 лет после турецко-армянской войны, 27 сентября 2020 года сделала попытку силой дать решение своему предусловию по Арцахскому вопросу. Путем ее непосредственного подстрекательства и поддержке «братскому» Азербайджану война, развязанная против Республики Арцах и Республики Армения, посредством военной агрессии было захвачено около 75% территории Республики Арцах, не только 7 ранее освобожденных районов, но также Гадрут и Шуши. Не удовлетворившись всем этим, по совету той же Турции, Азербайджан в мае 2021 года вторгся на суверенную территорию независимой Республики Армения, создав реальную угрозу существованию армянской государственности, реальную «угрозу безопасности армянского народа», пытаясь через так называемый Зангезурский коридор соединить через Нахичевань Азербайджан и Турцию для реализации давней программы пантюркизма.
Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.
Issue 25.4 of the Review for Religious, 1966. ; Life Charter for the Sisters of the Precious Blood by Sisters Angelita and M. Agnes, Ad.PP.S. 557 Practice of the Holy See by Joseph F. Gallen, S.J. 590 The Cloister Grille by Mother Mary Francis, P.G.G. 615 Mystery and Holiness of Community Life b~ Charles A. Schleck, C.S.C. 621 Identity and Change by ~qister M. Howard Dignan, B.V.M. 669 A Paradox of Love by Brother F. Joseph Paulits, F.&C. 678 Meaningful Adaptation by Sister Marie Leonard, LH.M. 684 The Hyphenated Priest by George B. Murray, S.J. 693 Having Nothing by Sister Helen Marie, O.&F. 703 Survey of Roman Documents 714 Views, News, Previews 718' Questions and Answers 726 Book Reviews 732 VOLUM~ 25 NUMBER 4 July 1966 SISTER ANGELITA MYERSCOUGH, Ad.PP.S. SISTER MARY AGNES KURILLA, Ad.PP.S. A Life Charter for. the Sisters Adorers of the Most Precious Blood Vatican II's Decree on the Adaptation and Renewal of Religious Life directs that "constitutions, directories, custom books, books of prayers and ceremonies and such. like be suitably reedited and, obsolete laws being suppressed, be adapted to the decrees of this sacred Synod" (n. 3). These decrees, everyone recognizes, are focused in the mystery of the Church. Vatican II's theol-ogy of the Church clearly lays emphasis on .its dynamic aspect as the People of God joined together in Christ and made' alive in the Spirit. While its institutional character, which has been emphasized in recent cen-turies, is never lost sight of, the stress is. strongly on this prophetic element. ~ The Council's teaching on religious life, too, is un, derstandably influenced by its pastoral ecclesiology. It .is the prophetic element of religious communities, their existential reality as worshiping communities of frater-nal love and. apostolic service, rather than their juridical organization, that is underscored. While no formal theol-ogy of.religious life has been expounded by the Council, certainly Chapter Six of the, Constitution on the Church as' well as the Decree on the Adaptation and Renewal of Religious Life lay evident stress on the dy-namic inner element. It would seem, consequently, that in the revision of documents, this orientation of the Church on the reli-gious life in an ecclesial context must be borne in mind to assure that such revision be truly "adapted to the de-crees of this sacred Synod." At pre.sent, many congregations of 0sisters have a, single Sister Angelita Myerscough, Ad. PP.S., and Sister Mary Agnes Kutilla, Ad.PP~., are sta-tioned at the Pro-vincial Mother-house of the Sisters Adorers of the Most Precious Blood; Ruma (P.O. Red Bud), Illin6is 62278. VOLUME 25, 1966 557 Sisters Angellta and Mary REVIEW FOR RELIGIOUS 558 basic document, the "constitutions," approved by the Church. Such a document often contains minutiae of practice as well as canonical norms for government, the regulation of the novitiate, of profession, and so on, besides more basic guidelines for living. Frequently the canonical prescriptions of such a document quantita-tively far outweigh the few articles which give genuine guidance and motivation in living the Christian life in the particular spirit of the congregation. For example, many constitutions, theoretically meant to be a guide to holiness, make no reference or only a very meagre ref-erence to the work of the Holy Spirit. Clearly, constitutions structured in this manner were conceived in a framework of ecclesiology which stressed the institutional character of religious life. The ques-tion arises: Should the work of revision not look to-ward a more basic document which would delineate the dynamic plan of religious life in a particular congre-gation within the Church, a document that would sketch the ideal of life in community consecrated to God in the way of the gospel counsels in that particu-lar congregation? Faced with this problem, the American constitution-revision committee of the Sisters Adorers of the Most Precious Blood, working in preparation for their gen-eral chapter (Fall, 1965), explored the possibility of such an approach. After discussion and examination of the-basic principles that should guide such work of renewal in the light of the Council's teaching and its spirit, the committee concluded that revision work should distinguish the different levels of elements in the-present constitution,. It should attempt, in the first place, to draw up a very basic document which would be so structured as to give genuine guidelines for living, defining the life of the sister rooted in. an ecclesial community, sharing the particular charism of the foundress. A secondary document, the committee decided, should be drawn up which would contain the canonical and juridical elements' of a statutory nature, necessary for the functioning of the congregation as an organization, as an institution. Regulations of the more minute practices, inasmuch as they need to be spelled out at all, might well be contained in a third document, readily responsive to continuing adaptation by an internal au-thority of the congregation as a whole or at the provin-cial, or even local, level. Pressured for time, the American constitution-commit-tee prepared a draft of a first basic document, a kind of life charter for the congregation, that stressed its dynamic character. It is this preliminary document--a draft copy needing much further refinement which is printed here as a possible source of help to others. The general-chapter'of the congregauon, meeting in Rome in August and September of 1965, neither d~s-cussed nor approved the work proposed by the American interprovincial ~committee, ,.nor another ~revision, sub-mitted from another part o[ the ,c, ongregation. Instead, the chapter "ffdoPt.ed a plan for '.further work on the revisiofi of constitutioris Under:,the direction of 'an interfiati0nal Committee which is to use as a poiiat of departure the work" already prepared. -- The'f0110wifig life'charter, ~hen; has not been adopted by the congregati6n -' for 'submis~iofi to the competent e~ccles~asucal authority. It does, however, represent an effort at revision of constitutions thatwould give. the sisters a life charter expressing in a manner consonant with the~spiTit of renewal in the Church today the essen-tial "char~icter"'hnd original slSirit,~ of the Congregation of the Sisters' /~dorers "of the Most .Precious Blood [ounded ' in It~ily in 1834 by'Blessed Maria De Mattias. There, is no question of an ~ff6rt to creat a radically new spirit or new way of life, but rhther-a sincere attempt at genuine renewal more faitHful"to the charism of origins than the later, "more juridical' ~onstitutions of 'recent decades. The sisters who have examined this work have re-acted favorably; for they expect revised constitutions to be a norm they can truly live by, motivated inwar~dly, led by the Spirit to faithful response to their Christian vocation in the Church today. On the other hand,° ecclesi-astics whose business it is to examine the revised docu-ments of religious may, at least at first, react unfavor-dbly. Learned as they are in the law and long accustomed to judge constitutions' by their c6nformity to specific canons and general" norrnae~ they may hesitate before this~,kind' of approach, even "though the Whole spirit and work of the Council suggests it. Perhaps'it Will be some time before' i't will become,evident that the s~rvices of theologians, .bib~l~ical scholars, and histori'ans of Chris-tian spirituality are also needed in the work of exiamining p~oposed revisions'or n~w constitutions of religious com-munities. It may take even 10ngdrqor the time to come wheh scholarly religious (even womenl) may be invited 'to" help in the Careful htudy of proposed documents preliminary to the Church's Official approval of l such constitutions~ as ~/" ~ay of life. .' ¯ " '. ' Permission for ~oublication of this tentative effort has been granted by Mother Marciana Heimermann, Ad.PP.S., general superior of.the congregation, who had been a member of the American intetprovincial com-mittee working on this document. Lile;Chart~r ', VOL~UME 25, 1~66 ' 559 Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 560 PART I. THE COMMUNITY OF CONSECRATED LOVE CHAPTER I. THE CONGREGATION IN THE CHURCH God graciously calls Certain persons whom He has brought, into His household through baptism to wit-ness more fully to the paschal mystery by profession of the gospel counsels in a religious congregation. This way of life is a sign of the.Church, called to b~ the community of God's holy people, walking in His presence, living together in the spirit of the beatitudes while awaiting the glorious coming of our Lord Jesus Christ. To be a sister in the Community of Adorers of the Most Precious Blood, founded by Maria De Matfias, is to pledge oneself wholly to the adoring, redeeming love of the Son of God who gives His Precious Blood, chalice of the new and eternal testament, as daily seal of God's covenant with His chosen people. ¯ Thus the Eucharistic celebration is the sum and sum-mit of life in the Community, and the center which draws each member to Christ's compelling love. Let each sister,, then, be the living image of this compelling' !ove, of which the Precious Blood is a sign, an expres. sion, a measure and a pledge,1 offered in filial adoration to the Father, poured out in compassionate redemption of the neighbor. Through the Blood of Christ, each member gives herself wholly to God in consecrated love, for the building up of the Church, the Body of Christ (Eph 4:12). In Him she is to love and be loved; to serve, teach, heal, comfort the distressed; to deal patiently with wrong, so that through her the whole of creation may move toward "that beautiful order Of things which the great Son of God came to establish through Divine Blood." 2 The Sister Adorer looks to Mary, Mother of God and first adorer of the Most Precious Blood, to know the true meaning of her adoring, redeeming vocation: wom-anly surrender to God, and motherly service to others. She sees this reflected in her holy foundress, Maria De Mattias, who was so attracted to the paschal .mystery under sign of the redeeming Blood of the Lamb, that great love for the Church, vivified by the paschal 1 First Constitutions o] the Congregation, 1857, p. iv. ~ Letter of Blessed Maria De Mattias to Bishop Annovazzi, Nov. 13, 1838. presence of Christ, was the source of her apostolic strength. In this, her aim was that which the Church defines as the purpose of all apostolic work: "that all who are made sons of. God. by faith and baptism should come to 'praise God in the .midst. of His Church, to take part in the sacrifice and to eat ttie Lord's supper." 3 The sister sees too how Maria's' love for Mary most holy, gave such boundless depths to her dedication to her neighbor, St. Joseph, St. Gaspar del Bufalo, and St. Francis Xavier are special patrons of this" congregation. In them the paschal mystery has been achieved, for they have suffered and have been glorified with Christ. Now they teach the. sister to draw' all to .the Father through Christ, in the power of the Holy Spirit, thus fulfilling her vocation of adoring, redeeming love,-gloriously trium-phant in the paschal mystery. CHAPTER ~II. P~ERSONA.L GRowTH IN COMMUNITY' 1. Accep,,tance The Community, in receiving a young woman into its midst, accepts responsibility for her. As all of the sisters share in,receiving her, all are to remain aware of this resp6nsibility, pledged to God, to the Church, to the congregation, to all the People of God whose leaven she is to be. ~ God has called this baptized person to dedicate her life to Him in, consecrated love, and has guided her to our cQngregation. The Church takes her into religi6us life ~acc0rding to our cbnstitutions, and during the Eucharistid.sacrifice makes her act an event in salvation history by accepting the young person's public profes-sion of vows as a Sister Adorer of the Most Precious Blood. , Gift for gift, Community and member extend to one another the.,ctiarity Of Christ. For the work she opens herself to do. for God, the Community cares for her and gives her a suitable education so that with her po-tentials unfolding, she might fulfill both herself and her commitment in the lifetime God appoints to her. 2. Initiation Although early education in religious life is desig-nated in successive stages as postulancy, noviceship, and scholasticate, they hre fundamentally one, a unifying growth "forming a personal continuum. It is the way in which the person progressively deepens: her baptismal commitment- as a Christian and reorientates and re- Constitution 'on the Sacred Liturgy, n. 10. + + + LiIe ~,harter VOLUME 25, 1966 ÷ .÷ ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 562 patterns its, outward expression .as a Sis~ter Adorer.of.the Most Precious Blood. The postulancy,acitudints her with religibus .life;!in general and with our congrtgation in. particular.It tests her~readiness to become a member 6f thd, Community and safeguards her from entering pretipitately on, a way of life. f6r which she may'.bd fundamenfally umuited. In the noviceship, the Director;of Novices assists.her to learn and to live the' life of the ~congregation.by bringing her. first of all to ':a,.'more ,,intensely .shared ~member-ship in the. Church;' and then~,,an understanding of .the vocation of the Sister Adorer, ~ledicated 'to the glory of the :Precious Blood as it manifests' itgelf in the adoring, redeemifig love of the Savior at~ the. present moment in The Director explains to her the.~ principles ~of' reli, gious life in the light of the counsels,,of~ Sacred Scripture, the requisites of the vows as determined,by the Church, and how th~e are lived i~a fourfbld growth: as a reli-gious whose aim is union with God; as member of a reli, gious Community-family i~nt9 which she isinteg~fited through .charity; as' an: apostle,:~ .well.~repared tO give excellent service in the spiri~tiiM ~ahd ~orp'oral workg of mercy; as member of a well=ordered '~Sb'cietyI ~vh0se. in: terests' she. prom6tts thr6ugh tbopetation~and pr'odu~: tivity. Above all the noviceship prepares her 0to be a Sister Adorer of/the Most Precious Bl6~d,'~'d~voted~ ~0 the Church~-.and ready to be at i'her disposal thttiOgh' he~- C~mn~Unity. Then, what the novice has begqn, to live in the noviceship, 'she freely bi~ds~ h~iself ~.~o continue with the profession of. vows: 3. Identification The newly professed sister give~ herself during her scholasticate to her edla~ation., for th~ ~apostolate by deepening her realizati6n 'of the redemptive aspects of the Precious Blood,' by devoting ~herSelf to studie~, and by a.cquiring the skills she will need ~in her future s~r,~- It will b~ her privilege in whatever assignment she may receive, to bring others closer to God, to find Him in the truth, beauty, and goodness of this world, arid to comriaunicate (1 Col 9:22) her discovery to Others', Her purposeis to be°all things to~a.!l:~people, even a~. the Precious Blood is"'all~ 'things to all' members oF the Mystical' Body, to .win "all for Christ, and in Him to restore.all things tothe Fatherr ¯ .~he scholastic sister is to learn' ~aduall~', for all times; and to the extent of her abilities the habit of intellec-tual effort, the strenuous .discipline. of long exacting hours of concentration to master truth and ~o express it in whatever form of science or art it may require. In this she experiences on a n~tural level, a distinctive kind of asceticism which detaches her from the non-essential and channels her efforts toward the essential. That grace may build on a well-founded nature,' her intellectual capacities, her possible artistic bent, her emotional responses, all her human endowments are stimulated and cultivated to enter into the total com-mitment which she has made of herself to God in reli-gious life. Let the sister esteem and strive for every excellence in her perfectible nature, that she may bear witness to the Gospel call: "Be ye perfecL even as your heavenly Father is perfect" (Mt 5:48). The Director of Scholastics and the faculty who work with the young sister are to her an exemplification bf the Adorer's vocation. Let these sisters, therefore, be truly guiding lights, united in mind and heart with one another, giving that selfless devoted service which is inspired in them by the redemptive Blood of the Savior. At the end of the years of scholasticate, the young sis-ter should find herself spontaneously at home in her Community, well identified with her congregation in its adoring, redeeming vocation, its community life, its Christ-like and professionally competent service, its stability as a human organization pledged to a divine purpose, to which she is ready to give herself in works of mercy. 4. Creative Growth In the eternalplan of God, each person is to fill some moment of salvation history in fellowship with others. The sisters will find that the twofold commandment of charity binds them to others in God whose creative love underlies their human and divine relatedness. The apostolate of mercy is the pursuit of this related-ness. Let the sisters be perceptive of another's needs, whether of body or of mind; respectful of his person, no matter of what age or circumstance; gentle and skilled in filling each particular need as it requires to be filled. Thus their service will be truly creative, and in the mutual exchange of giving and receiving helper and helped may witness to the greatest of the beatitudes: "Blessed are the merciful for they shall obtain mercy" (Mt 5:7). Let the sisters regard their assignment to a particular community, place, and work as part of God's arrange-ment in their lives, trusting His word that "to those ÷ ÷ ÷ VOLUME 25, 1966 563 $i~t~r~ Angelita and Mary Agn~s REVIEW FOR RELIGIOUS 564 who ,love God all things work together unto good" (Rom 8:28). The sisters in the individual houses need to establish themselves in harmony as a community of God's holy people, reflecting the Church and witnessing to the joy of the beatitudes if ~hey are to proclaim the word of God in. sincerity and truth (see 2 Cor 1:12). It is to be expected that weariness, routine, exhaustion [~om physical and mental work, loneliness, misunder-standing and conflicts, emotional disturbances, personal inadequacies, the pressure of time will disturb them frequently. All these form the unique cross each must ~adjust to and carry with whatever natural and super-natural helps she may have a4ailable, without how-ever, unduly inflicting her cares on others. These diffi-cult experiences are her exercises in and test of maturity. Let the sister accept them generously and use them as creatively as she can to make herself that image of God which was meant to be from all ete,rfiity. In a more positive way, let the sisters be open to what-ever is beautiful in their environment and experience. Their feminine graces are God's gift to them and are meant to be cherished and cultivated, to be part of the consecrated love they offer Him. To sustain a ,high level of excellence in their apostolate, the sisters need to remain relevant to their umes, eager to learn through continued in-service educa-tion, to ~.mprove their skills, to deepen their, perceptions, and courageously, confidently try what may be new and unfamiliar in their work. For greater cooperation and efficiency, the sisters are to acquaint themselves with the best methods, procedures, and human skills of admin-istration in their contemporary "world. Moreover, there is pfirticular need that the sister~ do not neglect their civic and social duties in society which needs the moral support and spiritual idealism represented by reli-gious. If God has endowed a sister with "leadership, ability to communicate, and other necessary requisites, let her be of service also in rdligious and secular professional organizations. In her close and frequent contacts with clergy and laity, she is to be aware of her solidarity with them, of the common gifts and needs which unite her to them. Together they all share in the universal call to holiness, "to put on as God's chosen ones, holy and beloved, a heart of mercy, kindness, humility, meekness, patience" (Col 3:12). Together with them, ttie sister "in this temporal service will manifest to all men the love with which God loved the world." 4 Let their mutual relationship with clergy or laity Constitution on the Church, n. 41. be marked by courtesy, genuine concern .and. considera, tion, cooperation and esteem for one another's vocation, fhat in fostering the wholeness and holiness of one another, they may bear witness to one faith, one baptism, and one Father who is over all and above all (see Eph 4:5). " The creative growth of a sister during her years of active service will. continue in a fourfold way to intensify her religious life, to unite her more closely to her Com-munity- family, to extend her apostolic service, and to make her a vital member of her congregation in 15to-moting its welfare. 5. F, ulfillment The life of a.,Sister Adorer is outwardly apostolic and inwardly contemplative in varying proportions. As hard work, illness, and.age take their toll ,of physical ~health and endurance in the sister, she comes face to face with the gradual decline of ,her active service-~ She must sacri-fice the satisfactions of her former ,absorbing outward activities one by one. Perhaps her greatest trial is to feel useless and a burden. This too is part of God's purposes, for it: means that she is entering on a vital and new apostolate, that of prayer and suffering. The contemplative aspects of her lifelong vocation .are now to receive more exclusive attention. She becomes in ever greater measure part of the spiritual vitality of her Community, Her very presence among her sisters, her life spent in prayer and retirement, the Small Services she.can still render, the wisdom, of her years, all are. an in-spiration to the younger members. One of her .great services at this time is her readiness to see her Commu-nity change to meet the needs of the times and her sup-port of this with confidence that the Holy Spirit will guide the Community aright. She gives her Community a deeper faith, a more complete trust in. God, a more selfless devotedness through her prayers and sufferings, her very passiveness in physical weakness, as~ ,the paschal mystery is coming to fulfillment in her life. She accepts death as she ac-cepted her call to the gospel counsels--as a means to union with God. Her final act is one of community, stepping from among her sisters on' earth to the company of her sisters in heaven. Her final achievement is the Christian pass-over through death to glory. CHAPTER III. THE GOSPEL COUNSELS IN COMMUNITY The vows of religious are a covenant with God, made with Him through His Church, drawing all of one's life ÷ + + VOLUME 25, 1966 565 4. 4. Sisters ,4ngelita and Mary Agnes REVIEW FOR RELIGIOUS 566 on earth now into that union with Him which the Son of God mediates in us through His holy word and through the fullness of His paschal mystery for all eternity. Vows are a sacred bond by which a person is to~ally dedicated to God, loved beyond all things. The vows effect, a visible community in the Church, based not on property, nor on marriage, nor on independent self-determination, but on consecrated love. 1. Poverty The Word is made flesh at the Incarnation and in the Eucharist that all material things might receive divine significance through the Body of Christ, presented to the Father in His Resurrection and glbrious Ascension and daily offered ~anew at the Holy Sacrifice. With full appreciation of the goodness of: material things, the sister, too, by her vow of poverty, gives a new significance to things. She surrenders their independent use to the sovereignty of God. Thereafter the whole significance of her poverty lies in her dependence on God in faith. By .her vow of poverty, the Sister Adorer of the Most Precious Blood is a sign in the Church, publicly wit-nessing through consecrated imitation of the poverty of Jesus, to the supremacy of His adoring, redeeming love in her life. Let her commit herself wholeheartedly to the gospel counsel of leaving all things .to follow Christ. With St. Paul, she is able to abound or to be needy (see Phil 4:12), neither condemning the riches of human culture, nor placing her heart's joy. in them for their own sake. Freed from the spirit of dominion over earthly goods, with faith in God and trust in His providence, let the sister cast all her care on the Lord for He has care of her. Let her lay aside all temporal anxiety, to be witness to the beatitude: "Blessed are you poor, the kingdom of heaven is yours" (Mt 5:3). And if the Lord occasionally permits the sister to lack something that is necessary, let her thank Him, realizing that this privation' renders her more like to God who, being Lord of the universe, rendered Himself poor for love of her. Impelled by love for their vow of poverty and in-spired by the spirit of their Mother Foundress to whom the poor were most dear, let the sisters be genuinely concerned with the needs of the poor. "Give special attention to the poor," she tells her sisters, "and try to lead them on to good; send them to confession often, because God wants them for Himself since they have been ransomed by the Precious Blood of His most holy Son." 5 The sister's detachment' foreshadows the life of heaven, echoing, the very life of the Trinity in whom no one per-son Claims anything separately, for all .life is held equally in the common good.of die divine nature. The. religious ~ Community as a whole also has its commitment to,pove'rty, standing before the world as a sign of Christ's all-sharingAove, For all that the congre-gation possesses "is channele6~to the holy People of God who are served¯ through the works of mercy in which the members en~age, ~ ,' As a 'faithful~ steward, the Community administers the~Master's goods 6n~rusted.to it by the Church, that the ~'poor might bed.fed, ttie ,sick healed, the ignorant taught, the needy, visited, aged and orphans cared for; for whatever is done to the least of these, is done to Christ (see Mt 25:40). ' 2. Consec~'ated Virgin(!y The consecrated virgin~ is a covenant~sign of God's union with His holy people; He is one who loves, and can be loved uniquely and personally, universally and perpetually. The sister's life means that ~a ,human being is called to experience God's° personal love and that a human person is called to be .the ,bride of the Lord. She is also a sign of the eternal blessedness of. heaven where one's .love will be open .to all in its utmost intensity. , The Sister Adorer of the Most Precious. Blood,~as~,a Christian virgin is a witness, of. the fullness of God's~.love which called forth all of the Precious Blood on the cross for the Redemption of mankind. The sister's re-sponse to this initiative of God!s infinit.e and ,personal love for her is to identify herself fully with the Church, the one and only bride of Christ, ~to be caught, up ,totally in the life of worship and in t, he fruitfulness,,0L~ the Church as she unfolds her mission in thelworks of mercy. Let the sister's bridal .,relationship with Christ~,be evident in her loving receptivity~ of~the things¯ ofrGod, in her generbsity and interest ~in all ~His °concernS.As Mary:, accepted' the ;role, of universal motherhood at the Incarnation, so the sister,, overshadowed, oby the "Holy Spirit, consecrates her. ~lo~e to God for universal spiritual motherhood. She promises to devote herself to the task of fostering and nourishing the Christ-life in,souls redeemed by the Precious Blood and called to divine sonship in the risen Savior . ¯ The sister is an understandable sign 'of0 the divine love only insofar as she loves as Christ loves, with a * Letter oI Blessed Maria De Mattias to Sister Maria Gaetani, April 5, 1862. ' , + ÷ ÷ VOLUME 25,.11966 567 ÷ ÷ ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 568 deep, unique personal love. The sister must be willing to take the risk involved in forming deep personal and truly human friendships.with those called to be sons of God through the paschal mystery. Without friend-ship she runs thelopposite risk of becoming selfish, hard, unloving, and ineffective in truly helping others. By. the vow of virginity a sister renounces the intimacy, complementarity, and companionship of a husband as life partner, the satisfying experience of sex, the hope of children of her own flesh, and the delights of a home of her own. She must be careful not to seek .compensation for the lack of these .physical fulfillments by possessive-ness or a need to dominate. Let her find courage in God's personal love for her, and let her dealings with men be a mature sharing and concern for the work of the Church. ~Vhen the heart is not constantly filled with a strong faith and trusting love, virginity can become a burden. The sister's total committment to the apostolate re-quires above all, faith in the kingdom of God which is at hand, the readiness to work, and the willingness to suffer and sacrifice for the attainment of "that beautiful order of th!ngs which the grea~ Son of God came to es-tablish in His Blood." e This purity of heart can take root only when it is founded in deep personal prayer and nourished by spir!tual.reading. Devotion to Mary most holy and a profound humility will safeguard her .fidelity to her divine Spouse, who is continually calling to her: "Arise, my love, my dove, my beautiful one, and come" (Ct 2:10). 3. Obedience Our' Savior Jesus Christ redeemed the world through His obedient love, Himself.becoming a new covenant in His own Blood, to form for the Father a new people to be a communion of love.7 His Spirit who dwells fin their midst draws them powerfully into the current of Christ's obedient love by which the unfolding of God's redeeming plan goes for-ward through space and time. A Sister Adorer of the Most Precious Blood is called by the Father to live wholly within this.~ current of Christ's obedient love pulsing in the Church, and trans-forming the world. Let each sister by her vow of .obedience respond joyfully to this call, for through the vowed religious obedience of all the sisters together, the congregation is constantly renewed by the Father as a Community of o Letter of Blessed Maria De Mattias to Bishop Annovazzi, Nov. 13, 1838. ~ Constitution on the Church, n. 9. (See 1 ~or 11:25.) love pledged to ~arry forward the redeeming mission of Christ. Thus the congregation as a whole becomes a living sign, witnessing to the dynamic presence now of Christ's loving sm'render to the Father, which all are called to share. Thus, too, superiors and sisters together, experienc-ing authority in the bondsof charity, pledge themselves to do the will of God lovingly on earth as it is done in heaven so that the religious Community becomes a sign of the final destiny of the world made wholly conformed to God's loving design. A. What a Sister Vows By her vow of obedience a sister commits herself to be fully obedient~ to the Father's will within the framework of the Congregation of the Sisters Adorers of the' Most Precibus Blood as patterned by its constitutions and statutes. Let the sister surrender her whole person to Christ in the .Church, in and through her religious congrega-tion, thereby placing all her talents and life energies at the service of Christ'S' redeeming mission. Thus she will also be aspiring to the most complete fulfillment possibld of her own unique destiny~ in God's saving designs for her. By her vow of obedience, the sister likewise publicly affirms her decision to forego all individualistic planning of her .life's endeavors and activities in order the more fully to carry out the will of the Father in a Community of redeeming love and service. The' sisters will center their, common life of obedient service in the Eucharist. Here they will renew their self-surrender with Christ in His paschal sacrifice. In joyous fellowship they will find here the humility, power, and love for daily fidelity to the calls of obedience. B. Obedience of Superiors Because the sisters live their life of service in com-munity, in the human condition of a world in process of redemption, it is necessary that some sisters be given the responsibility of directing the service of others. The authority which these sisters bear must be pri-marily an authority, a service, of love to show forth the goodness and kindness of God our Savior, as was the authority which the Father gave to Jesus and which He in turn entrusted to His Church. While the superior must often be an administrator of temporal affairs and a guardian of discipline and ob-servance, her role is primarily to be a leader in charity and service. Hers is a ministry of love to her sisters, in 4, L~I~ VOLUME 25, 569 Sisters Angelita and Mayo Ag~s REVIEW FOR RELIGIOUS 570 health an~d in,illness, in,,rest, and in work, inall their temporal and spiritual needs. ~ . The sister .who is given the office of superior mustE be first in obedience.It is her task in a very special way. to discern the wil~l of God, .as fa.r as sh~ canl at each time~ point of God's unfolding salvation plan fdr the whole community and for each individ~ual sister in all .the major concerns of life.~andI .ser, vice within th_e,.con.grega- , In~.o~der to discern what God wills for, ~each~ and for all,, let the sister'.charged with the service of superior pray unceasingly for light from the Spirit and .listen~at~ten-tively to His promptings. Let her reflect, study, and enter into dialogue With others,'e~pe6ially with her sis~ ters, remembering with St: Benedict. that "the Lord often reveals what is better :through him who. is younger" (St. Benedict). _ ,Relying on the Spir.it, she can confidently hope to . discern as far as possible within the limits of the human condition, the.manifestations of God's will, first of all in His living word in the Sctiptures.:~nd in the voice of the living Church. She will discern His will throug.h the guidance of the constitutions and statutes, the history and the spirit of .the congregation, bearing willingly the,, burden of inter-preting them in love and prudence according to corn crete circumstances. She will likewise find God's will manifest through the God-given endowments and aspiratigns of the si.sters, through the present needs of the world, and especially the needs of the immediate area of the ~ apostolate. Al-ways her supreme norm in seeking, to ~know God's will for the Community and for each sister, in ,the concrete moment will be the law of Christ which is the law of love. Not only will the superior listen to the Spirit as He speaks through her sisters and others in order to discern God's purposes, but she will also communicate as far as possible to all her sisters her own insights and under-standing of what she.believes,God wishes for the Com-munity and for each sister. Thereby she will better ful-fill her role as leader in love and service°by promoting a thoughtful and mature involvement~ of all the sisters in the common service of the Community in Christ's re-demptive work. For a sister to fulfill the difficult service of superior, it is important that she be a religious who is strong and mature, prudent and, patient, secure befo~'e God, her neighbor, and herself.- She is to manifest a firm trust in her sisters. .She will be watchful not to promote an unworthy subservience among the sisters, nor will she allow those who are more authoritarian to dominate the Commu-nity. She will be alert to discourage all childish obedi-ence. Rather, she will promote a genuine Christian obedi-ence o[ humble faith and love. In this way, she can help each sister continually to develop toward the Spirit-given freedom in God's service which enables each to enter more fully into the current of Christ's loving obedi-ence by which the world is redeemed. Many sisters must necessarily share the responsibility of serving the sisters as superiors at different levels within the entire congregation. The superior general serves the entire congregation, the provincial superior the prov-ince, and the local superior the sisters of her house. It is important that they all respect, love, and support one another in their mutual task of directing the sisters ac-cording to God's will. Each superior at her level of service focuses the unity o[ her sisters in their loving, obedient service. "The Institute of the Most Precious Blood is made up of many individuals, but it must be but one heart and one soul, since there must be but one will, the will of God. and this will is made known to us through holy obedience." s C. Obedience of the Sisters Because the superiors bear the heaviest burden of obedience in the community, it is clear that all the other sisters must seek to have for them above all a strong Christian love and trust. The sisters will manifest this love in many ways, Be-cause "love is kind and patient" (1 Cot 13:4), they will accept the superior as their leader in service with all her human frailty, trying not to demand of her a perfection in life and in discernment to which even the best su-perior can only approximate. They will do their utmost to avoid unkind criticism of the superior and her deci-sions. All the sisters will support the superior by their prayer, especially in their daily covenant renewal in the Eucharist.~ The sisters will wish the superiors to deal with them honestly and frankly. They will expect the superior to direct them firmly, to discuss with them their service in the apostolate and their progress in loving obedience in community, and to correct them in love when neces-sary. s Letter of Blessed Maria De Mattias to Sister Maddalena Capone, April 8, 1850. ~ Constitution on the Sacred Liturgy, n. 10. + 4. + Life ¢lmrUr VOLUME 25, 1966 ÷ ÷ Sisters Angelit9 and Mary Agnes REVIEW FOR RELIGIOUS 572 The religious obedience of the sisters is not the forma-tive obedience of children toward parents, nor merely the prohibitory or regulatory obedience necessary for good order in any society or community. Rather, by the vow .of obedience each sister commits her life freely and responsibly to the redeeming work of Christ in His Church as it is specified through the religious Con-gregation of the Sisters Adorers of the Most Precious Blood. Hence it should be dear that no individual sister, by appeal to her vow, can shirk mature responsi-bility, for all her actions, since her vowed commitment to Chrigt's obedience makes her all the more fully re-sponsible for freely directing her whole life according to God's will.~ For this reason, each Sister Adorer should always seek to obey with faith, with a ready promptness, intelli-gently and with a sense of personal responsibility; above all, with sincere humility, not only externally and superficially, but with true cooperation of mind and heart. In faithfulness to their vowed obedience the sisters must wish the superior to be as fully right as possible in her discernment of God's will for all and for each. For that reason they should be. willing to give her all possible help in the measure of their own resourcefulness in discerning God's plan according to times and circum-stances and their personal insights. All are responsible for offering to the superior, with prudence, humility, and love, whatever suggestions and information they believe will be helpful to her in her task as superior. At the same time the sisters will be kare-ful not to impqse their point of view unduly, realizing fully that their suggestions sometimes will not be fol-lowed and often cannot be. The sisters will recognize that in many circumstances it is neither desirable nor possible for the superiors to explain decisions made. The sisters will sincerely try to recognize in such decisions a true discernment of God's will and obey in faith and joy. If, however, a sister is humbly convinced that a more serious decision does not truly accord with God's plan in. the given circumstances, it is her responsibility to make known to the superior, with all humility and love, her reasons for so judging. If after reconsidering the matter the superior con-firms the original decision, then a sister will, as far as possible according to her conscience, follow out the directive, trusting in the supporting grace of Christ, who "learned obedience through the things that He suffered" (Heb 5:8j. In so acting, a sister is not blindly yielding to an nn- reasonable command. Rather in faith she seeks its rea-sonableness within the larger framework of her life of obedient love and service in the Church. In rare in-stances when a sister cannot in conscience obey a direc-tive, she must be willing humbly arid with love to bear with Christ the suffering which her decision entails. Indeed, through, her vowed commitment, each sister has freely entered into the depths of the paschal mystery of Christ's loving obedience by which He redeeins the world. She knows that thereby she has pledged herself to a pattern of service which at times will certainly lead her, as it has the saints, to share the anguish and suffering and death of our beloved Savior, "obedient even to the death on the cross" (Phil 2:12). Though she is aware of her own weakness in face of the ultimate demands of religious obedience, she will rely on the power of the Spirit poured forth constantly from the opened Heart of the risen Lord. Through the strength of His love she can confidently renew her vowed pledge to be obedient with Christ through death to glory. Living as she does in a community of love under the sign of the saving Blood of Christ, each sister, whether superior or subject, will find her life of obedience con-stantly thrusting her forward in the current of Christ's redeeming love, more and more fulfilled in her own per-son as she is more wholly given to the service of Christ's redeeming mission from the Father. CHAPTER IV. FELLOWSHIP IN CHRISTIAN LOVE 1. Fellowship The love of Christ has joined the sisters in fellowship with one another as members of the Community given wholly to the glory of the Precious Blood. This fel-lowship has as its sacramental sign and source the holy Eucharist which unites them to one another in Christ at the table of the Lord. From the sacred precincts of the altar each sister car-ries Christ with her to the daily encounters which await her. Let her meetings with her sisters as well as with all others be a recognition of her previous meeting with them through the Eucharist. The sisters are to receive one another as Christ has received each of them, as they have received Christ, in a holy communion. Let them bear one another's burdens and allow each one to be wholly that person and that reflection of God which the Creator has designed her to be from all eternity. Let individuality be tempered with a genuine availability to others in the spirit of the beatitudes. To have time for thi~ availability implies continual simplification of one's personal needs, not with rigid constraint but with a gentle yielding faith. 4- 4- + Lite Charter VOLUME 25, 1966 573 + + ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 574 Simplicity is found in the free joy of a sister who forsakes obsession with her own needs, her progress or her failures, in order to fix her gaze on the light of Christ.lo Perfect joy is in the laying aside of self in peaceful love; it is wonderment and thankfulness con-tinually renewed in the face of the free giving of Him who grants an abundance of spiritual and material bene-fits. 2. Communication God favors man with the gift of communication that he might come to live in unity and charity. Let the sisters communicate truly then, with God and neighbor, in word and action, in movement and manner, in writing and reading, in sound and in silence, as the need of the moment requires. God communicates His holy word to man in Sacred Scripture; the thoughts of His heart in the sacramental life of His Church; Himself in the Eucharist, His sacred Body, His Precious Blood. Let the sisters in return communicate themselves to Him with loving attention and peace of heart; in out-ward composure and inward silence; in the fellowship of His holy people, whether in the lit.urgy of the Church or in the public worship of the Community or in the solitude of private prayer. Formed thus by the w~rd of God, the sisters will com-municate with one another simply and openly in a way that their word may reflect the gentle word of God. The sister is to listen with care and receive the neigh-bor's word with faith and respect, opening herself to understand the true meaning of what the other is trying to communicate to her. Let each be considerate of the other's need, of one another's time, obligations, free-dom, the pressures of the other's work, so that conversa-tion may be neither pointless nor harried but may be shared with .purpose and with kindliness. Let movement and manner be a witness to the charity, joy, peace, and patience of the Holy Spirit who wishes to act in and .through each sister and for this has chosen her to be a symbol of given-ness in His living Church. Let the sister give herself generously to serve the holy People of God with all that she is and has. Let her word to them convey what the word of God imparts to her in her communion with Him. Writing is the image of one's thoughts; readirig, the reflection of one's interests; listening, .one's openness to sounds of truth and beauty and goodness. All are means 1o "It is in simplicity that one finds wha[ is natural, and the divine is in the natural" Pope John XXIII. to discover, and to serve God, one's neighbor, and~ one-self. Let the sisters also read and listen to the more subtle communications of God that surround them: the lessons of nature, the signs,and circumstances of the times, the needs of others, the quiet day-by-day directives of the Holy Spirit at work among the People of God, so that they may come.~to'know and further the ways ~of God with His creatures. Let their sound disturb no one, their silenc~ make no one anxious. , The sisters are" to cultivate God's manifold gift of communication with careful attention. Let their words be trifly vessels of truth. Let them. use this precious art with modest~ and discretion, with sincerity and good-ness, ~ith all beauty~ that through communication their joy'in~ unit~ and charity may be full. 3. ~'ommo'n Life The sisters are to find in, all community activities-- rest~ repast.; re~creation, common work, or study--a way living the beatitudes. In this they will be a sign of joy and sisterly love among people. "Let the sisters Open themselves to what is human and through their fellowship with the whole people of God they~will ,see all vain desire to look down on the world vanish from 'their hearts. ~ They will be present to their':day and age;' and will adapt themselves to the conditions, of the moment. "Let them give profound affection to their parents, relatives, and friends, and through its quality help them to recognize the absolute' iniperative of a sister's 'voca-tion." .Each meal of ,:the Community is an agape in which sisterly love is manifested in joyfulness and simplicity of heart, whether'the meal be taken in silence, accompanied by spiritual reading, or. cheered with conversation. May Christ .be seated at each table to bless the food which His bounty prgvides, and which loving hands have prepared with care for ,the bodies He has created. May He make of one heart all who share in the breaking of one bread at the Community repast. It is Chris~ who receives .their thanksgiving for the refreshing goodness the meal and of the companionship they have shared with one another at table. It is particularly at recreation that fellowship and communication can unfold that human kindness which nourishes charity. Recreation is a Community experience of the freedom of the children of God. It is an opening n See the Rule of Taiz~ (in French and English), 1961, p. 14. Else-where in this document there are also brief borrowings from or thoughts inspired by the same rule. + + 4- Liye Charter VOLUME 25, 1966 ÷ ÷ ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 576 of one to another, to all, the confident giving of oneself to the Community~ and the ready acceptance of others just as they are at the moment. Let a sincere desire to please pervade the atmosphere of recreation, no matter what activity fills the time, Consideration for one another will effect that happy me-dium of activity in which all can relax, be refreshed in mind, and strengthened in sisterly affection. The harmony of prayer and recreation in the Com-munity will reflect in the harmony of work by which each sister can prepare to give her best and .most for the spread of the kingdom of God in her apostolate. To do this while living in community requires orderliness: in things, in activities, in the use of time. Let the sisters promote the good order of the house by carefulness in the use of furnishings and equipment, by willing cooper-ation in household work, by a reasonable punctuality in observing the daily schedule. The sisters ,should try to achieve continuity in their work during the hours allotted to it, and they will be careful to allow this same continuity to others. Let each sister know how to give herself to her assign-ments according to the capacities God has given he.r, without comparing herself with others. In true under: standing of membership in the Mystical Body, let her give generously of herself to her Community and to the Church .and find in the variety of services rendered by the members of her Community an expression of the wonderful works of God. 4. The Spirit of the Beatitudes It is in the inner circle of one's Community that the joy of the beatitudes germinates and flourishes for the enrichment of the whole Church. As the first four beatitudes relate the sister to God, the last four relate her to her fellow human beings. To be poor in spirit is to know humility, to be of the "anawim" of God, who live out of His bounty and share His goodness with one another. It is to be aware of one's sinfulness before the holiness of God, but to use the consciousness of sin as a precondition for ttie holiness which God Himself perfects in those who accept all His arrangements in their lives. Meekness is complete suppleness before the designs of God, knowing that God does the decisive work and letting what is decisive rest with Him. It is to see past and through the human factors which are the outward cloud concealing the purposes of His providence. To see the reality .o[ evil as it desecrates the inner temple of God in the soul is to know sorrow, the sorrow and compassion of Christ, suffering servant of Yahweh. it is to unite whatever one has of suffering to the redeem-ing value of the Precious Blood through which evil is overcome by good, sin by grace, hate by love, Satan by God. Hence sadness of heart becomes a beatitude in the ioy of redemption through the paschal mystery. Hunger and thirst for holiness lead all who suffer from their own and others' unholiness to look to the holiness of God, to be open to His action as the dry ground is for rain. It is to find the emptiness of earth's fullness in the face of the fullness of God in whom one day they shall neither hunger nor thirst anymore. To be merciful is to have an open heart for the misery of others, to be ready to help bear their burdens of mind or body. This is the beatitude of love, the deepest mys-tery of Christ and of Christianity. Purity of heart is clarity and simplicity of motive and purpose; it is straightforwardness and honorable frank-ness, for only one who approaches others in trans-parent purity is able to communicate with them truly, and .from this experience know what it means to see and communicate truly with God. When sincere, straightforward communication is lack-ing, good will is weakened; and misunderstandings, strife, chaos abound. God's gift of a peacemaker at this point, one who works for and creates peace, bridges the misunderstanding, reconciles differences, dispels, quar-rels, says the first word to soothe irritations, and brings about that sweet reasonableness which is the root of charity. Lastly, in our imperfect world love can evoke hate for its response. To live as a Christian, and much more as a Sister Adorer of the Most Precious Blood, is to accept without indignation and without retaliation such a negative response. It is to know something of the oppo-sition and persecution which enveloped Christ and which cost Him His Precious Blood. But it is also toknow the humility of the Son of God who, though He was God, gave Himself for the redemption of mankihd by becom-ing their victim. In the end, it is to know also the beati-tude of the Resurrection, the triumph of the paschal sacrifice. PART II. THE coMMUNITY OF ADORING LOVE CHAPTER V. WORSHIP A sister's worship is her whole being's .tribute to God; ¯prayer is her communion with Him. His holy word ex-presses the living bond between Himself and His holy people. As God speaks to the sister in the words of Sacred ÷ + ÷ Lite Charter VOLUME 25, 577 4. Sisters An~elita and Mary Agnes REVIEW FOR RELIGIOUS Scripture, may she find it her joy to "speak to God through the same inspired words, For the word of God is the great treasure ,hidden among us: for worship, for apostolate, for community. God entrusts this treasure to His Church, which as His faithful householder brings forth from its riches new things and old, as the readiness of the times requires. Let the sister, then, receive each day's bounty of the word of God a.s Holy Mother Church unfolds it in the liturgy--in the Eucharistic celebration; in each of the sacraments; in the DiVine Office by which the whole day is permeated with the presence of God; in private prayer, spiritual reading, and meditation. Let her listen ¯ to the word ofGod with an open, reverent~heart and give herself fully, together with the people of God, to the liturgical celebration of the mystery of redemption. Each Sunday is to "renew the living hope of the Resurrection, that t.riumph of the .Precious Blood re-flected in us first through baptism, then through con-firmation and dedication by vow to the Precious Blood. Let the Lord's day be a day of joy and relief from work.1~ The sisters are to prepare for Sunday and the feastdays of the Church with loving attention to the mystery about to be renewed °and to celebrate the day in com-munity as a sign of the eternal fellowship of heaven. As she faithfUlly renews the sacred seasons each year with Holy Church, she is duly formed by them to that image which her Creator envisioned for her. 1. The Mystery of the Eucharist The title of Adorer of the Most Precious Blood finds its perfect flowering at Holy Mass when this divine Blood renews its ~eternal covenant mission: adoration of God and redemption of mankind. . Let the Holy Sacrifice of the Mass be the very heart of a sister's life, a sacrament of love, a sign of unity, a bond of charity, hei paschal banquet ih which Christ is eaten, her mind is filled with grace, and a pledge of future glory is given to her. The depth and height of her participation in this supreme act is without limit. For in each day's Mass she offers herself anew, together with her fellow sisters, and all .the holy People of Go'd, ~with this day's particular needs. Through Christ, he~ immaculate Victim and her Mediator, she and those with her are drawn day by day more perfectly into union with God. and with each other until God is all in all to them. , Th~ Mass will truly be for the sist~ '~a be~iuty ever ancient ever new if, living her life of prayer closely 578 ~ Constitution on the Sacred Liturgy; n. 106. united to that of the Church in her liturgy, she relives in herself each year the complete cycle of the redemptive mystery. Each day, in rich variety, the word of God forms her anew and prepares her; together with the celebrant and the holy People of God, to offer the Body and Blood of Christ to the eternal Father at the supreme moment of the Mass. The great "Amen" of the Holy Sacrifice associates the sister, her apostolate, her life in community, with Christ, so that in all things the Father is adored, the precious Blood glorified, and all the People of God, redeemed by the Blood of Christ, are made unto Him a kingdom. 2. The Other Sacraments Let each sister come to know the joy of salvation in being redeemed again and again for God's kingdom by the Precious Blood. While the sin of a member marks the whole body, God's forgiveness reestablishes the sin-ner within the community. Let the sister love the sacra-ment of forgiveness and its sacramentals: the acknowl-edgment of, and sorrow for sin as she approaches the Eucharistic sacrifice, the mid-day spiritual renewal, the evening contrition for the day's failures, the chapter of faults. Let her celebrate the paschal fast and other penitential days of the Church or of her Community with voluntary earnestness as circumstances allow, both alone and in community, that the rich graces of baptism and penance might continue their formative work in her. In sickness and physical debility, it is her privilege to be supported by the sacrament of holy anointing. 3. Prayer The sisters are to go with gladness to the hours of Divine Office, to be united to the Son of God, to the whole Church, and to their fellow sisters in. singing the praises of God. For Lauds as morning prayer and Vespers as evening prayer are the two hinges on which turns the Church's daily praise of God.1~ Let them sub-mit lovingly to the discipline of voice and movement which this address to God requires. Let their perfect manner be the vessel in which the incense of their praise as the community of God's holy people is offered. Holy Mother Church has enriched this congregation with the glories of the adoring, redeeming Blood of the Savior. It is most fitting, therefore, that each day, as a community, the sisters join one another in special adora-tion of the Precious Blood. And since all of salvation history is permeated with this Precious Blood, they are Constitution on the Sacred Liturgy, n. 89. + ÷ ÷ Liye Charter VOLUME 25, 1966 579 ÷ ÷ + Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 580 to search the Scriptures .diligently and prayerfully for this treasure. In this way their adoration will become more aware, their commitment more complete, and their life in community enriched from this living stream in which they all share,x4 Let there be freedom in private devotions, but let the first of these be friendship with the Son of God in the Eucharist. Here are to be found that necessary support and fulfillment of a life of consecrated love, pledged to God by vows. Here the sister learns to express her unique personal response to God for His goodness to her, her oneness in fellowship with the saints, and her genuine concern for the holy People of God on earth. A life of prayer that is full and sincere is one of hum-ble creative love. It is ready compliance with hard work, the .willing exposure of oneself to pain to be the faithful servant of God. A sister's penance is her daily care for the Church of God, and the incessant outpour-ing of all her energies for its welfare. Let the sisters come to know and to follow Christ in His hidden and public, life among us in the world today; to be ready and open to fellowship in His sufferings; to learn through personal assets or limitations, achieve-ments or frustrations, the power of His Resurrectibn in I.IS. Renewed daily in the Holy Spirit through mental prayer, let the divine presence penetrate all of one's being. The sisters are to foster inward quiet and the outward silence in which communion with God is most surely experienced. Let each give her fellow sis-ters the support of her regard for the other's personal encounter with God; and let her be most careful about disturbing the neighbor by word, manner, or action. Let the sisters Strive for that joyous composure of mind and body which walking in the presence of God will effect in them when whatever they do in word or in work is done in the name of the Lord Jesus Christ, giving thanks to the Father through Him in the power of the Holy Spirit. PART III. THE COMMUNITY OF REDEEMING LOVE CHAPTER VI. THE APOSTOLATE The Church presents Christ to the world daily in His ministry of love through her religious who have placed the kingdom of God and its needs above all earthly con-siderations by their vows of poverty, virginity, and obedience. Though not of this world, the faithful of Christ, and First Constitutions o] the Congregation, 1857 (preface). especially religious, are to be the light of the world, to glorify the Father before all men through their life of charity in the apostolate and through their united wor-ship of the Father. An authentic apostolate is the charity. of Christ poured forth into and from our hearts by the Holy Spirit who has been given to us. Let the Sister Adorer find in the Precious Blood the exemplification and wellspring as well as the vitality and reward of her life of charity in serving the People of God. For the Precious Blood in the Mystical Body of Christ, as the blood hidden safely in the framework of any li~¢ing body, exists by its very nature to be of service: first of all to form and renew itself daily for its mission, and then to nourish and to build, to cleanse and to safe-guard, to heal and restore, to calm and relieve distress, to enhance with wholeness every smallest unit in the entire living body. Let the sisters esteem this infinite treasure and learn from the hidden, self-immolating, life-giving seiwice of the Precious Blood of Christ in His Body, the Church, what their own mission within the Church is to be, as member shares with member in this living stream. Let them find in whatever work of mercy they are serving, some aspect of the Precious Blood for their contempla-tion, love, and imitation. God has given the congregation in its holy foundress, Maria De Mattias, a woman endowed for all times with a profound dedication to the divine Blood, with zealous love for her fellow man redeemed by this Blood, and with intense loyalty to the Church and her needs. Let the sisters carry on the spirit of dedicated apostolic cooperation in the work of redemption bequeathed to them by their foundress and be united in fellowship with one another, ". for no other purpose than the welfare of souls which cost the Son of GOd so much blood, and to promote the glory of His Church by means of this Institute . ,, 1.~ Let the sisters find encouragement and guidance in what Maria regarded as essentials, for the apostolate of her sisters: to be led by holy obedience, to act with purity of intention and with humility, to work with tireless industry, to be united to Christ in loving gener-ous sacrifice for the salvation of souls redeemed with His Precious Blood~ Above all, let the sisters glory in the Eucharistic cele-bration where the Precious Blood becomes trhly present and is shared by all the faithful, both as their light and Letter of Blessed Maria De Mattias to Bishop Annovazzi, May 2, 1838. ÷ ÷ ÷ Life Charter VOLUME 25, 1966 581 strength in the apostolate and as its joyous fulfillment and reward. In the life of the Sister Adorer, it is the triumph of the Precious Blood in herself as well as in those whom she has served, that will give her holiness its unique splendor as the paschal mystery reaches its ful-fillment in her. + + + Sisters Angellta and Mary Agnes REVIEW FOR RELIGIOUS 582 I. The Apostolate of Domestic Work Our Blessed Lord prepared for the years of His public life by the quiet, holy years of Nazareth as He worked with His hand.s toward the upkeep of a home. Closest to and most needed by the religious Community for its daily maintenance is the lowly apostolate of domestic work, sanctified by the Holy Family, and exemplified so well for sisters in our Blessed Lady herself who spent her life in the hidden unassuming duties of a home. Every sister has some domestic duties to perform each day; and for some sisters it is a full-time assign-ment, whether that be in a small mission convent, in a hospital, home for the needy, seminary, episcopal resi-dence, or one of the large houses of the congregation. ¯ Let the sisters see in these humble tasks a reflection of the activities in the home of the Son of God at Nazareth. The sisters who have the privilege of working with our Lady in this apostolate create the atmosphere of quiet contentment needed by the sisters to renew themselves physically and spiritually for further work in their re-spective assignments. If the sister, while doing domestic work, has taught herself to do her work lovingly, with some recollection, centering her thoughts now and then on the things of God, she will radiate peace and cheerfulness to her fel-low sisters, so that their reunion in community after the varied scenes of their scattered activities in the apostolate will be a truly welcome Community experi-ence. It should be possible for the sister doing full-time do-mestic work to enrich her life in 'many ways. Some gogd reading, arts, crafts and skills, the creative use of her hands, some share in a form of social apostolate in her environment will give her opportunity to serve others in different ways as well as to broaden her own experience. The sister at work in full-time domestic duties is at the heart and center of the convent home or the institution. Her services, her prayer and concern follow her sisters and those for whom her assigned work is done. What sh~ prepares and does for them endears her to them a hundredfold. If her works of mercy seem limited in scope, they are enriched in depth of meaning: she is a maker of the religious Community-family. 2. Catechesis . °/"'Our life is an ap~st01ic life, to bri~ag the good news to the people . 10 Do all the good you can for those who are waiting for the brehd of Christian doctrine" ~(Ble~sed Maria De Mattias).17 The imparting of Christian doctrine is the work most cherished by Maria De Matfias and 'the cong~egatior~ which she founded. As a member of the Church obedient." to the Holy Spirit; the sister is a witness to the faith that is'in her ag she educates the faithful in the things Of God. °Her greatest requisitd, therefore, is her own' personal holiness,'° fostered' through the sacramental life of the Church who directs her activities: /'Through o!~aptism ~nd ~nfirma~ion all are ~commissioned by the"Lord'Him-self to p~rticipate in the salvific mission of~he Church. Through Holy Eucharist that "charity toward God and man which is the soul of the apostolate is communicated and nodrished." In'fiddlity to the" living Church, the sister is to present Christ who is her message With' all the integrity, clarity, and intensity which her every word and action can con-vey. I.n g~eat charity and with all human competence, she is to adapt the divirle'~mess~g~ to the level of understand-ing of her h~arers, of whateCer age or condition they m,a~, be, ia'nd find,meanifigful' ways for them in which to express tSeir 'resp6.nge in faith, hope, and love to the word of God.' Mindful of the Church's word to her that "the aim and ~object "of"the apoS'tolat~ is that all who are made sons of God by faith and baptism should come together to~ praise God in* the midst of His "Church, to take part in the sacrifice, and t~ eat the Lord'~ supper," ~ the sister will do all ih he~ power to make the worship of God the climax'0f her endeavors. The Community is to use every means and every ef-fort to prepare the sisters well for the teaching of Chris-tian doctrine. Let it be the aim of all in the Comhaunity to be as closely associated as pos.sible with the sublime commission of bringing the light of the gospel and the gifts of the li'tu~gy to all the People. of God. Ttie siste~ is to ~egard it a~ a special i~Hvil~ge to pro-mote and to assist with retreats~ According to the Con-st~ tution 6n ~h~ Church, all' th~ Christian life and to the perfection of charity." ~ to Frequent saying of the foundress. x¢ Letter of Blessed Maria De Mattias to Vincenta Ferri, Oct. 20, 1855. . ~ ~s COnstitution on the Church, n. ~. ~ Constitution on the Sacred Liturgy, n. 10. ~ Constitution on the Church, n. 40. + + + Li]e Charter VOLUME 25, 1966 ÷ ÷ ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 584 Lay retreats for women offer these persons an oppor-tunity to study the!r relationship with God and neigh-bor, to weigh and to measure, and to grow in Mary-likeness to the full stature of Christian womanhood. As a prolongation of the apostolate of Blessed Maria De Mattias, the Sisters Adorers of .the Most Precious Blood welcome these, their sisters in the Mystical Body, and by a joyous serf-giving hospitality provide the leisure they need to walk and to talk with Christ. With great faith, let the sisters give themselves more intensely to prayer and penance at this time so that the retreatants may be receptive to the graces which the Holy Spirit wishes to impart to them. The' sister who shares wholeheartedlyin the retreat work ~ontributes toward the spread of God's kingdom on earth, for a saintly mother is a lamp burning in the sanctuary of the home, a saintly woman in other walks of life is the salt that savors the earth. Both by their kind-ness and goodness exert an apostolic influence; both en-hance the glory of the Most Precious Blood. 3. The Apostolate of Education Because grace builds on nature and all wisdom and knowledge is a reflection of the wisdom and knowledge of God, because the Church has a need of educated mem-bers, because it is the will of God and the desire 0f His people, the sisters are to undertake works of general edu-cation at all levels where they can give competent serv-ice. Let the sisters remember that they are called through their educational commitments to assist the great body of laity in the Church to become her apostles to the secular world, to permeate it with the spirit of Christ in justice, charity, and peace. Moreover, the laity, by their competence in secular training, by their activity ele-vated from within by the grace of Christ, can vigorously contribute their effort so that created goods may be per-fected by human labor, technical skill, and civic cnlture for the benefit of all mankind according to the design of the Creator and the light of His word.2x . As teachers of the laity, the sisters need to be and to remain through continued inservice education in the forefront of knowledge and culture in their generation, if the holy People of God whom they educate are to be helped in carrying out their commission to restore all things in Christ. The sisters are to be well prepared for their work, first of all through a broad cultural education and through whatever specialization of subject matter or Constitution on the Church, n. 36. method they may need in special instances. They are to meet and to maintain, even surpass, the current stand-ards of secular evaluating agencies, ~onsid.ering the greater excellence of the purposes which Catholic educa-tion has over the purely secular. In their association with the laity---children, youth, faculty members with whom they work, lay professors whose classes they attend, parents of the youth whom they teach and counsel, business men and employees-- the sisters are to extend the charity and courtesy of Christ, to give splendid and striking testimony of how the world can be transformed and offered to God through the spirit of the beatitudes32 Encouraged by the spirit of Blessed Maria, let the sisters bear in mind their more immediate aim in edu-cation, "that after having pursued these studies a young person is well trained to go through life holily and with dignity," as well as the ultimate~ divine purpose in this "most extensive field the Lord has confided to us, the fruit of which is the salvation of souls redeemed by the divine Blood." 28 4. Care o[ the Sick Human suffering has always been of deep concern to the Church, for she sees in her stricken members the image of the suffering Savior. From Christ her founder she learns compassion for the afflicted and seeks to al-leviate their need, whether of body or of soul. The Sisters Adorers of the Most Precious Blood, iden-tifying themselves with the Church, share this same com-passionate love. Let the sisters, therefore, whose gifts and training enable them to care directly for the sick per-form their services with the greatest kindness and un-derstanding of the patients' needs. Their professional services are to be of the highest excellence in that they are seeking not only to meet ac-cepted standards of performance, important as these are, but to communicate to their charges, along with pa-tient care, the peace and comforting of Christ. As the opportunity or the need arises, let the sisters convey to the sick a loving solicitude for their spiritual needs, without however undue insistence or pressure, par-ticularly with patients of some other faith. The sisters are to respect the religious convictions of all and in a truly ecumenical spirit be cordial and helpful to minis-ters and rabbis who come to visit and care for the spirit-ual needs of the members of their congregations. Let the sisters associated in any way with services to Constitution on the Church, n. 31. First Constitutions o] the Congregation, 1857, p. 53. ÷ + ÷ Li]~ Charter VOLUME 25, 1966 ÷ ÷ ÷ Sisters Angelita and Mary Agnes REVIEW FOR RELIGIOUS 586 the sick, however lowly and hidden .their tasks may seem to be, realize that they are making important ~con: tributions to the welfare of the whole, and that without their support some. more nearly related activities of pa-tient care would be seriously hindered. In unity and charity alofie can there be that cooperation which en-ables the members of the community, to work harmoni-ousl~ to carry on so complex a work." of the apostolate in a spirit of joyous service. In the numerous inter-related, departments of the health institutions which the sisters operate, care should be taken lest the machinery o[ organization overwhelm the person, and human values and needs be lost in the name of efficiency. On the other hand, it is necessary that each assign~ ment of duty b.e promptly and conscientiousl); fulfilled, since the activities and procedures of the whole institu-tion are so highly inter-related thht °they affect one an-other's operation. The ultimate value involved is the hu-man life' of.a sick person, a life that is 'often dependent on a matter of, minutes for survival through a crisis. 0 The sisters in the hospitals work closely with large numbers of the laity at various levels of authority: doc-tors, nurses, administrators, employees. It may be that at times sisters will have to show a readiness in Christian obedience toward lay persons in authority, Let the sis-ters'be the first to set an example of loyalty and coopera: tion, of diligence and a sense of resp6nsibility for the promotion of the general good. Let the close association of these laity'with the sisters reveal nothing in the latter except the pure charity Christ, evident in the sister's dedication, her gentleness, her courtesy even when she must be.~ finn, her poise in word and manner. Let this also be'evident to'visiting relatives and friends of the sick person. 5. Care of the Aged In their desire to serve the Mystical:Body more com, pletely, the sisters extend their apostolate to the care of the aging, men and women of an older gen.eration who come to,spend their declining year~ in their home for the aged. : ",. The.sisters chosen.lfor this work will deem it a privi-lege to be associated Closely with the aged and infirm, seeing in therh the presence of Christ and reveren~cing them for their wisdom, experience and merits, their sacrg rices and perseverance. They ,will be influenced in their appreciation of theelderly by God's own respect for a long life as exemplified in the beautiful biblical exam-ples of old age. . ; , " , ., In their care for the aged, the sisters, imbu6d' with a humanism based on Christian values, will accept thegn fully as persons, even though their physical, mental, or emotional limitations may ~nake them dependent on others for their needs. Let the sisters be carel~ul to help these people main-tain their sense ot~ personal dignity by utilizing their remaining abilities to the full. Elderly people have a need and a right to freedom in making their own choices and decisions in their life situations. All staff members have the corresponding duty to respect that right and to help the residents use all their resources of personality for as long as possible. It is faith in God and a tender compassionate love for His holy people which enable the sisters to give ,their services generously to the care of the aged. To do so in a competent manner, the sisters are to receive adequate training and preparation for their work. Their cheerfid and encouraging manner toward the aged, their helpful-ness to them, their regard for them as persons beloved of God, will create an atmosphere of peace and contentment in the home. Knowing that their residents are on the threshold of eternity and that for most of them this is their last home on earth, the sisters should make their lives as meaning-ful as possible, encouraging them to love God faithfully and.to look forward to meeting Him in heaven. 6. Care o[ Orphans The love and care of children, so dear to Christ in His earthly life, has a special appeal for the sister. The natu-ral endowments which fit her for motherly care of others is here given expression in a work which has in it the highest supernatural possibilities; Let the sister who is assigned to this work give herself to it with great kindness and sureness. Her first task will be to win the love of the children through the physical care which she gives them so that she will then be. able to carry out the more difficult task of social, moral, and re-ligious training. The sister should try in every way possible to under-stand her charges. Frequently these children have had disturbing experiences which have exposed and deepened certain natural weaknesses in them. Consequently their training will require greater patience and tact in helping them grow into good Christian men and women. Besides a broad generhl education, the sister engaged in this work needs to have some acquaintance with child car~ and child psychology.to enable her to care for prob-lem children. She herself must be emotionally mature and able to withstand and control a great deal of emo-tional irregularity in them. Li]e Charter VOLUME 25, 1966 587 ÷ ÷ ÷ Sisters Angellta end Ma~y Agnes REVIEW FOR RELIGIOUS 588 Their religious formation is her greatest concern, and it will be the quality of the sister's own religious convic-tions rather than the quantity :of her instructions which will effect the greatest good in them. She will lead them to love the Church through her feasts and celebrations; and as they are able to absorb it the sister will explain to them the meaning of: the great mystery of redemption. She will bring them to love the word of God and to understand the significance of the incidents in salvation history which reveal the greatness and goodness of God to His people. As they grow older, the sister will see to it that the children understand and practice their moral obligations to God, to themselves, and to one another; she will need to acquaint them with the problem of evil-in its many forms and with the Christian's way of dealing with it. Lastly, in a practical way, the older children will have to be prepared to be self-reliant and self-supporting to the best of their abilities. And even after they leave the sisters, it will remain a part of the sister's duty and privi-lege to follow them through the years with her interest; her prayers, and her wise counsel when they return to her periodically. 7. The Apostolate o[ Social Work While social work formally so called is a profession with its own particular requirements of preparation and operation, in its more general meaning social work re-fers to the non-institutionalized form of charity which is open to one and all on an individual to individual basis. The sisters frequently have the opportunity tO bring the charity of Christ to the needy of body and mind in their homes or wherever they may be found. Personal kindness and concern for another is at the heart of this apostolate, and here the sister can experi-ence in a simple basic way what it means to help the neighbor. An institution by its nature has to accept the person on its own terms and fit him into its operation. In the direct apostolate of social work the attention is wholly on the needy person, and the solution of the problem does not come ready made; it calls for the lov-ing initiative of the apostle. Most frequently this apostolate is found among the very poor, the underprivileged, the mentally distressed, whether in large cities or in remote rural areas, Let the sisters who are able to engage in this work do so with humility and simplicity, accepting the needy and their condition with understanding of the ihuman dignity be-hind the impoverished circumstances. With tact and gentleness, let the sisters offer their services as to Christ, remembering that their very pres- ence should speak of faith and confidence in. a loving providence, of love for one's fellow man. Let the sisters be careful not to impose their own standards or preconceived form of charity on whomever they contact, but with sensitive regard for the person fill the need as the person would like to have it filled, as much as possible. This work of mercy frequently rises out of the initia-tive of the sister, who besides fulfilling her duties in her assigned work will find in this added form of charity a way to enrich and motivate her daily routine. It is for her a more direct way to contact Chris( in His needy ones. As she goes about this work, the sister brings the mes-sage of the gospel vividly to people. She .is literally a witness that the kingdom of God is at hand, that the Church is the Church of the poor, that in the charity of Christ there is genuine human concern for the well-being of another, and that each person is precious before God. The sisters should expect rebuffs and opposition on the part of those who have been embittered against re-ligion or who have grown indifferent to it. It will be the sister's cheerful patience with, and genuine goodness to them which will dispel [ear and distrust and open the way for the love of Christ once more to come into their lives. CONCLUSION Through baptism, God has called us out of darkness into His marvelous light. Through the Eucharist-covenant, sealed in His Pre-cious Blood, He has made us a kingdom unto Himself. Within this kingdom we His purchased people, Sis-ters Adorers of the Most Precious Blood, vow to 'Him our consecrated love: In poverty--to use the things of this world as if we used them not; In virginity--for who shall separate us from the love of Christ? (Rom 8:35); In obedience--for He became obedient for us unto death, even to death on the cross (Phil 2:8). Wherefore, redeemed not by silver or gold, but by the Precious Blood of Christ, and in union with His Church, we sing for all time and for eternity, "Come, let us adore the Son of God, who has redeemed us with His Blood." ÷ ÷ VOLUME 25, 1966 589 JOSEPH F. GALLEN, S.J. Practice of the Holy See ÷ ÷ Joseph F. Gallen, S.J., resides at St. Joseph's Church; 321 Willings Alley; Philadelphia, Penn-sylvania 19106. REVIEW FOR RELIGIOUS 590 This article gives; from January 1962, the practical points of the practice of the Holy See concerning the reli-gious life" from rescripts, replies to quinquennial reports, and approvals of changes in articles or of general revi-sions of constitutions. Nature and Federation of Religious Institutes The evident fact that lay religious institutes authentb cally cooperate in the mission of the Church is stated simply in the constitutions of a missionary congregation of sisters: In approving the Congregation and its special end as it is stated in the. Constitutions, the Church gives to the Congrega-tion, and through it to all its members, the mandate of collabo-rating in her missionary apostolate. A no less evident and fundamental principle of the con-tinuation of the apostolate of Christ is reasserted in the same constitutions: "Let the Sisters care with preference for the poor and the outcasts no matterwhat their misery or deficiency may be." The Holy See has approved a closer association of some religious institutes of men and women, as is exemplified in the following approved articles of the constitutions of two missionary congregations of sisters: The Congregation is associated with the Cong3"egation of the. [a Congregation of priests and brothers] in view of the mutual help they will give each other in spiritual matters as well as in missionary activities. Each Congregation, however, shall keep its juridical and financial independence. -- The general purpose of the Congregation is to promote the greater glory of God and the honour of the Blessed Virgih,. by the sanctification of its members and by their co-operation in the apostolic work of the Chur~:h in the Missions, preferably the Missions of the Fathers of . (Cf. REwEw for RELm~oos, 17 [1958], 251-2; Questions on Religious Life, q. 150). The Redemptoristine Nuns, Monastery of St. Alphon-sus; Liguori, Missouri, received permission from the Holy See to resume solemn vows and introduce major papal enclosure. The solemn vows were pronounced on June 27, 1965. The instruction of the Sacred Congregation of Reli-gious on the apostolic constitution Sponsa Christi stated in number XXIII, 4: "Confederations of regional federa-tions can be allowed if need, or great advantage, or the traditions of the order recommend them" (Bouscaren- O'Connor, Canon Law Digest lor Religious, 351). By ~i decree of January 4, 1964, the Sacred Congregation sup-pressed the confederation of Visitandine Nuns. The federations remain. The pertinent parts of'the decree are: In consideration of the historical'origins of the Order of the Visitation of Holy Mary and the. spirit with which its Holy Founders have animated it but more particularly on account of the explicit declarations made by them to prevent the formation of a central government in .the Order, the Con-federation of the Visitation of Holy Mary has been suppressed together with all its canonical effects. On the other hand, in conformity with the original traditions, the entire group of monasteries with their Federations will constitute the Order of the Visitation of Holy Mary . The present group.ing bf the monasteries into federations will be revised and a~lapted in a way that will render them more homogeneous, both from a disciplinary and a geographic viewpoint. If necessary, the Sacred Congregation will contemplate the creation of new federations within the present organization. On May 15, 1965, the Mother McAu!ey ConferenCe of the Sisters of Mercy of the Americas unanimously adopted the following resolution: Be it resolved in accordance with the wishes of the' Church as expressed through the propositions on the religious life of the Second Vatican Council, definite steps be taken towards a World Federation of Sisters of Mercy; that as one such step this Mother McAuley Conference be formed into a Federation of the Sisters of Mercy of the Americas; that in such a federation the autonomy of each congregation be preserved. The officers of the federation are Mother M. Thomas Aquinas Carroll, R.S.M., Pittsburgh, Pennsylvania, presi-dent; Mother Mary Regina Cunningham, R.S.M., Bethesda, Maryland, vice president; Mother Mary Bernard Graham, R.S.M., Merion, Pennsylvania, secre-tary; and Mother Mary Patrick McCallion, R.S.M., North Plainfield, New Jersey, treasurer. The goals or purposes proposed to the McAuley Con-ference were: (a) to promote unity and stability of the institute and preserve the spirit of Mother McAuley; (b) to intensify the spirit of unity in the apostolic labors of the Sisters of Mercy in order to fulfill their mission in the Church; (c) to advance the cause of canonization of Mother McAuley; (d) to draw on the resourcefulness of all members of the institute in order that continuous + + + Practice Holy See VOLUME 25~ 1966 ÷ ÷ + $oseph F. Gallen, $.7. REVIEW FOR RELIGIOUS 599 development and. improvement be made in the works entrusted to the institute; (e) to cooperate in the planning for the promotion of the spiritual, intellectual, profes-sional, and apostolic growth of the sisters in formation, sisters in service, and sisters assigned to the apostolate of prayer. The functions discussed were: (a) to serve as a channel of communication to all member communities; (b) to recommend consultants in specialized areas when re-quested to do so; (c) to provide a source of information for creating in the mind of the major superiors an aware-ness of areas in need of study, necessary adaptations, and changes warranted in keeping with the mind of the Church; (d) to make recommendations that will promote excellence in the works of the institute, project a Mercy corporate image capable of attracting desirable candidates to the institute, and bring about unity without uni-formity in community living, emphasizing the virtues of charity and mercy. Any community of Sisters of Mercy in the United States, Canada, or Latin America may become a member, with formal application to be made after community approval. Active participation was to be had in federa-tion meetings either in the person of the major superiors and assistant major superiors or by proxy. On July 2, 1965, the following petition was addressed to the cardinal prefect of the Sacred Congregation of Religious: The Major Superiors of the Congregations of the Sisters of Mercy of the United States and Newfoundland,. both the in-dependent and those of the Union, have been meeting regu-larly since 1955 as the Mother McAuley Conference for mutual consultation on matters pertaining to their Institutes. At the meeting in Hooksett, New Hampshire in May, 1965, the matter of federation was discussed and accepted in principle. Thereafter major superiors of the Religious Sisters of Mercy, representing approximately 15,000 sisters, with the deliberative vote of their councils, have indicated their desire to federate as the Sisters of Mercy of the Americas and their Missions. May we through the Sacred Congregation of Religious peti-tion the blessing of His Holiness, Pope Paul VI, on this initial step towards greater excellence in our apostolic endeavors? In a letter of August 12, 1965, to the president, Mother M. Thomas Aquinas, R.S.M., the Sacred Congregation replied as follows: This Sacred Congregation is most pleased to have the news which you sent in your letter of July 2, about the desire and intention of the Major Superiors of the Religious Sisters of Mercy of the United States and Newfoundland to federate. This is preminently in line with the views of the Holy See and, as you know, has been the desire of this Sacred Con-gregation for some time. We thank you, Reverend Mother, and all the Major Superiors of the Religious Sisters of Mercy who have been taking part in the meetings, and we express the hope that you will be able to draw up in the near future a workable set of Statutes to govern the Federation, to be submitted to this Sacred Congregation. Sending you a special blessing for all the Major Superiors of the Religious Sisters of Mercy and their subjects . The aim will be to join eventually with federations of the Sisters of Mercy in Australia, Ireland, and so forth, to form a world confederation. A meeting looking towards this end will probably be held in "Pittsburgh in June, 1966. This federation can obviously be of interest to similar institutes, and we have already received inquiries about it. For that reason we have described this federation of the Sisters of Mercy very fully and have also prev.iously submitted the description of the federation to Mother M. Thomas Aquinas for her approval and correction. Members, Precedence, and Titles One congregation of sisters abolished the class, of lay sisters. In a general revision of its constitutions, a con-gregation of sisters omitted the article on precedence. The revision was approved with no animadversion on the omission. Two other sets of constitutions contain the fol-lowing sentences on precedence: In formal assemblies, for the sake of regularity, the follow-ing order shall be observed as to precedence.--The Sisters follow no order of precedence when approaching the Com-munion Table and the Sacrament of Penance. Personality development and fulfillment are obviously not to be attained at the expense of the common good and without regard for the interests of other individuals. Some customs of the religious life can unreasonably obstruct the sense of individuality and the development and fulfillment of the individual. I have often suspected this in the submergence of the family name by that of a saint. I admit that I have not seen any sign whatever of a universal agreement with this opinion. However, a congregation of sisters, in a revision approved May 12, 1964, changed its practice as follows: "The postulants shall wear a plain dress, different from that of the novices. They shall retain, even as professed, their family name." Religious Habit Several congregations of sisters included in a revision of Prmrtice of their constitutions or secured from the Holy See a faculty Holy See of the following tenor: VOLUME 25, 1966 Where the climate or the work of the Sisters may require some modification in the form or the color of the habit,, these 595 ]oseph F. REVIEW FOR RELIGi~)US modifications may be determined by the Superior General with" the consent of her Council. The inclusion of such an article in the constitutions is understandable, but it is to be remembered that the permission of the Holy See is necessary only for a sub-: stantial, permanent, and general change in the color or form of the habit (R~w~w FOR P~LIGIOUS, 18 [1959], 80- I; 13 [1954], 298; 21 [1962], 409). The Sacred Congrega-tion of Religious showed itself more liberal than one congregation by approving a change in the habit, "pro-vided the headband and veil were reduced somewhat." The Sacred Congregation approved a description of the habit~ in the constitutions that leaves a wider field of choice to the particu!ar institute. ,The pertinent articles are: " A habit suitable to the times and conformable to religious dignity, reserve, modesty, and poverty shall be worn by the members of the Congregation. The veil of the professed Sisters' is o.f bl.ack material and light in weight. The veil of the nowces ~s white. The coil is of white material. A rosary is - carried in the, pocket. A cincture of suitable material is worn. , The constitutions of this congregation had formerly stated: "Postulants shall wear a modest black dress dif-ferent from that of the novices." The revised article reads: "Postulants shall wear a becoming dress different from that of the novices." Canon 540, § 2 requires only that the dress of the postulants be modest and different from that of the novices. It may therefore be secular but modest; special and" uniform, but this is not of obliga-tion; religious, but different from that of the novices. Constitutions ordinarily merely state canon 540, § 2 in describing~the dress of the postulants and therefore, as the revised article given above, permit all the variations just listed. The Sacred Congregation for the Propagation of the Faith has recently and at least twice approved a descrip-tion of the habit in the constitutions that gives a much wider power to the particular institute. The only article on the habit in one of th~se congregations is the follow-ing: The Sisters wear the religious habit, in order to make~ manifest their total belonging to God, and also to safeguard themselves more easily from the spirit of the world. This religious habit shall be simple in style~ adapted to the climate and the customs of the country, as also to the activities of the Sisters. The veil, the crucifix, and the ring shall be the symbols of their religious consecration. The second congregation has only the two following articles: " The distinctive dress worn by a religious sister identifies her as a woman consecrated to God and belonging t.o a particular religious community. The habit is visible testimony of the sister's response to Christ's elective love and witness to His .presence in the world as One who serves. The religious habit is a reminder to all men of supernatural realities. Accordingly, the sisters shall wear a simple habit and veil expressive of their dedication. For a serious reason they may be excused by the mother general, or in urgent necessity by the local superior. The material in habit and veil shall vary according to the climatic conditions under which the sisters live and must be approved by the mother general with the advice of her council~ Major daanges or modifications of the habit may be made by the general chapter to meet the needs of the times. The habit is to be a symbol or sign of the consecration to Christ. The traditional form of the habit is not a natural sign of this consecration, as smoke is of fire, nor is there anything whatever in revelation on the religious habit. Therefore, the traditional form of the religious habit is a symbol of the consecration to Christ only from use. It follows with equal clarity that other forms of dress and other insignia can by use become expressive of the same consecration. Vatican .Council II stated: The religious habit, as a symbol of consecration, is to be simple and modest, poor yet becoming, and also in keeping with the demands of health and adapted to the circumstances of time and place and to the requirements of the apostolate. The habit of both men and women that does not conform to these norms is to be changed. The council has thus pointed out the obvious fact that the dress of religious men is not exempt from the necessity of adaptation. This very evident fact has often been disregarded in discussions on the religious habit. The council has also given general norms for decisions on the necessity and type of adaptation. There has been constant discussion on the religious habit but it may not be amiss to emphasize again that the retention of the dress and externals of past ages, by religious men or women, can project more of an image of quaintness and even eccentricity and strangeness than of consecration to Christ (Cf. K~wEw for R~i.iGiotJs, 18 [1959], 345; 14 [1955], 315). Dowry ÷ The dowry should ordinarily be actually given before ÷ first profession, since the institute is obliged by canon 549 to invest the dowry after the first profession. How- l'rvxt~e ever, in some recent approvals of constitutions, the Holy See Sacred Congregation of Religious has added that the dowry may be paid in parts, that is, in installments, and without limiting the time within which the installments VOLUME 25, 1966 595 ÷ ÷ ]oseph F. Galgen, REVIEW FOR RELIGIOUS were to be completed. The pertinent sentences in two sets of constitutions read: The Superior General, with the consent of her Council, may permit for just reasons that the dowry be paid to the Congregation by the family of the postulant in ~nstallments at determined times, o~ even after the death of the parents, proyided that meanwhile the interest is paid.--The dowry must be turned over to the Congregation before the taking of the habit, "or at least its payment must be assured by an act in ~due form valid in civil law, and in this case it shall be paid not later than the first profession. However, the prioress general with the deliberauve vote of her council may grant permission to the aspirant to pay the dowry in installments or after the death of her parents. (And see I~EVIlZW FOR RELIGIOUS) The modern practice of the Holy See in approving con* stitutions is to leave the determination of the amount of the dowry to the general chapter, which can change the amoun~t for different times and also impose a different amount for various countries. The chapter may also delegate the m6ther general with the advice or consent of her council to change the amount when this is judged necessary or advisable, and such a delegation is found in some constitutions. One set of constitutions approved by the Sacred Congregation for the Propagation of the Faith in 1964 reads: "Let the aspirants bring the dowry determined in the Provincial Chapter and approved by the Superior General and her Council." The Sacred Congregation of Religious permitted one congregation to abrogate the dowry completely. The rea-sons of this congregation were: a) The amount of money concerned is insignificant; b) in certain countries, the fact of asking for a dowry is not under-stood and very unfavorably interpreted; c) in a few countries, tl~e candidates cannot even pay that small contribution; in other countries, exceptions are not rare, and in these cases, the Province has to make up the amount of the dowry; d) the dowry constitutes a dead capital; e) the sum of money that the parents spend for the education of their daughters constitutes in itself a dowry. " The Holy See has frequently approved constitutions that contain an article of the following type: The higher superior [or mother general or mother provin-cial] with the consent [advice] of her council may remit in whole or in part the dowry of those who lack financial means but possess academic degrees, teachers' or nurses' certificates, or special abilities which can compensate for the dowry and make them especially useful to the congregation. The admissible equivalent for the dowry in such cases is much more widely expressed in many constitutions recently approved by the Holy See. These give the power of remitting the dowry in whole or in part: According to the rules established by the General Chapter --because they lack the means or because of other special reasons--of a candidate who lacks financial means or because of special reasons--those who are unable to furnish it--for just reasons--if the applicant .has an education which, ac-cording to the judgment of the superior general and her council, is useful for the congregation. Finally, one set of constitutions approved in 1964 states simply: "The Superior General with the deliberative vote' of her council can remit, in whole or in part, the dowry of a postulant." Admission of Candidates Recently approved constitutions frequently contain this article: "Only the Holy See or those who have received the faculty from it can dispense from the im-pediments listed in articles . " These are the diriment and merely prohibiting impediment~ of common law to entrance into the noviceship (hat are enacted in canon 542. Bishops and the superiors general of pontifical clerical institutes flow possess the faculty of dispensing from the diriment impediment of canon 542, 10: "Those who have renounced the Catholic faith and joined a non- Catholic sect." Because of this recently granted faculty, a clause has been added to the article of the constitutions on d!spensing fromthe impediments of common law, that is, "or who have received the faculty from it . " Profession and Canonical Examination The canonical examination commanded by canon 552 is proper to religious women and is made by the local ordinary or a priest delegated by him at least thirty days before entrance into the novices.hip, first religious profes-sion, whether temporary or perpetual by privilege, and the final perpetual profession, whether solemn or simple. A congregation of sisters was granted the following indult by the Holy See in 1963: "If necessary, and as an excep-tion, the sisters may take the canonical examination for perpetual vows a few days before the beginning of the retreat." By the law of their constitutions, these sisters make an eight-day retreat before perpetual profession. Anticipated Renewal of Temporary Pro[ession The same sisters have six years of temporary vows divided into three annual and one three-year professions. Accordin~ to the norms of canon law, temporary profes-sions are to be renewed on the anniversary day (August 15, 1965-August 15, 1966) and their renewal may not be anticipated by .more than a month (July 15, 1966). The revised constitutions of this pontifical congregation, ap-proved in 1962, read: 4- 4- Pro~t~e o] Holy See VOLUME 25, 1966 ,597 ÷ ÷ ÷ ]oseph F. Gallen, SJ. REVIEW FOR RELIGIOUS According to an indult of the Holy See the sisters, regard-less of the date of their first profession, renew their temporary profession on the feast of the Epiphany, January 6. It is not permissible to postpone the renewal of profession beyond the day of expiration of the vows. Anticipation of Perpetuai Profession Canon 577, § 2 grants the permission to anticipate the renewal of a temporary profession, but this does not include permission to anticipate perpetual profession nor to abbreviate the time of temporary vows established either by the Code of Canon Law or the particular con-stitutions (R~vmw for RELIGIOUS, 12 [1953], 262--3; 16 [1957], 379-80; Questions on Religious Life, q. 43). The same revised constitutions, however, contain the follow-ing faculty: By virtue of a special induh of the Holy See the superior general can, for just reasons, permit the taking of perpetual v.ows up to thirty days before the legitimate date; this profes-sxon, however, becomes effective only on the sixth anniversary of the first profession; and anticipation for a greater length of time., can take place only with the special permission of the Holy See. Poverty and Civil Will Apparently in an effort to bury the "envelope" system or to prevent its inception or resurgence, a congregation has included the following norm in its constitutions: "No sister may deposit a sum of money, be it great or small, under her own name in the bursar's safe." Since the pradtice of the Sacred Congregation of Religious re-quires that the will commanded by canon 569, § 3 be civilly valid, some congregations are expressing the article on the will substantially in the following form, which is taken from a recently revised set of constitutions: Before profession each novice shall freely dispose by will of all the property she possesses or which may accrue to her. She shall observe, as far as possible, what the civil law requires for the validity of the will; and, if prior ~to her profession she does not yet have the capacity of making a will, she shall make one as soon as possible after profession. (And see REview roa RrL~c~oos, 20 [1961], 222-24.) . Renunciation o] Patrimony An article of the revised constitutions of a congrega-tion of sisters, approved in i961, reads as follows: If there be question of giving away her patrimony or any notable part of it, that is, about one-third, the permission of the Holy See is required. For any amount less thafi one-third of the total, the permission of the superior general is suffi, cient . The permission of the Holy See is also required in case a notable.part of the patrimony of a religious is donated to the Congregation. (And see REv~.w fOR R~L~cxOUS, 12 [1953], 258-9; "16 [1957], ~I1, 21 [1962], 410.) The apostolic delegate has recently received the follow-ing faculty: "to allow a "donatio inter vivos' (e.g. as in the ¯ case of Sisters who wish to donate from their patrimony to the community or their parents)." Vatican Council II has enacted the following: "The constitutions of reli-gious congregations may permit that the members renounce their patrimonial property, whether already acquired or to be acquired in the future." Obedience Several more recently approved constitutions contain the following articles: In virtue of this vow the sisters are obliged to obey under pain of serious sin only when the lawful superior expressly commands anything in virtue of holy obedience in conformity with the Rule and the Constitutions. -- This obligation be-comes grave when the Superior commands in virtue of the vow, in the name of Jesus Christ, in the name. of holy obedience, or with similar expressions. -- This obligation binds under pain of serious sin only when the legitimate Superior expressly commands "in virtue of holy obedience" or ".under formal precept" or by any other equivalent expression. -- The Sisters are bound to obey in virtue of the vow of Obedience whenever a lawful Superior gives an order dealing directly or indirectly with the observance of the Rule and Constitutions: This obligation becomes grave when a Superior ives a formal command in virtue of holy Obedience. -- Bygthe Vow of Obedience the Sisters assume the obligation of obeying all commands of their lawful Superiors in everything that con-cerns, directly or indirectly, the observance of the vows, the Rule, and the Constitutions. A formal precept, which obliges under pain of mortal sin, is given only when the lawful Superiors command expressly in virtue of holy Obedience. Not all constitutions approved by the Sacred Congrega-tion of Religious, even at the same period of time as the above, contain the new wording; nor did I find it in the constitutions recently approved by the Sacred Congrega-tion for the Propagation of the Faith that I have read. The new wording, in congregations that have it, more clearly permits a precept under venial sin to be given by reason of the vow of obedience. Such a power is obviously to be most rarely used. To effect a precept under venial sin, the superior must give a precept that obliges im-mediately under sin, even though he is not required to state that it is in virtue of the vow of obedience. The reason is that the proximate matter of the vow of obedience, that which brings the obligation of the vow into actual existence, demands at least the strict command of a lawful superior. A strict command is the express imposition of an obligation immediately in conscience, immediately under sin, to do something, to omit some-thing, or to fulfill a punishment. The superior must manifest clearly the intention of obliging in conscience, e.g., "I command, order, forbid you in conscience." A VOLUME 25, 1966 599 ÷ Joseph F. G~en, S4. REVIEW FOR RELIGIOUS strict command is not the mere good pleasure of a superior (It would please), a desire (I would like), a counsel (It would be better), an admonition (Do not do that), or a merely penal precept, that is, a precept obliging only under a punishment for its violation. The superior may oblige under mortal or venial sin in serious matter but only under venial sin in light matter, since such matter does not admit a grave obligation. See Raus, De sacra obedientia, Lyons: Vitte, 1923, nn. 109-11; Ver-meersch, De religiosis institutis et personis, I, ed. 2, Bruges: Beyaert, n. 296; REv~.w for RELIO~OUS, 22 (1963), 586-7. One congregation added the following sentence to its constitutions: In keeping with the ~,irtue, the sisters should be encouraged to discuss with their superiors ideas which they think would contribute to the common good of the institute or further its apostolic work. Such an article obviously does not diminish the authority of the religious superior. Vatican Council II was not lessening the authority of bishops in counseling them: Wherefore, for the sake of greater service to souls, let the bishops call the priests into dialogue, especially about pastoral matters. This they should do not only on a given occasion hut at regularly fixed intervals insofar as this is possible. The council affirmed the same principle with regard to religious superiors: "Superiors should in a suitable manner consult and listen to subjects in matters that con-cern the entire institute." Another statement of the council explicitly safeguards the authority of superiors: Superiors should therefore gladly listen to their subjects and encourage their cooperation for the good of the institute and of the Church, but the authority of superiors to decide and order what is to be done remains undiminished. Penance More recent constitutions have frequently phrased the article on the frequency of confession: "The sisters will usually go to confession at least once a week." The norm in one set of revised constitutions approved by the Sacred Congregation for the Propagation of the Faith in 1964 is: "The Sisters will go to confession every week or at least every fortnight . " REVIEW FOR RELIGIOUS, 18 (1959), 161; 16 (1957), 116-7; Questions on Religious Life, q. 90. Divine 01~ce and Spiritual Reading Several congregations of sisters have obtained approval from the Sacred Congregation of Religious of a change to Lauds, Vespers, and Compline of the Divine Office from the recitation of the Little Office of the Blessed Virgin Mary. One has Lauds, Sext, Vespers and Compline, another Lauds, Terce or Sext, Vespers 'and Compline of the Divine Office. REwv.w FOR RwLIG~OUS, 24 (1965), 473- 4; 20 (1961), 304-6. On July 27, 1964, the Sacred Congregation of Religious approved a revised article of a congregation according to which the sisters make each day, if possible, and without strict obligation, a short spiritual reading. Once a week all must make a longer spiritual reading in the course of their weekly free half day. A similar article approved in May, 1964 reads: Every day: a part of the Office of the Blessed Virgin for morning and evening prayer, a half hour of mental prayer, holy Mass, spiritual reading, visit to the Blessed Sacrament, particu-lar and general examination of conscience, recitation of ofie third of the rosary. This article does not determine the length of the daily spiritual reading. Another congregation of sisters had fifteen minutes of spiritual reading and another half hour of mental prayer in the afternoon. This was changed by the congregation to the following: ". the sisters shall make a private spiritual reading which will be continued in prayer according to the needs of each. The spiritual reading and prayer shall in all be for an hour." Chapter of Faults One congregation omitted this chapter in its revision as proposed, and the revision as approved contained no correction on this point. Another congregation asked that the frequency of the chapter be reduced from once a week to once a month. The Holy See replied that it was to be held twice a month. Another recently approved set of pontifical constitutions reads as follows: Four times a year, preferably during the Ember Weeks, the local Superior shall hold a chapter of affairs with the members of her Community. At this chapter she shall give public ex-hortations which will help improve the spirit of the house and eliminate abuses which may have crept in; she shall discuss matters of discipline and of the apostolate with all the Sisters of the house; she shall recommend to the prayers of the Sisters the requests of petitioners and the welfare of benefactors. At this chapter, if any Sister should wish to confess an ex-ternal fault against the Rule, Constitutions, and Customs, she may do so. The Superior shall impose a moderate and discreet penance. Separate chapters shall be held for Sisters in the Juniorate and the Novitiate. Cloister: Associated Topics Companion. The Holy See continues to approve con-stitutions stating that sisters are ordinarily not to go out 4. 4, 4- Holy See VOLUME 25, 1966 601 ÷ ÷ ÷ ]oseph F. Gallen, ~, SJ. REVIEW FOR RELIGIOUS go~ without a companion. The Sacred Congregation of Reli-gious approved also the following two forms of the same article: Sisters are permitted to make visits and to leave the house without a companion when, in the judgment of the superior, there is a just cause for doing so. -- No Sister shall go out without the permission of her Superior, who should if possible send~a Sister or some trustworthy person as her companion. The 'Sacred Congregation for the Propagation of the Eaith approved a wide form of the same article: "Particu-lar circumstances or the customs of a country may require that the Superior assign a companion to the Sister who goes out." Going out at night. One set of constitutions approved by' the Holy See in 1964 enacts: "With permission of the higher superior, the sisters may attend evening meetings and programs of a religious, professional, or educational nature." Excessive remoteness from seculars. The excessive remoteness from conversation and contact with seculars inculcated in many constitutions and customs was the reason that motivated one congregation to request that the italicized words in the following article be deleted. The request was approved by the Sacred Congregation. Finally, in order to observe chastity more perfectly, they shall keep the rules of modesty and enclosure exactly, shun familiarities, abstain from conversation with seculars as much as possible, and frequently pray to God that their hearts, being filled with divine grace, may be kept pure and pleasing unto Him. ' A liberalizing,o[ the following type of custom is evi-dently in accord with reasonable norms of adaptation: The Sisteis are permitted to eat with others when this seems feasible. Sisters from other religious communities may b~ invited to eat within the enclosure. -- If refreshments are offered to visitors, the Sisters shall not eat or drink with them. Mee(ing o[ Discalced Carmelites The superior general of the Dis~alced Carmelites made the following petition to the Sacred Congregation of Reli-gious: Many Monasteries of Discalced Carmelite Nuns in the United States have mani[ested the desire o[ an Assembly o[ Prioresses, which would afford them the opportunity of an ex-change of ideas on the more urgent and actual problems of cloistered, Teresian life, especially what refers to the forma-tion of young Religious. In consideration of which and in compliance with the common desire of having the Superiors of the Order to direct the undertaking, the said Superior General requests: 1. authorization for all the Superioresses of the Monasteries of Discalced Carmelite Nuns in the United States to attend the proposed Assembly with a companion, provided such an attendance be freely accepted; 2. authorization for the Superior General to preside over the Assembly personally or by means of a Delegate. The Sacred Congregation replied: In virtue of the faculties granted by His Holiness, the Sacred Congregation for Religious, taking the above into account, benignly grants the favors as requested, provided the Local Ordinaries to whom it pertains have no objection and n. 23 of the "Inter Cetera" is to be observed. The Nuns are to observe the law of enclosure in the place, where they assemble, in as far as possible. Afterwards a report of the proceedings is to be sent to the Sacred Congregation for Reli-gious. Junior Pro[essed The ~ollowing article is pertinent to the frequent dis-cussion on an excessive separation of the junior professed: The junior professed Sisters are under the supervision of a Mistress in a separate section of the house. They are not, how-ever, to be totally segregated from the senior professed Sisters. Indults o[ Secularization The Sacred Congregation of Religious has, in some cases, replied to a petition for dispensation from the vows that an induh of secularization was not expedient, and has substituted an induh of exclaustration, e.g., for one or two years. See REVIEW FOR RELIGIOUS, 24 (1965), 475-6. The wording in the latest indults of secularization is the following: "This rescript has no validity if not accepted by the petitioner within ten days from receiving communication of it." And see REWEW VOR REL~GIOt~S, 15 (1956), 231--3. Charitable Subsidy The Sacred Congregation of Religious, is wont to cor-rect the wording on the competent local ordinary in the article on the charitable subsidy to the following: If any professed sister who leaves or is dismissed was received without a dowry or with an insufficient dowry and cannot provide for herself out of her own resources, the congregation is obliged in charity tO give her what is necessary to return safely and becomingly to her home, and to provide her, accord-ing to natural equity, for a certain period with the means of a respectable livelihood. This is to be determined by mutual consent, or in the case of disagreement, by the local ordinary o[ the [ormer religious (cc. 643, § 2; 647, § 2, 5°; 652, § 3). In a congregation that does not impose a dowry, the beginning of this article reads: "If any professed sister who leaves or is dismissed can-not provide for herself out of her own resources, the ÷ Prtwtice of Holy See VOLUME 25, 1966 603 4, 4- Joseph F. Gal/en, $.1. REVIEW FOR RELIGIOUS 6O4 congregation . " See REVIEW FOR RELIGIOUSi 15 (1956), 253-6. General Chapter Substitutes [or ex officio members of a chapter. While constitutions frequently, especially if more recently ap-proved, prescribe substitutes for the provincial at the general chapter and for the superior of larger houses at the general or provincial chapter, it is not the practice to enact substitutes for other ex officio members, e.g., for a general or' provincial councilor at a general or provin-cial chapter. Such substitution has been approved in one or two constitutions, e.g.: The superior general with the consent of her council shall provide a substitute for an ex officio member other than a general councilor who may be legitimately prevented from attending the general chapter. If there be question of a general councilor, the general council elects her substitute. -- If it should be necessary to replace an ex officio member legitimately prevented from taking part in the[provincial. ].chapter, the provincial superior shall provide a subsutute, w~th the con-sent of her council and the approval of the superior general with the advice of her council. The following article was proposed to the Sacred Con-gregation of Religious in 1965. The Sacred Congregation deleted the part in italics. Should a provincial superior be unable to attend the general chapter her place shall be taken by the first provincial councilor. In the case of any other ex officio member of the general chapter the substitute shall be chosen by the superior general with the consent ol her council. Ex officio membership [or regional superiors. Several congregations have given regional superiors ex officio membership in the general chapter, which to me is an evidently sound and prudent policy (See REvmw fOR RELIGXOUS, 21 [1962], 414). Delegates for six years. One congregation elects its delegates as follows: The delegates are elected for six years, that is, until the next regular meeting of the general chapter for elections. Once elected they remain as delegates for any chapter which may be convoked before the next regular meeting of the general chapter. Number o[ elected delegates. A few congregations foI-low the principle, of equality in number for their provin-cial or general chapter, e.g.: "There shall be as many delegates as there are members who attend the [General] Chapter by right of office." Another congregation has a similar norm: "The number of delegates to the Provin-cial Chapter will be at least one more than the number of members by right." In another revision approved in 1964 there are five elected delegates from each province: The number of delegates to be elected to the General Chapter is two Superiors and three non-Superiors from each province, or in the case of a Vice-Provincial Chapter, one Superior and two non-Superiors from each vice-province. One large congregation Of sisters has an unusual norm for the number of delegates from each province. The provincial chapter is composed of the provincial superior, councilors, secretary, and treasurer and, roughly, one delegate, superior or subject, for every fifty sisters of perpetual vows in the province but, in houses of less than fifty sisters of perpetual vows, one. delegate for every fifty to seventy sisters of perpetual vows. The provincial chapter then elects delegates according to the following norm of a revision approved in 1964: The Provincial Chapter when meeting for electing delegates to the General Chapter, shall elect by relative majority of votes one-third of its number as delegates and two substitute delegates. The Provincial Superior who is an ex officio delegate is not included in this number. The delegates from the provinces and vice-provinces in another change of constitutions approved in 1964 are: 6. Two delegates from each Province and one delegate from each Vice Province. 7. One added delegate for 200 Sisters and fraction of 200 for those Provinces having more than 300 Sisters. 8. Of the principal Superior of the Motherhouse
Technical Report 2018-08-ECE-137 Technical Report 2002-09-ECE-006 Engineering of Enterprises a Transdisciplinary Activity Murat M. Tanik Ozgur Aktunc John Tanik This technical report is a reissue of a technical report issued September 2002 Department of Electrical and Computer Engineering University of Alabama at Birmingham August 2018 Technkal Report 2002-09-ECE-006 Engineering of Enter·prises A Transdisciplim•ry Activity Murat M. Tanik Ozgur Aktunc John Tanik TECHNICAL REPORT Department of Electrical and Computer Engineering University of Alabama at Birmingham September 2002 ENGINEERING OF ENTERPRISES A TRANSDISCIPLINARY ACTIVITY OVERVIEW Contributed by: Murat M. Tanik, Ozgur Aktunc, and John U. Tanik This module is composed of two parts: Part I surveys and defines Enterprise Engineering in the context of transdiscipline. Part II introduces Internet Enterprise and addresses engineering implementation consider ations. PART I ENTERPRISE ENGINEERING ESSENTIALS 1 INTRODUCTION When Henry Ford rolJed out his first automobile assembly during 1913, he created the archetype of single-discipline enterprise. Ford's adventure was a self-contained and efficient exercise in mechankal engineering. With no competition, no regulatory constraints, and no pressing need for cross-disciplinary partnerships, from design development to process development, all ideas primarily originated from Ford's own engineers. The world is a different place today. Automobiles are complicated hybrids of mechanical, electrical, electronic, chemicaJ, and software components. Modern 4 manufacturers must now pay dose attention to new technological developments in hardware (mechanisms associated with physical world), software (mechanisms associated with computational world), netware (mechanisms associated with communications), and peopleware (mechanisms associated with human element). The changes experienced in the automotive industry exemplify the needs of the ever increasingly complex nature of today's modern enterprise. In other words, the ubiqui tous existence of the ";computing element" forces us to take into account disciplinary notions, ranging from psychology to ecology. In one word, the world is becoming transdisciplinary. In this world of transdisciplinary needs, we need to approach designing of enterprises as engineers, moving away from the traditional ad hoc approach of the past. This module expl ai n~ the changes to be made to current enterprise organization in order to be successful in the networked economy. A brief definition of Enterprise Engineering is given as an introduction, foJJowed by a summary of Enterprise Engineering subtopics, namely modeling, analysis, design, and implementation. In the last section of Part I, the definition of an intelJigent enterprise is made with an emphasis on knowledge management and integration using Extensible Markup Language (XML) technology [1]. 2 DEFINITION The Society for Enterprise Engineering (SEE) defined Enterprise Engineering as ";the body of knowledge, principles, and practices having to do with the analysis, design, implementation and operation of an enterprise" [2]. Enterprise Engineering methods include modeling, cost analysis, simulation, workflow analysis, and bottleneck analysis. 5 In a continually changing and unpredictable competitive environment, the Enterprise Engineer addresses a fundamental challen ge: ";How to design and improve all elements associated with the total enterprise through the use of engineering and analysis methods and tools to more effectively achieve itsgoals and objectives" [3]. Enterpr.ise Engineering has been considered as a disdpline after its establishment in the last decade of the 20th Century. The discipline has a wor]dvicw that is substantial enough to be divided into sub-areas, with a foundation resting on several reference disciplines. In the Enterprise Engineering worldview, the enterprise is viewed as a complex system of processes that can be engineered to accompli sh specific organizational objectives. Enterprise Engineering has used several reference disciplines to develop its methods, technologies, and theories. These reference disciplines can be listed as the following: Industrial Engineering, Systems Engineering, Information Systems, Information Technology, Business Process Reengineeling, Organizational Design, and Human Systems [2]. 2.1 Understanding Enterprise Engineering Like most engineering profession als, Enterprise Engineers work on four main areas: modeling, analyzing, design, and implementation. One important issue facing Enterprise Engi neering is the development of tools and techniques to support the work of analyzing, designing, and imp1ementjng organizational systems. These tools must assist enterprise engineers in the initial transformation of functional, often disjoint, operations into a set of integrated business processes replete with supporting information and control systems [4]. To develop new models of enterprises, the enterprise should be analyzed 6 using process analysis, simulation, activity-based analysis, and other tools. Also an abstract representation of the enterprise and the processes should be modeled in a graphical, textual, or a mathematical representation. The . design issues in Enterprise Engineering consist of developing vision and strategy, integration and improvement of the enterprise, and developing technology solutions. Lastly, implementation deals with the transformation of the entetprise, integration of corporate culture, strategic goals, enterprise processes, and technology. We will take a look at these areas in the fol1owing section: • Enterprise Engineering Modeling (EEM), • Analyzing Enterprises, • Design of Enterprises, and • Implementation. 2.2 Enterprise Engineering Modeling Enterprise Engineering Modeling (EEM) is basically dealing with the abstraction of engineering aspects of enterprises and connecting them to other business systems. The model encompasses engineering organizations' products, processes, projects, and, ultimately, the ";engineered assets" to be operated and managed. EEM coordinates design and deployment of products and assets at the enterprise level. It integrates engineering information across many disciplines, allows engineering and business data to be shared through the combinatjon of enterprise IT (information technology) and engineering IT, and simulates the behavior of intelligent, componentbased models [5). 7 The selection and design of enterprise processes for effective cooperation is a prime objective of Enterprise Engineering. Enterprise models can assist the goal of Enterprise Engineering by helping to represent and analyze the structure of activities and their interactions. Models eliminate the irrelevant details and enable focusing on one or more aspects at a time. Effective models also facilitate the discussions among different stakeholders in the enterprise, helping them to reach agreement on the key fundamentals and to work toward common goals. Also it can be a basis for other models and for different information systems that support the enterprise and the business. The enterprise model will differ according to the perspective of the pers.on creating the model, including the visions of the enterprise, its efficiency, and other various elements. The importance of an enterprise model is that it wm provide a simplified view of the business structure that will act as a basis for communication, improvements, or innovations and define the Information Systems requirements that are \ necessary to support the business. The term business in this context is used as a broad term. The businesses or the activities that can be represented with Enterprise Engineering models do not have to be profit making. For example, it can be a research environment with the properties of an enterprise. Any type of ongoing operation that has or uses resomces and has one or more goals, with positive or negative cash flow, can be referred to as a business [6]. The ideal business model would be a single diagram representing all aspects of a business. However this is impossible for most of businesses. The business processes are so complex that one diagram cannot capture all the information. Instead, a business model is composed of different views, diagrams, objects, and processes: A business 8 model is illustrated with a number of different views, and each captu~cs infmmation about one or more specific aspects of the businesses. Each view consists of a number of diagrams, each of which shows a specific part of the business structure. A diagram can show a ~1ructure (e.g., the organization of the business) or some dynamic collaboration (a number of objects and their interaction to demonstrate a process). Concepts are related in the diagrams through the use of different objects and processes. The objects may be physical such as people, machines, and products or more abstract such as instructions and services. Processes are the functions in the business that consume, refine, or use objects to affect or produce other objects. There are cunently hundreds of modeling tools for enterprises, and many modeling techniques such as Integrated Definition Language (IDEF), Petri-Net, Unified Mode1ing Language (UML), and meta-modeling. Modeling involves a modeling language and the associated modeling tools. Different enterprises may need different modeling tools according to the nature of the enterprise. Before selecting the modeling tool, a detailed analysis should be made to select the most appropriate modeling language and the tool. For the software industry, UML has become the standard modeJjng language [7]. 2.3 Enterprise Analysis The increasing complexity of enterprises has stimulated the development of sophisticated methods and tools for modeling and analysis of today's modern enterprises. Recent advances in information teclu1ology along with significant progress in analytical and computational techniques have facilitated the use of such methods in industry. 9 Applying Enterprise Analysis methods results in a documentation that supports a number of programs, which are as follows: strategic information resource planning, information architecture, technology and services acquisition, systems design and development, and functional process redesign. Most organizations have a wealth of data that can be used to answer the basic questions supporting strategic planning: who, what, where, and bow much. By modeling with these data using an Enterprise Analysis toolset, the enterptise models can be built incrementally and in less time. The most important use of Enterprise Analysis is that it presents the organization's own business, demographic, and workload data in a compelling manner to tell the story. Whether they are used to support programs for acquisitions, information architectures, or systems development, Enterprise Analysis studies are rooted in the business of the organization and thus are easily understood and supported by executive management. 2.4 Enterprise Design The design of an enterprise deaJs with many issues, including development of a vision and a strategy, the establishment of a corporate cu.lture and identity, integration and improvement of the enterprise, and development of technology solutions. Optimization of several perspectives within an enterprise is the objective of Enterprise Design. Examples of enterprise perspectives include quality, cost, efficiency, and agility ,. and management perspectives s uch as motivation, culture, and incentives. For example, consider the efficiency perspective. The modeling task will provide ontologies (i.e., object libraries) that can be used to construct a model of the activities of a process, such as its resource usages, constraints, and time. Based on these models the efficiency 10 perspective will provide tools to design, analyze, and evaluate organizational activities, processes, and structures. These tools will also be capable to represent and model the current status of an enterprise and to analyze and assess potential changes. One issue is wbetber there exists sufficient knowledge of the process of designing and optimizing business activities/processes to incorporate in knowledge-based tools. The main goal of an Enterprise Design application is to deveJ~p a software tool that enables a manager to explore alternative Enterprise Designs that encompass both the stmcture and behavior of the enterprise over extended periods of time. lssues such as motivation, culture, and incentives are explored, along with other relevant parameters such as organizational structure, functions, activity, cost, quality, and information [8]. 3 STRATEGY FORMULATION FORE-BUSINESS Electronic commerce is becoming a growing part of industry and commerce. The speed of technological change is enabling corporations large and small to transact business in a variety of ways. Today, it is routine practice to transact some aspect of business electronically from e-mail to exchanging data via Electronic Data Interchange (EDI), World Wide Web (WWW), and various shades these technologies. Numerous benefits accrue to corporations when they use automated capabilities. In order to maximize such benefits, electronic enterprises must base their efforts on welJdeveloped strategies. In this manner, tbe probability of success is increased many folds. Embarking on electronic commerce or business should never be thought of as the sole quest of the information systems department. The following strategies are a synthesis of II best practices introduced to assist information systems departments to prepare the organization for the information age [9, 1 0]. 3.1 Strategy 1 - Improve Corporate System DeveJopment Skms In addition to developing technical skills, corporations must pay close attention to effective communication, eliminating cross-functional language barriers, and improving inadequate facilities in geographically dispersed systems. 3.2 Strategy 2 -Build a Proactive Infrastructure There must be a constant effort to keep up with technological changes. Frequently, these changes trickle down from the top as a result of various business strategies. For example, top managers may discover that they need video-conferencing capability, and the information technology people are under pressure to deliver it. This kind of approach will put the chief information officer(CIO) in a reactive posture, trying to put out fires as they appear. In putting out such fires, local resources may be used to satisfy higher level needs without any obvious benefits to local managers who may resent this fact and create barriers against success. CIOs should try to get the cooperation of all users in anticipating system needs. If users are not satisfied with an imposed system, they wiiJ try to build their bootleg systems for their own needs. Thus, project needs should be anticipated as far as possible and should be planned to meet both short-term goals of management and yield benefits for the development of the infrastmcture of the corporation in the Jong term. 12 3.3 Strategy 3 - Consolidate Data Centers A corporation embar1dng on developing an e-business system must realize that there do already exist semiautonomous data centers distributed throughout various geographical locations. There may have been a time when such data centers were desirable. Today, e-business demands integrated information systems, and the data centers must be consolidated. An integrated information system is far more effic ient in controlling corporate operations. Obviously, operating fewer facilities, maintaining minimum levels of inventory, and giving better service to customers will bring handsome returns to corporations. During the consolidation process, a number of problems of compatibility and standardization will occm, but tackling such problems is better than having semiautonomous data centers. 3.4 Strategy 4 - Standardize Data Structures As corporations grow, different data processing systems and data centers proliferate, especiaUy in transnational corporations. Consolidating data centers and systems as suggested in strategy 3 may not be sufficient. Corporations need to determine data needed at global levels and standarclize them. Standardization may not be possible for certain applications in an international setting since regulatory accounting of different countries may be a roadblock. However, this should not be taken as a signal for nonstandardization. Standardization will make useful information available throughout the corporation. For example, these days many corporations are adapting XML as part of data stmcture consolidation strategy. XML issues are addressed in the next section with more detail. 13 3.5 Strategy 5 - Accommodate Linkages with Cui-rent Strategic Allies and Provide Expansion for Future Str ategic Alliances Recent developments in globalization and Internet technology are spurring corporations to form sliategic alliances. Automobile manufacturers are, for example, forming alliances to influence prices and qualities of their raw materials and parts purchases. Similar alliances are growing at an accelerated pace in other industries. These alliances are designed to create not only purchasing power but also a variety of other mutual interests, from technological co-operation to joint production. 3.6 Strategy 6 - Globalize Human Resource Accounting As companies centralize their information systems through computerization, a global inventory of human skills should be developed. Frequent human resource problems arjse when Information Systems (IS) personnel focus locally rather than globally. Recmiting of specialists, for example, must be done not with a local perspective but with a global one. This will help eliminate possible redundancies with potential savings. 4 INTELLIGENT ENTERPRISES Enterprises competing in global markets assume complex organizational forms such as supply chain, virtual enterprise, Web-based enterprise, production network, e-business, and e manufacturing. Common traits of these organizations are willingness to cooperate, global distributed product development and manufacturing, and high coordination and communication. These traits have led the trend of transformation from 14 capital intensive to intelligence intensive entetprises [1 1]. Visions of the organization's future e-Business roles as an intelligent enterprise could be formulated as follows [12]: • Transparent - Intelligent enterprises will contain substantial amounts of information on capabilities, capacities, inventories, and plans that can be exchanged between tools, servers, and optimizing agents that will augment capabilities of their human masters. • Timely - Intelligent enterprises will be designed to meet a customer need exactly when the customer wants it. • Tuned - Through collaboration and sharing of knowledge, the intel1igent enterprise wiJl serve customer needs with a mjnimum of wasted effort or assets. 4.1 Knowledge Management and Integration with XML One important challenge for enterprises today is storing and reusing knowledge. For many organizations, up-to-dale knowledge of what is relevant and important to customers distinguishes their offerings. The challenge is to assimilate this rapidly changing knowledge about products and services quickly and distribute it rapidly to leverage it for improved performance and quality service. This means finding all knowledge that is embedded in and accessed through technologies and processes and stored in documents and external repositories and being able to share it quickly with the customers. The capital-based organization needs to transform into bigh-perforrn.ing, processbased, knowledge-based enterprises, characterized by agility, f lexibility, adaptability, and willingness to learn. To overcome the difficulties during the transformation, powetful tools are needed to manage the knowledge within the enterprise and to develop the 15 communication between the company and the customers. The key tool to be used within this process is XML, which will set the standards of communication and wm help to manage the knowledge [13]. To understand how XML will help us managing the knowledge, a def111ition of a knowledge-based business is needed. 4.2 Knowledge-Based Businesses The following six characteristics of knowledge-based business were defined in Davis and Botkin [14]. ~hese characteristics are actually guidelines for businesses to put their information to productive use. 4.2.1 The More You Use Knowledge-Based Offerings, The Smarter They Get This characteristic fits in the customer-defined offerings the companies give. For example, a credit card company can build a system that could understand the buying patterns of a customer that can protect the customer from fraud. A news agency can change the interface of its system to give the type of news that a newspaper or journal requests. Knowledge-based systems not only get smcuter but also enable their users to learn. For example, General Motors' computer-aided maintenance system not only helps novice mechanics to repair automobiles but also helps expe1t mechanics to refine their knowledge. As the technology advances, the amount of information that a mechanic needs to know expands rapidly. With tllis system a mechanic can leverage the knowledge of all mechanics using the system. As a result, the system continually improves, as does the service quality. 16 4.2.2 Knowledge-Based Products And Services Adjust To Changing Circumstances When knowledge is built into a product, the product may adjust itself in a smart manner to changing conditions. For example, a glass window that may reflect or transmit sunlight according to temperature is such a product. Producing tbese producl:s will not only be marketed well but also have important economical advantages. Tbe smart pr~ducts will guide their users as well. 4.2.3 Knowledge-Based Businesses Can Customize l1teir Offerings Knowledge-based products and servkes can determine customers' changing paltems, idiosyncrasies, and specific needs. For example, a smart telephony system can understand which language will be used on specific num bers~ also by using the voice recognition system, the need for telephone credit cards can be diminished. 4.2.4 Knowledge-Based Products A11d Services Have Relatively Short Life Cycles Many knowledge-based products have short life cycles, because they depend on the existing market conditions; their viability is short-lived. For example, the foreign exchange advisory services offered by a commercial bank are highly specialized and customized for corporate clients. Such services should be constantly upgraded to keep the profits and the proprietary edge. 4.2.5 Knowledge-Based Businesses Enable Customers To Act In Real Time Information becomes more valuable when it can be acted on constantly. A system that will deliver the tour book information while you are driving the car will have a great 17 value. An interactivity. added to the system will make the product's value even higher. Knowledge-based products can also act in real time. For example, a copier machine that calJs the maintenance provider when an error occurs wiJJ have a great value in this sense. 4.3 XML's Role in Business Applications The smallest cluster of knowledge is data. These are basic building blocks of information that come in four particular forms: numbers, words, sounds, and images. Manipulation of the data determines its value. The arrangement of data into meaningful patterns is information. For example, numbers can be arranged in tables, which is information; a series of sounds, which is music, can also be considered as information. Today, an important challenge for Internet-based businesses is using the information efficiently and in a productive way that will upgrade the information to knowledge. Thus, we say that knowledge is the application and productive use of information. The shift from the information to knowledge age will be via technology. The new enabling technologies of software development such as XML, J2EE, and Visual Studio are forcing e-businesses to build knowledge-based businesses. Here we will explain the most important enabling technology, XML, within the development of e~businesses. XML can be used effecti~ely for exchanging of business documents and information over the Internet. XML is a standard language that simultaneously presents content for display on the Intemet and describes the content so that other software can understand and use the data. Therefore XML can be a medium through which any business application can share documents, transactions, and workload with any other 18 business application [15]. In other words, XML can become the common language of ebusi. ness and knowledge management. One impmtant property of XML is providing .information about the meaning of the data. Thus, an XML-Jonnatted document could trigger a software application at a receiving company to launch an activity such as shipment loading. But to provide that level of data integration, trading partners would have to agree on definiti ons for the various types of documents as well as standard ways of doing business. In addition to facilitating e-commerce, having common defini tions and uses for data also enable an enterprise to better leverage the .knowledge ctmenrly stored in information silos. XML supports the searching and browsing of such information sHos [16]. It structures documents for granularity, such as alJowing access to sections within documents and fine-tuning retrieval Also, it annotates documents, which enables users to not restrict themselves to what is in the document. XML organizes documents by classifying documents into groups and supports browsing them. AdditionaiJy, it has Hyper Text Markup Language (HTML)-like linking options that help the information users to find the documents they arc seeking. Fig. I shows the tools that are common in the organization of information through XML. XML is the next evolution in knowledge management, and organizations are beginning to understand the potential of this technology to develop enterprise-wide information architectures. As a technology, XML does not bring any value to an organization. The value of XML wHI depend on how it js used within a company. The agreement on data definitions within an enterprise has always been a hard task. At rn.inlmum, XML should be implemented strategically within the organization. Ideally, the 19 Annotate Documents I RDF I Schemas J:: I XML I (.---, X-Poin- ter--, Fig. 1. Organization of information through XML. implementation should include strategic partners and other organizations that have a need to share data and information. XML is a majm advance in the standardization of information sharing across traditional information boundaries, both internal and external Information security and privacy issues are major concerns revolving around customer and corporate data flowing across wires. Successful knowledge management in a company often depends on having access to information outside the enterprise walls. XML can also be of value here by helping to improve the functioning of supply chains and the extranet. In conclusion, it becomes obvious that managing knowledge requires better tools. We need to create systems that manage documents, as people would do, and we know that better tools need better documents. Thus by building on a solid knowledge management strategy using XML, we believe an organization can gain competitive differentiation in the near future. 20 PART II INTERNET ENTERPRISE IMPLEMENTATION CONSIDERATIONS 1 INTRODUCTION In the first section of this module we introduced essential elements of enterprise engineering in abstract and general terms. Building on the notions explored in the first section, we will address here, specifics concerning designing and implementation of Internet enterprises. In this section, a review is provided of the key concepts and concerns an Internet enterprise engineering (IEE) project would encounter and need to address. Business engineering fundamentals, technologies, and strategies for the lrlternet such as Unified Modeling Language, Cosmos Model, Enterprise Maturity Model, Web Business . Models, Methods of Electronic Transaction, Online Contracts, Security Protocols, selected integrated development tools, Next Generation Internet, and Internet2 arc covered. Over 20 occupational roles within IEE are identified and described separately. A technology implementation platform and strategy are introduced, along with marketing and customer retention technologies and strategies on the Internet A detailed overview is provided of the various Internet business tools, technologies, and terminology for the systematic construction of new ventures on the Internet l7]. For convenience, all these issues are summarized in table fmm at the end of this section. 2 BUSINESS ENGINEERING FUNDAMENTALS 2.1 UML: Officially introduced in November 1997, UML has quickly become the standard modeling language for software development [6]. It bas a business model approach that provides a plan for engineering an orchestrated set of business functions. It 21 provjdes a framework by which business is to be performed, allowing for changes and various improvements in the process. The model is designed to be able to anticipate changes in business function in order to maintain an edge on the competition. One of the advantages of modeling in UML is that it can visually depict functions, relationships, and paradigms. UML is a recommended tool for business analysts to break down a large-scale business operation into its constituent parts. Capturing a business model in one diagram is not realistic, so it should be noted that a business model is actually composed of a number of different views. Each view is designed to capture a separate purpose or function without losing any important overall understanding of the business operation. A view is composed of a set of diagrams, each of which shows a specific aspect of the business structure. A diagram can show a structure or a kind of dynamic collaboration. The diagrams contain objects, processes, rules, goals, and visions as defined in the business analysis. Objects contain information about mechanisms in the business, and processes are functions that use objects to affect or produce other objects. Objectoriented techniques can be used to describe a business. There are similar concepts in business functions that mn parallel to object-oriented techniques of designconceptualization. Another advantage of UML is derived from the ability of business modelers and software developers to use the same conceplualization tools and techniques to achieve a common business end. Additionally, the power of UML is derived :from its ability to transcend tbe standard organizational chart [ 17]. 22 2.2 Cosmos Model: A generic approach for a business to manage change is through a holistic framework as described by Yeh in his three-dimensional model called Cosmos (Fig. 1). One of the important aspects of this model is that three dimensions exist interdependently because each dimension behaves as an enabler and an inhibitor to the other dimensions. The ";activity structure" dimension covers how work is structured in an organization, factoring in the steps and tasks that are taken to achieve an appropriate level of workflow. The ";infrastructure dimension" covers how resources are allocated and factors in the assets of an enterprise. The ";coordination dimension" covers how information is created, shared, and distributed. The cultural aspects of the enterprise are factored in here. The Cosmos model provides a conceptual space bounded by concrete factors for successfully navigating from one point of an organizational situation to another. Infrastructure Long-term vs. short-term objectives Activity Structure Stability vs. Flexibility Target Coordination Structure Modu]arity vs. Interconnectedness Fig. l. Cosmos model--holistic framework for managing change. [13) 23 The Cosmos model is an abstract tool for managers to guide their company along the best possible path. The trade-offs between the three dimensions at each point in the journey along the path are what the manager must determine to be most effective and best for the organization as a whole. In the case of work structure, there is an inherent tradeoff between stability and flexibility. In the case of a coordination structure, there is a tradeoff between strictly aligning of human resources with company objectives and providing each operating unit with sufficient autonomy. More autonomous organizations are generally organized with a greater degree of modularity, allowing for the ability to make rapid decisions by adapting to changing market conditions. In the case of infrastlucture, there is a trade-off between seeking short-term gain versus long-term gain. Overall, the Cosmos mode] provides an executive or project manager with another technique to visualize the overaJJ situation and path of an organization by laking into account the three dimensions that correspond to the three main forces that affect its future [ 18]. 2.3 Enterprise Maturity Model: In order to characterize a business in terms of its level of maturity, focus, activity, coordination, and infrastructure, please refer to Table l, provided by Yeh [18]. The table provides an overview of the various levels of enterprise maturity. 2.4 Web Business Models: Entrepreneurs who wish to start e-businesses need to be aware of e-business models and how to implement them effectively. The combination 24 of a company's policy, operations, technology, and ideology defines its business model. Table 2 describes in more detail the types of business models in existence today [6, 19]. 2.5 IVIethods of Elech·onic Transaction: There are various methods and mechanisms that merchants can collect income through electronic transactions. Table 3 provides the types of transactions covered such as credit card, e-walJets, debit cards, digital currency, peer-to-peer, smartcards, micro-payments, and e-billing [19]. 2.6 OnJine Contracts: An online contract can be accomplished throt1gh the use of a digital signature. Digital signatures are the electronic equivalent of written signatures. The Electronic Signatures in Global and National Commerce Act of 2000 (E-sign Bi11) recently passed into law were developed for use in public-key cryptography to solve the problems of authentication and integrity. The purpose of a digital signature is for electronic authorization. The U.S. government's digital authentication standard is called the Digital Signature Algorithm. The U.S. government also recently passed digitalsignature legislation that makes digital signatures as legally bindiqg as handwritten signatures. This legislation is designed to promote more activity in e-business by legitimizing online contractual agreements. 2.7 Security Protocols: Netscape Communkations developed the SSL protocol, developed as a non-proprietary protocol commonly used to secure communication on the Internet and the Web. SSL is designed to use public-key technology and digital 25 certificates to authenticate the server. in a transaction and to protect private information as it passes from one party to another over the Tnternet. SSL can effectively protect information as it is passes through the Internet but does not necessarily protect private information once stored on the merchant's server. An example of private information would be credit card numbers. When a merchant receives credit-card information with an order, the information is often decrypted and stored on the merchant's server until the order is placed. An insecure server wi th data that are not encrypted is vulnerable to unauthorized access by a third party to that information. SET protocol was developed by Visa International and MasterCard and was designed speci.tically to protect e-commerce payment transactions [20]. SET uses digital certificates to authenticate each party in an e-commerce transaction, including the customer, merchant, and the merchant's bank. In order for SET to work, merchants must have a digital certificate and special SET software to process transactions. Additionally, customers must have complementary digital certificate and digital walJet software. A digital wallet is similar to a real wallet to the extent that it stores credit (or debit) card information for multiple cards, as well as a digital certificate verifying the cardholder's identity. Digital wallets add convenience to online shopping because customers no longer need to re-enter their credit card information at each shopping site. 2.8 Integrated Tool Example: Drumbeat 2000: Macromedia Drumbeat 2000 is a tool capable of accepting and delivering complex infmmation and functionality through a web-interface [21]. The tool aids a visually skilled Web designer in competitively building a website without necessarily having to do any coding, which is useful in the 26 initial prolotyping phase. It is a tool that can interact with the back-end database with the ability to build a user-friendly client-side using Active Server Page (ASP) Web technology. ASP technology enables a real-time connection to the database, so any changes made to the database are immediately re flected on the client side. Macromedia D1umbeat 2000 claims to provide everything needed to build dynamic Web applications and online stores visually at a fraction of the typical development time and expense. The designers of Drumbeat 2000 also cl aim that the development environment can keep up with continuously evolving web technology, thus making it a future-oriented technology. 2.9 NGI: This initiatjve is a mulli-agency Federal research and development program began on October 1, 1997 with the participation of the following agencies: DARPA, DOE, NASA, NIH, NIST, and NSF (Table 4). These agencies arc charged with the responsibility of developing advanced networking technologies and revolutionary applications that require advanced networkjng. 2.10 Internet2: The Intemet2 is a consortium of over 180 uruversit ies leading the way towards a partnership with industry and government to develop advanced network applications and technologies in order to accelerate formation of a more advanced Internet. The primary goals of Internct2 are to create a leading edge network capability for the national research community, enable revolutionary Internet applications, and ensure the rapid transfer of new network services and applications to the broader Internet community. Through Intemet2 working groups and initiatives, Internet2 members are 27 collaborating on advanced app.lications, middleware, new networking capabilities, advanced network infrastructure, partnerships, and alliances [22). 3 OCCUPATIONAL ROLES IN illE In order to build, deploy, and maintain an Internet Enterprise, certain roles and positions most be filled for the organization to be effective. Table 5 lists and describes many of the relevant roles required within an enterprise initiative, such as Chief Privacy Officer (CPO), in addition to the more traditional organizational roles such as Chief Executive Ofilcer (CEO), Chief Technology Officer (CTO), and Chief Financial Officer (CFO) [20, 23]. 4 TECHNOLOGY IMPLEMENTATION AND STRATEGY 4.1 Microsoft Dotsmart Initiative: There are various approaches to imp.lementing strategic planning and technology implementations. For illustrative purposes, Microsoft is considered in this thesis to be one such approach for enterprise planning. Once the overall conceptualization and business pattern is created and a.ll the necessary occupational roles within the organization are identified, it is necessary to identify exactly which technology to utilize in order to build and implement the business venture. As the requirements of a business are analyzed, a useful guide is the Microsoft Dotsmarl Initiative. This mode of business analysis will help determine which business engineering concepts to use and what kinds of personnel are needed to 1un the operation. Additionally, the Microsoft Dotsmatt Initiative provides key points to address when building an Intemet operation from scratch. 28 4.2 Microsoft Technology Centers (MTCs): MTCs are areas designed for groups of entrepreneurs, Information Technology personnel, and businessmen for the rapid development. of robust e-commerce solutions. At these facilities, developers, entrepreneurs, and high-technology business persons use Microsoft Technology and the relevant knowledge to build enterprise solutions. The centers provide the essentials a team would need to develop an enterptise from the initial conception of the idea to launch. Microsoft provides essential equipment, support, and expe11ise, with an application of a ";best-practices" approach. These best practices have been tested before at MTCs, expediting the development progress and time to market. Laboratory sessions are designed to bring together an assortment of entrepreneurial individuals as they facilitate the development process using the latest Microsoft products. The MTCs offer customers wishing to capitalize on emerging Microsoft.NET technologies the service, infrastltlctme, and development environment to accelerate their projects and reduce thejr risk. The working laboratory is intended to help customers develop and test next-genera6on e-commerce technologies and demonstrate further the value of Windows platforms and other industry-standard systems for powering ebusiness. 4.3 Impact of XML: XML represents a more general way of defining text-based/ documents compared to Hypertext Markup Language (HTML). Both HTML and XML descend from Standard Generalized Markup Language (SGML). The greatest difference between HTML and XML is the flexibi lity of the allowable tag found in XML. An XMLbased document can define its own tags, in addition to including a set of tags defined by a 29 third-party. This ability may become very useful for those applications that need to deal with very complex data structures. An example of an XML-based language is the Wireless Markup Language (WML). WML essentially allows text pm1ions of Web pages to be displayed on wireless devices, such as cellular phones and personal digital assistants (PDAs). WML works with the Wireless AppHcation Protocol (W AP) to deliver this content. WML is similar to HTML but does not require input devi ces such as a keyboard or mouse for navigation. In the case of a PDA thal requests a Web page on the Intemet, a WAP gateway receives the request, translates it, and sends it to the appropriate Internet server. In response, the server replies by sending the requested WML document. The WAP gateway parses this document's WML and sends the proper text to the PDA. This introduces the element of device portability. 4.4 Microsoft.Net Initiative: Microsoft announced a new generation of software called Microsoft .NET. This software is intended to enable every developer, business, and consumer to benefit from the combination of a variety of new Internet devices and programmable Web services that characte1ize NGI. Microsoft is trying to create an advanced new generation of software that wiiJ drive NGI. This initiative is called Microsoft.NET and it.s key purpose is to make information available at any time, in any place, and on any device. 4.5 Microsoft BizTalk 0 1·chestration: For IEE purposes, BizTalk Server 2000 is the considered a nex t-generation software that plays an important role in forming the infrastructure and tools for building successful e-commerce communities. The core of 30 BizTalk Server offers business document routing, transformation, and tracking infras tructure that is mles based. BizTalk Server offers many services that allow for quickly building dynamic business processes for smooth integration of applications and business partners while utilizing pubJic standards to ensure interoperability. Essentially, BizTalk server provides a method to build dynamic business processes quickly. 4.6 Back-end Configurations Using Microsoft Technology: In the design of the backend of a website, special considerations must be given to security. This is done by providing a kind of safety buffer from the greater world of the Internet using a demiUtarized-zone (DMZ) strategy. The components of a DMZ such as the firewall, the front-end network, the back-end nelwork, and the secure network function as a security buffer from the outside world. 4.7 Rapid Economic Justification (RE.fl: The REJ framework makes it possible for IT and business executives to demonstrate how specific investments in IT will eventually benefit the business, ensuring in the process that the IT projects are aligned with the specific business strategies and priorities. IT investments play a critical role in Internet enterprises. Important decision-making at the early stages of any venture does require an effective methodology to identify the best strategic IT investments. Leaders in the upper echelon of organizations such as CEOs, CTOs, and CFOs are being overwhelmed with complex information. REJ may prove to be a reliable method to quickly evaluate the true value worth and potential of a company by taking into consideration its intangible IT assets. 31 In the past, companies developed metrics for the valuation of IT investments on the basis of cost improvements. Metric methodologies have focused on Total Cost of Ownership (TCO), whereas the strategic role of IT in boosting new opportunities for business has been largely ignored. Understandably, the benefits of IT can be traced to ways of measuring business value the traditional way. Unfortunately, current business practices are not necessarily adequately equipped to handle the complexities of the New Economy. Although the economic justification of IT projects has been researched extensively in the past decade, the problem is that these metiJods and techniques require too much data-crunching power and time to prepare. These unwieldy research techniques need to be replaced by a new and practical approach to quantify swiftly and accurately the true value of IT investments. 5 MARKETING AND CUSTOMER RETENTION 5.1 Online Marketing: The Internet provides marketers with new tools and convenience that can considerably increase the success of their marketing efforts. An Internet marketing campaign such as advertising, promotions, public relations, partnering and Customer Relationship Management (CRM) systems are all an integral prut of the marketing process. Table 6 describes the various techniques at the marketer's disposal when using the Internet as the medium of customer information delivery [19]. 5.2 CRM Systems: CRM is a general but systematic methodology using both business and technological techniques to maintain and grow a business's customer base. CRM systems enable a business to keep detaj led records on the activity of its c ustomers 32 by using new, sophisticated tracking systems on the Internet. Table 7 shows various areas where CRM technology and CRM business techniques can assist in managing a customer base [19]. 5.3 Web Design Technology Example: Dreamweaver Technology: Macromedia Dreamweaver is Web technology for building websites on the Internet without the need for programming directly in HTivlL [21]. Also, Web designers are easily able to create Web-based leaming content with Dreamweaver 4.0. A Web designer has the ability to create site maps of the website that can be easily maintained and enhanced. This is a very popular technology available on the market that can be used to make professional quality websites for marketing and promotional purposes. 5.4 Web Enhancement Technology Example: Flash Technology: Macromedia Flash is a multimedia technology for applications on the Web. This technology gives the user, especially one not artistically talented, the ability to develop interactive animations that can look quite impressive. A flash movie can be embedded into a Web site or run as a standalone program, and Flash is compatible with Dreamweaver. Flash movies can be made with sound and animation, so it is useful as a software tool to produce demonstrations at the user-interface. Flash can be used on CD-ROMs and allows for the construction of cross-platform audio/video animations and still jmages. 33 \ 6 SUMI\-IARY TABLES We would like to reiterate emphasis areas for Electronic Enterprise as listed in the introduction of this module. These are a) hardware (mechanisms associated with physical world), b) software (mechanisms associated with computational world), c) netware (mechanisms associated with communications), and d) peopleware (mechanisms associated with human element) [23, 24]. Following tables provide a useful Jist in all these areas. For convenience, we include all summary tables in following order: Table 1 Enterprise Maturity Levels Table 2 Web Business Models Table 3 Electronic Transactions Table 4 NGI Participating Agencies Table 5 Occupational Roles in lEE Table 6 Marketing Techniques on the Internet Table 7 Customer Relationship Management 34 Table 1 Enterprise Maturity Levels Levels Focus Activity Coordination Infrastructure 5. Whole Human-society Process Self-directed teams Long-term oriented; in engineering dominate orientation, harmony with methodology workplace; toLal personal mastery, nature, people institutionalized; alignment; open, heavy investments routinely do the Flexible and honest in IT, continuous right things: predictable communication improvement change is second process, right the channels institutionalized nature first time, value- throughout adderl activities only 4. Wise Stakeholders and Process monitored Organjzational Organi:z.ation community automatically for structure based on competency oriented in high performance; cross-trained case management; harmony with dominated by teams; vision continuing community; value-added al igned with the education; team-people routinely activities; high needs of the based structure; doing things right. degrl:e of society tenm-oriented HR Changes are concurrency; few policy planned and handoffs mannged 3. Mature Customer oriented; Process defined Vision defined Integrated customer's needs and is measured with extensive capacity, are anticipated; buy-ins, multi- con sol ida ted people are proud to functional project function; work here teams exist; investment in participatory training and work culture with force planning; managers as flattened coaches organization 2. Stable Competition- Process under Internal focus, Short-term focus, oriented reactive statistical control; control oriented, fragmented bench-marking as functional division capacity, little IT, a result of reaction, hierarchical, inflexible process, difficult to get has many information, no handoffs and a formal HR policy substantial number of non-value-added tasks I . Ignorant Disoriented- Fire-fighting Ad- No clear vision, Don' t know where chaotic hoc, unpredictable, resources exist fragmented Rumor mill rampant 35 e-Business Model Storefront Model Auction Model Portal Model Dynamic Pricing Model Comparison Pricing Model Demand-Sensitive Pricing Model Table 2 Web Business Models Description The~ storefront model is what many persons think of when they bear the word ebusiness. The storefront model combines transaction processing, security, online payment and information storage to enable merchants to sell their products on lhe web. This is a basic form of e-commcrce where the buyer and seller interact directly. To conduct storefront c-commerce, merchants need to organize an online catalog of products, take orders through their Web sites, accept pnyments in a secure envi ronment, send merchandise to customers, and manage customer data. One of the most commonly used e-commercc enablers is the shopping cart. This order-processing technology allows customers to accumulate items they wish to buy as they continue to shop. www.amazon.com is a good example. Forrester Research reveals that an estimated $3.8 billion will be spent on online person-to-person auctions in the year 2000 alone. This number is expected to rise to $52 billion for Business-to-Business (B2B) auctions. Usually auction sites act as forums through which Internet users can log-on and assume the role of either bidder or seller. As a seller, you are able to post an item you wish to sell, the minimum price you require to sell it, your item, and a deadline to close the auction. As a bidder, you may search the site for availability of the item you are seeking, view lhe current bidding activity and place a bid. They usually do not involve themselves in payment and delivery. www.ebay.com is a good example. Portal sites give visitors the chance to find almost everything they are looking for in one place. They often offer news, sports, and weather, as weU as the ability to search the Web. Search engines are h01i zontal portals, or portals that aggregate information on a broad range of topics. Yahoo! at www.yahoo.com is an example of a horizontal portal. America Online (AOL) www.aol.com is an example of a vertical portal because it is a community-based site. The Web has changed the way business is done and the way products are priced. Companies such as Priceline (www.pricelinc.com) and Imandi (www.imandi.com) have enabled customers to name their prices for travel, homes, automobiles, and consumer goods. The name-your-price model empowers customers by allowing them to choose their price for products and services. The comparison pricing model allows customers to polJ a variety of merchants and find a desired product or service at the lowest price (i.e. www.bottomdollar.com). The Web has enabled customers to demand bener, faster service at cheaper prices. It has also empowered buyers to shop in large groups to achieve a group rate (i.e., www.rnercata.com). Customers become loyal to Mercata because it helps them save money. 36 e-Business Model Bartering Model Advertising Model Procurement Model B2B Service Provider Model · Online Trading Model Online Lending Model Online Recruiting Model Online Travel Service Model TabJe 2 (Continued) Description A popular method of conducting e-business is bartering, offering one item in exchange for anotiier. If a business is looking to get rid of an overstocked product, iSolve ~isolve.com) can help sell it PotenHal customers send their pricing pre ferences to the merchant who evaluates the offer. Deals are often part barter and part cash. Examples of items typically bartered are overstocked inventory items, factory surplus, and unneeded assets. Forming business models around advertising-driven revenue streams is the advertising model. Television networks, radio stations, magazines, and print media usc advertising to fund their operations and make a profit. www.Iwon.com is a portal site that rewards users with raffle points as they browse the site's content. www.freemerchant.com offers free hosting, a free store builder, a free shopping cart, free traffic logs, free auction tools and all the necessary elements for running an e-commerce storefront. Frccmerchanl makes money from its strategic partnerships and referrals. The procurement model means acquiring goods and services with effective supply chain management via a B2B Exchange. ICG Commerce Systems (www.icgcommerce.com) is a site that enables businesses, customers, suppliers, purchasers, and any combination of these to interact and conduct transactions over the Internet. The system supports B2B, B2C, and all variations of these models. · B2B service providers make B2B transactions on the Internet easier. These e-businesscs help other businesses improve policies, procedures, customer service, and general operations. Ariba (www.ariba.com) is a B2B service provider. The online trading model is essentially securities trading on the Internet. Trading sites allow you to research securities and to buy, sell, and manage all of your investments from your desktop; they usually cost less. Charles Schwab (www.schwab.com) is a notable example. Companies are now making loans online. E-loan (www.eloan.com) offers creditcard services, home equity loans, and the tools and calculators to help you make educated borrowing decisions. Recruiting and job searching can be done effectively on the Web whether you are an employer or a job seeker. Refer.com (www.refer.com) rewards visitors for successful job referrals. Web surfers can search for and arrange for all their travel and accommodations online, and can often save money doing so. Cheaptickets (www.cheaptic kets.com) .is a similar site that helps customers find discount fares for airl.ine tickets, hotel rooms, cruise vacations and rental cars. 37 e-Business Model Online Entertainment Model Energy Distribution Model Braintrust Model Online Learning Model Click-and-Mortar Model Table 2 (Continued) Description The entertainment industry has recognized this and has leveraged its power to sell movie tickets, albums and any other entertainment-related content they can fit on a Web page. ICast.corn (www.icast.com) is a multimedia-rich entertainment site. A number of companies have set up energy exchanges where buyers and sellers come together to corrununicate, buy, sell, and distribute energy. These companies sell crude oil, electricity, and the products and systems for distributing them. Altranet (_www.altranet.com) also sells energy commodities. Companies can buy patents and other intellectual property online. Yet2 (www.yct2.com) is an e-business designed to help companies raise capital by selling intellectuaJ property such as patents and trademarks. Universities and corporate-training companies offer high-quality distance education directly over the Web. Click2learn ~www.click2 1earn.com) has created a database of products and services to elp mdtvtdunls and companies fi.nd the education they need. Brick-and-mortar companies who wish to bring their businesses to the Web must determine the level of cooperation and integration the two separate entities will share. A company that can offer its services both offline and o nline is called click-and-mortar, such as Barnes & Noble (www.bn.com). 38 Electronic Transaction T e Credit Card Transactions E-wallets Debit cards Digital Currency Table 3 Electronic Transactions Descrjption Merchant must have a merchant. account with a bank. Specialized Internet merchant accounts have been established to handle online credit card transactions. These transactions are processed by banks or third-party services. To faci litate the credit card process, many companies are introducing electronic wallet services. E-wallets allow you to keep track of your billing and shipping information so it can be entered with one click. Banks and businesses are also creating options for online payment that do not involve credit cards. There are many forms of digital currency; digital cash is one example. It is stored electronically and can be used to make online electronic payments. Digjtal cash is often used with other payment technologies such as digital wallets. Digital cash allows people who do not have credit cards to shop online, and merchants accepting digital-cash payments avoid creditcard transaction fees. 39 Examples Companies like Cybercnsh (www.cybercash.com) and ICat (www.icat.com) enable merchants to accept credit card payments online like www.Charge.com. www. visa.com offers a variety of ewallets. Entrypoint.com offers a free, personalized desktop toolbar that includes an e-wallct to facltitate one click shopping at its affiliate stores. In order to standardize e-wallet technology and gain wider acceptance among vendors, Visa, Mastercard, and a group of e-wallet vendors have standardized the technology with the Electronic Commerce Modeling Language (ECML), unveiled in June 1999 and adopted by many online vendors. Companies such as AroeriNet allow merchants to accept a customer's checking-account number as a valid form of payment. AmeriNet provides authorization and account settlement, handles distribution and shipping (fulfi11ment), and manages customer service inquiries. E-Cash Technologies (www.ccas.b.com) is a secure digitalcash provider that allows you to withdraw funds from your traditional bank account. Gift cash is another form of digital currency that can be redeemed at leading shopping sites. Web. Flooz (www.Jlooz.wm) is an example of gift currency. Some companies offer points-based rewards. www.beenz.com is an international, points-based currency system. Electronic Transaction Peer-to-peer Smart Cards Micropaymenls Table 3 (Continued) Description Peer-to-peer transactions allow online monetary transfers between consumers. A card with a computer chip embedded on its face is able to hold more information than an ordinary credit card with a magnetic strip. There are contact and contactless smartcards. Similar to smart cards, ATM cards can be used to make purchases over the Internet. Merchants must pay for each credit card transaction that is processed. The cost of some items could be lower than the standard transaction fees, causing merchants to incur losses. Micropayments, or payments that generally do not exceed $10.00, offer a way for companies offering nominal.ly priced products and services to generate a profit. 40 Examples cCash runs a peer-to-peer payment services that allows the transfer of digital cash via email between two people who have accounts at eCashcnablcd banks. Pay Pal offers a digital payment system known as X payments. PayPal allows a user to send money to anyone with an email nddress, regardless of what bank either person uses or whether the recipient is pre-registered with the service. EConnect has technology in the form of a device that connects to your computer and scrambles financial data, making it secure to send the data over the Internet. EpocketPay is another product developed by eConnect that allows a consumer to make secure purchases from the ePocketPay portable device. This device acts as a cell phone with a card reader built into it and will allow you to make secure purchases anywhere. Millicent js a micropayment technology provider. Millicent handles all of the payment processing needed for the operation of an e-busi ness, customer support, and distribution services. Millicent's services are especially useful to companies that offer subscription fees and small pay-per-download fees for digjtal content. c-Billi ng Electronic llill Presentment and payment (EllPP) offers the ability to present a company's bill on multiple platforms online. Payments arc generally electronic transfers from consumer checking accounts. 41 The Automated Clearing House (ACH) is the current method for processing electronic monetary transfers. Table4 NGI Participating Agencies _A~c~ro~t~1Y~n_l_ _~ E_x~p_a_n_si~n --- ~ --- ~--~ --- DARPA Defense Advnnced Research Projects Agency DOE Department of Energy (beg inning in PY 1999) NASA National Aeronautics and Space Administration NIH National Insti tutes of Health NIST National Institute of Standards and Tec hnology NSF National Science Foundation 42 Occupation Entrepreneur e-Commerce Program Manager Enterprise Architect Business and Infonnation Architect Table 5 Occupational Roles in illE Descdptjon An entrepreneur on the Internet is usually the person with the initial idea for the entire business and is involved in its early stages of inception before official management takes over. e-Commerce Program Managers are involved in enterprise-wide ecommerce initiatives and projects, managing e-cornmerce integration and overall business and technology architecture and infrastn1cture. Usually, they arc senior-level line managers who are effective at uniting the business and technology front by coordinating units within an organization and across the extended enterprise. Enterprise Arc hitects are involved in the definition, alignment, and refinement of the overall ente rprise architecture. Their responsibilities include seeing to it that many of the tasks of program management are can·ied out properly. More important, they must provide guidance so individual projects can make optimal use of infrastructure resources for e-Cornmerce. A balancing act between business requirements and tcchnologicnl capabilities is accomplished through their efforts . Enterprise Architects have a duty to identify the requirements, goals, and constraints of the project. They allocate responsibilities for each of the architectural elements. They are also responsible for lhe coordination of the modeling and design activities for the overall enterprise architecture. They are the chief e-commerce architects because they coordinate the work information, infrastructure and application architects. All architects and modelers should be completely capable in design patterns common to the many facets of business and technology. The design pattern movement has affected all aspects of analysis, design, and implementation of componentbased systems. Design patterns are the reusable material of architecture and have an important role in the complex distributed information systems lhat are conceived and developed today. Business and Information Architects have business domain knowledge, including business processes and logical information structures. They coordinate the work of business and technology analysts and modelers who develop abstract representations or business object models of the subjects, rules, roles, events, tasks, activities, and policies of the business domain. Application-neutral models that are built enable the reuse of business engineering analysis and design patterns and artifacts 43 Occupation Infrastructure Architect Application Architect Humru1 Factors Engineer Business Manager Internet Commerce Architect Table 5 (Continued) Description Infrastructure Architects identify the technical services required of the technology infrastructure to empower and support the logical busi ness and information architecture. They evaluate existing infrastructure services, s\~l ect those appropriate to a given project and acquire (via build or buy) new components needed in the infrastructure. They oversee the work of technical specialists in modeling the service architecture of the technical infrastmcturc. They maintain the technical components of the development repository. Application Architects coordinate the business process modeling activities across multiple projects and business domains. They coordinate the work of domain modelers and maintain the repository of business and component models. They evaluate existing business component services, sclectthose appropriate to a given project and (via build or buy) new components needed in the evolving business model. They maintain the business application components of thC development repository. Most importantly. tl1ey guide solution developers in blending the business object model with the infrastruchJre services needed to implement the models in an e~com merce platform. Human Factors Engineers are needed to design the next generation of user interfaces. While the graphical user Interface (GUD is recognized as the enabler of wide-spread personnl computing, task centered user interfaces provide assistance to end-users and can be a boon to productivity in the world of e-commerce. E-commerce transactions can involve a multitude of complex steps and processes. Well-designed user interfaces can help navigate and guide the user through these tasks, keeping track of the progress, and picking up where users leave off when transactions span multiple sessions of work. The Business Manager is responsible for the business approach on the Internet, creating and operating the Internet presence for the business, deciding what products and services are sold online, determining pricing, and establishing the key business relationships needed lo make a venture successful. This is primarily a business role, with particular attention paid to the success of the online business and bottom line. The Internet Commerce Architect is generally a systems analyst who turns the business requirements into a system design that incorporates the creation and management of content, the tnmsaction processing, fulfillment, and technical aspects of customer service 44 Occupation Solution Developer Content Designer Content Author Implementor Database Administrator Internet Sales and Marketing Customer Service Representative T~lble 5 (Continued) Description Solution Developers are application developers. They develop the use cases for the specific application at hand, compose solutions through extensive use of business object models, and use repositories. They assemble application components to implement c-commercc application. Unlike conventional programmers or programmer/analysts, they do not build or pmgram components. Instead, they assemble or glue together business solut ions from prefabricated components. They use highly integrated development environments (IDEs) such as IBM's VisuaiAge, Symantec's Visual Caf6, Sybase's PowcrJ, and Inprise's Jbuilder. Emerging Computer Assisted Software Engineering (CASE) tools and related methods will likely appear that tighten the link between business modeling and software development. Tools for understanding and managing business processes, such as Inte11icorp's LiveModel allows solution developers to build logical business that can automate the configuration and management of the SAP/R3 ERP system. The Content Designer is responsible for the look and feel of an Internet commerce system, including the graphic design, page layout, and user experience. The Content Author creates or adapts product information into a form that can be used for internet commerce, working within the design laid out by the content designer. The Impleme::ntor is responsible for creating any programs or software extensions needed to make the Internet commerce system work. For example, an Implementor might write the software or construct an ASP page using Drumbeat 2000 that takes product information from a database and dynamically renders it into a Web page. In the case that a database is used in the back-end, the Database Administrator (DBA) manages the creation and operation of the database to ensure its reliability, integrity, and performance. The Sales and Marketing team is responsible for focused efforts in promoting Internet-based commerce. Customer Service Representatives answer questions about products, assist buyers with registration or the purchasing of goods and services. 45 Occupation Component Developer Operations Manager System Supervisor System Administrator Security Officer Fulfillment Agent CPO Internet Lawyer Internet Accountant Table 5 (Continued) Description Component Developers usually build components in the form of coding projects. They are masters of component technology and know the intricacies of composition, delegation, and object-oriented systems analysis and design. They are proficient in component development languages (such as Java and C++), modeling standards (such as UMLand XMI), and distributed computing platforms (such as CORBA, DCOM, EJB). They understand and think in terms of architectural design patterns. In the meanti me, they will close the gap between business requirements and available components. Component developers must be highly qualified software engineers since quality'components do not just happen. They are carefully constructed using quality soflware engineering disciplines. Component Developers, therefore, must be highly trained specialists and masters of software quality processes such as CMM and ISO, as well as masters of component-based development methods. The Operations Manager is responsible for managing all service activities for the Internet commerce system. The System Supervisor manages the system staff. The System Administrator is responsible for the technical operations of the computer systems and networks. The Security Officer ensures that appropriate security measures have been taken in the design and implementation of the Internet commerce system. The Fulfillment Agent is responsible for shipping and handling of physical goods or delivery of services. In the case of digital goods, the fulfillment agent is responsible for overseeing the operation of the fulfillment system. The Chief Privacy Officer is io charge of measures for ensuring the security of vital company information, such as customer credit card numbers remains secure within the company network. An Internet Lawyer is a legal expert for Internet fu nctions. The .importance of this position cannot be overstated, because new laws and regulations could ki ll a company without legal assistance, prevention, or intervention. The Internet Accountant is responsible for ensuring that the proper accounting procedures have been followed for Internet-based transactions. 46 Technique Domain name FAQ Forum Networking Faci litation Promotions c-Business advertising Pay-per-click Pay-per-lead Pay-per-sale Webcasting Interactive Advertising Public Relations and press releases Trade shows Table 6 Marketing Techniques on the Internet Description The Universal Resource Locator (URL) represents the address of the domain name, which must be chosen with care because it reflects the company's values immediately and connotes immediate meaning to customers with its first impression. One can purchose a domain name at www.networksolutions.com. A frequently asked questions (FAQ) section contributes to a userfiiendly site. An onli ne forum on the website enables customers to congregate at a pre-de~ign at cd place on the site to post comments and to share ideas. This promotes site activi ty. It is important to make it easy for the customer to recommend a site to a friend. This can be accomplished with a quick button that brings up an email exchange. c-Business promotions can attract visitors to your s ite and can influence purchasing. Netcenlives.com is a company that can provide your business with customer reward programs. P ublicizing through traditional channels such as television slots, movies, newspapers, and magazines is effective. Pay-per-click is a mode of operation that calls for paying the host according to the number of click-throughs to a site. Pay-per-lead is a mode of operation that pays the host for every lead generated from the advertisement. Pay-per-sale is a mode of operation that pays the host for every sale resulting from a click through. Webcasting is a broadcasting technique on the Web that uses streaming media to broadcast an event over the Web. Interactive Advertising involves consumers in the advertising campaign. An example is WebRIOT, a game show on MTV. The game is aired on television, and viewers can join in the game at the same time by playing online. Public Relations (PR) and press releases keep customers and your company's employees current on the latest information about products, services, and intemal and external issues such as company promotions and consumer reactions. Trade shows arc excellent opportunities to generate site interest by speaking at conferences, which increases brand awareness 47 Table 7 Customer Relationship Management CR.M:Area Handling Sales tracking Transaction support Data-mining Call center Log-file analysis Cookie Customer registrntion Personalization One-to-one marketing Onsite Search engine Registering with Internet search engines Partnering Afffiiate Programs Culture management Description Handling is essentially the maintenance of out-bound and in-bound calls from customers and service representatives. Sales tracking is the process of tracing and recording all sales made. Transaction support entails technology and personnel used for conducting transactions. Data-mini ng is a wny to analyze information collected from visitors. Data-mining uses algorithms and statistical tools to find patterns in data gathered from customer visits. A call center gathers customer-service representatives who can be reached by an 800 number or through email, online text chatting, or real-time voice communications. A log-file analysis is a useful way to keep track of your visitors in tenns of site visits, including each visitor's location, IP address, time of visit, frequency of visits, and other key indicators. A cookie is a technology that keeps a profile on each visitor. Customer registration is an excellent method to create customer profiles because visitors fi ll out a form with personal information. Personalization technology can help a company understand the needs of its customers and the effectiveness of its website, thereby catering to the whims of the customer. One-to-one marketing such as e-mails confirms purchases and offers new products, showing customers that the business appreciates their patronage. Onsite Search engines allow people to find information relative to a subject of interest amidst the large amounts of information available on a personal website. Registering with Internet search engines is important because there are reportedly over 400 se::arch engines in usc on the Internet. This process makes a website known to the world by submitting the website as a searchable domain name in a sea of domain names. Partncring is a way of forming a strategic union with another company. Generally, legal contracts are usually written to define the relationship in a wf'ly to help a company provide customers with complimentary services and product<;. An Affiliate Program is an agreement between two parties that one will pay the other a commission based on a designated consumer action. Affi liate programs establish new income streams for companies and individuals that host the advertising affili ate websites. Culture management is the ability to understand and cater lo a target audience's patronage and culture, especially in global enterprises. 48 LIST OF REFERENCES [1] 0. Aktunc, ";The Role of Component Technologies on Enterprise Engineering,"; Masters Thesis, Department of Electrical and Computer Engineering, University of Alabama at Birmingham, 2002. [2] D.H. Liles, M.E. Johnson, L.M. Meade, and D.R. Underdown, ";Enterprise Engineering: A Discipline?"; Society for Ente1prise Engineering Conference Proceedings, June 1995. [3] L. Whitman, Enterprise Engineeiing IE8801 class webpage, http://webs.twsu. edu/enteng, 2002. [4] W.D. Barnett and M.K. Raja, ";Object-Oriented Enterprise Engineering,"; http:/ /webs. twsu .edu/enteng/papers/OOEE. pdf, 1999. [5] J. Orr, ";Enterprise Engineedng Modeling,"; http://www.cadinfo.net/editorial!eem. htm, 2002. [6] H. Eriksson and M. Penker, Business Modeling with UML, New York: Wiley, 2000. [7] G. Herzum and 0. Sims, Business Component Factory, New York: Wiley, 2000. [8] ";Enterprise Design and Engineering,"; http://www.eil.utoronto.ca/ent-eng/, 2002. [9] M. Segal, M. N. Tanju, 0. Aktunc, and M. M. Tanik, ";Strategy Formulation for E-Business ,"; in The fifth World Conference on Integrated Design & Process Technology, 2000, Proceedings CD. [10] E.M. Roche, ";Managing Information Technology in Multinational Corporations,"; Macmillan Publishing Company, New York, 1992. [11] C. Chandra and A.V. Smirnov, ";Ontology-Driven Knowledge Integration for Consumer-Focused Smart Companies,"; Proceedings of the Twelfth Annual Conference of the Production and Operations Management Society, POM-2001, Orlando FL, 2001. [12] G.J. Cross, ";Now e-Business is Transforming Supply Chain Management,"; Journal of Business Strategy, March/April, pp. 36-39, 2000. [13] S. Chincholikar, 0. Aktunc, and M.M. Tanik, ";TheN-Queens Test-Bed,"; Technical Report 2001-1 0-ECE-0 11, Department of Electrical and Computer Engineering, University of Alabama at Birmingham, 2001. [14] S. Davis and J. Botkin, ";The Coming of Knowledge-Bases Business,"; D. Tapscott, eds., Creating Value in the Network Economy, Boston: Harvard Business School Publishing, 1999. 49
