Suchergebnisse

Part one of an interview with Rev. Monsignor Leo J. Battista.Topics include: The Monsignor's family history and how his parents came to the U.S. from Italy. His father's work experience as a water boy on the Clinton Dam and then as a barber. The Monsignor's education at Holy Cross and at Grand Seminary in Montreal. The history of his assignments with the Church. Speaking Italian at home and learning different languages. Attending the Italian missions in Clinton, MA. Fighting cancer around the time he was ordained. Working at St. Anna's in Leominster. The Monsignor's experiences as an Italian living, going to school, and working in different places. His father's experiences being and Italian immigrant. Local social clubs. What his mother's life was like as a house wife. The importance of education to his family. ; 1 LINDA: … Rosenbaum for the Center of Italian Culture. It's Thursday, September 13th, 2001, and we are at the home of Monsignor Battista. I would like him to just introduce himself and his address, and then we'll get started with the interview. LEO: Good morning. My name is Monsignor Leo Joseph Battista. I live at -- I reside, rather, at 35 Julio Drive in Shrewsbury at a facility known as Southgate, which is an independent living home for retirees. LINDA: I thought that we could start with just you telling us a little bit about yourself. For example, your date of birth, and… LEO: I was born on December 27th, 1923 in a small town called Clinton, Mass, which is not too far from here. And I was born of two Italian [non-born] parents, both having come over from Italy—my father, Vincenzo Battista, and my mother, Maria Perrone Battista. My father came over here when he was just 13 years old and began to work as a worker at the Wachusett Reservoir. LINDA: What is that noise? LEO: That's the bird. On the clock. LINDA: Oh, I see. Okay. Try if it will shut up. I wasn't sure if that was a real bird. LEO: No. LINDA: Okay. I'm sorry. So you were explaining when your father was arriving? LEO: He arrived in 1908, I believe he got here. He came over with his dad, and they settled in Clinton because of work that was being done on the Wachusett Reservoir at the time. And he worked here -- he worked there for several years and then went on to take up the trade of being a barber. My mother, of course, she was born in Italy. And I believe she came over here in -- she came after she married my father. My father went back to Italy to marry her. And then she came over, and she was always a homemaker. She never worked outside the home. LINDA: Which village were they from in Italy?2 LEO: They were from a place called Delianuova, which is in the province and region of Calabria. And they were from the large province of Calabria and in the smaller district of Calabria called Reggio. And their little town was in the mountainous area, and it was called Giulinova. LINDA: About their experiences in Italy? LEO: Well, they would from time to time, just how they worked. Not too much though, when I stop and think of it. Because my father was very young, he hadn't had much opportunity to find work there. But he – so, he didn't have any job from there. He just came over here looking for job, looking for work with his dad. And my mother was just a homebody, so to speak. She was just from a family of -- I believe there were seven in her family. She was one of the girls in the family, had two brothers and four sisters. And she just worked around the home. She never really had any kind of a job over there or anything. And they would talk about the different things they would do, the picnics that they would go on and the festivities that they would attend and tell us about those things. There wasn't too much exchange as to what they did over there. LINDA: Did you father ever share with you the voyage? How old was he when he came here? LEO: He was only 12. LINDA: He was 12 in age when he came. LEO: He didn't say too much about that…just that they came over. He didn't go into much detail about it. And I don't know, for some reason or another, we never really asked too much about his trip over other than he came over by way of a boat with his dad. They certainly didn't travel first class. They were part of the immigrants who came landing in New York and getting off at Ellis Island.3 And that was an interesting thing. I often wondered why they used to call him James when his name was Vincenzo. And he then related the story to me one time that the officials at the immigrant registration desk had difficulty in understanding the name Vincenzo. And to them it sounded like James for some reason, Vince for James. So they put down James Battista. And so he kind of assumed that name here; and as he went along in labor, he was more commonly known as James Battista rather than his real name, Vincenzo Battista. But it was one of those mix-ups at the point of immigration registration that I think many Italian people went through. I mean, the people here were just in a hurry to register the people coming in, and if they didn't catch the name in the way it came across to them, they would put in what they thought they heard. And people got these different names from time to time. LINDA: So he worked as a laborer at Wachusett Dam? LEO: He worked as a laborer at the Wachusett Dam as a water boy because he was just, you know, 12 or 13 years old. And then after working there for a while, he was able to get a job in the Lancaster Mills, which was in Clinton at the time. That was a big copper company, and he worked there as a laborer for a while. But then he had the opportunity to pick up the trade of barbering. And I don't know how it was that he picked up barbering, he just seemed to want -- he liked that trade for one reason or another. He never did it as an apprentice in Italy, which was common in Italy. Before you did anything, any kind of work, you always worked as an apprentice for a number of years, and you gradually grew into and then being able to go on your own. Now, whether it was in carpentry or masonry or brickwork or barbering or 4 shoe work, that's the pattern; that's the way they trained over there. They trained as apprentices for a number of years. I remember when I used to help him at the barbershop when I was in high school. And he always used to consider my beginning as an apprenticeship. And then he would tell me about how he had to be an apprentice for a number of years and how he had to just watch the fellow work; that he was training with cut hair before he actually did cut any hair or attempt to make any attempt on cutting hair or trimming people's hair. And I used to be very impatient with that, just standing next to him watching him cut hair and trim people's hair. And I would be going up -- but he said you have to watch the technique, the way it's done. And he then explained that that's just the way an apprentice goes. And at the time, too, there was such a thing as an apprentice license in barbering. You couldn't get a license, a full complete license, until you had accomplished your apprentice training. So going back to his work, that is the way he learned, and then he went into barbering and then was able to open up his own barbershop. LINDA: And where was that located? LEO: It was -- I think it was located in Depot Square in Clinton right next to the railroad station. And he had quite a few really important people that used to come to him. For example, Senator David I. Walsh was one of his customers. And I can remember him going up to the site of David I. Walsh's house when the senator was in town, and he would go up there to either cut his hair or shave him and so forth. And another one of his major customers was Congressman Philip J. Feldman, who used to always come to the barbershop to have his hair cut, or he'd get a shave.5 And I remember how I used to like -- well, I wasn't around when Senator Walsh, David I. Walsh, was coming in, but I was around, working around the barbershop when Congressman Feldman was, and I used to like to kind of prepare him for my father's work on him, like getting him ready to have his hair trimmed and so forth or shaved. Because he used to always give me a nice big tip at the end even though I did nothing but just lather him up or put the apron on around him to protect him from the hair that might have fallen on him. LINDA: So you were expected to become a barber? LEO: Well, my father never expected me. He thought it would be good for me to learn the trade, and if I wanted to do it, to follow his footsteps. But he left it up to me pretty much as to what I wanted to be. And so he never -- I just helped him out. He had other barbers, too. But I used to help out too in the busy time on Saturdays and the weekends. But he never put any pressure on me to be a barber. I think he wanted something more for me because he would always encourage me about studying and to study and to go to school. And one of his high events, one of his great hopes and mission was that I would go to Notre Dame University. He was always talking about Notre Dame, going to Notre Dame. But to go to Notre Dame at that time when I was growing up and in school, in high school, it was during the Depression, and that would cost a great deal of money. And so in my deliberations about where I was going to go to the school or pick, I felt that I would have to go to school around here someplace and commute to school, you know, not to live on campus or that because I didn't think my family could afford supporting me as a boarder in college some place. LINDA: So which school did you go to? LEO: Well, I was all set to go to Boston College, and the reason for that was because generally there was a cost factor. I had a sister who was married and lived in Boston, and I felt I could live with her and commute to school 6 on the trolley, on the tram in Boston. And I was all set and scheduled to go there and accepted. But then one day -- I was an altar boy, and after sitting a mass, one of the priests at the parish said to me, "Have you ever been to Holy Cross?" And I said, "Up to Holy Cross?" And I said, "No." And he said, "Well, I've got to go up there." He says, "You want to take a ride up and see the school?" And of course, at that time I was -- I knew quite a bit about Holy Cross, and so father used to follow their football team and the like. So it was kind of a challenge to go up and take a look at them. Well, when I went up there and I walked around with him and I saw Holy Cross, the whole atmosphere at Holy Cross presented itself in a different manner than Boston College did. And I mean, it seemed to be more scholastically appropriate, I mean. So far as I was -- when I went to BC with my brother-in-law, that visit, it was during the year and there was a lot of commotion, a lot of activity, and a lot of things going on. It didn't seem like I was in academia, you know. But when I went up to Holy Cross with the priest, Father O'Connell, it was -- everything was quiet and there weren't too many people around. It was very [contemporary], so to speak, and I was really impressed with Holy Cross. And so I said to Father O'Connell, I said, "I like this school very much." And he says, "Come on, let's go and get an application." And so I went into the Dean's office, the Dean of Admissions, with him and we got an application. And I filled it in, and I was accepted. And after a few days, I got a letter saying that I was accepted to go there. So that's how I picked. And I felt it was close to Clinton, and I could commute from Clinton to Holy Cross maybe much better than being all the way down in Boston, so. LINDA: How did you commute? Did you have a… LEO: When I graduated from…7 LINDA: Put your hands further. Okay. LEO: When I graduated from high school, my father decided to go look at cars. He decided to buy me a car for graduation. A very good friend of his was a dealer, had taken this car in, and it was a 1937 Plymouth. And it was owned by a young woman who very seldom used it, and there wasn't very much mileage. And he got a terrific buy at the time. I think he paid $315 for it. So that was my graduation gift from high school, which enabled me then to use it to commute to Worcester every day to Holy Cross. And at the same time, there was already a young man in the town who was going to Holy Cross, and so knowing that I had a car, they asked if he could ride with me, and they would pay me so much a week for transportation. And that enabled me to keep the car up and get the gasoline and all that sort of thing. And that was every day, so that's how we used to travel to Holy Cross. LINDA: When you entered Holy Cross, did you… LEO: When I entered Holy Cross, I said that I would -- I put down that I wanted to be a priest or a doctor, let's say medicine or the priesthood. And I would take the AB pre-med course in case I wanted to switch, but it also would enable me to go on for a study of priesthood too because they were the same courses, practically speaking, until you get up into your junior year where you began to take more of the chemistry and biology and so forth. And so I went in with that intention, either to be a doctor or to be a priest. And what was, you would say, the deciding factor at all -- well, I was having stronger, really, desire to be a priest. But I liked medicine because I had two sisters who were nurses, had trained, and I used to get -- hear a lot about medicine and so forth, and that always kind of interested me.8 But then the war -- the Japanese attacked Pearl Harbor in 1941, and that was the year I began Holy Cross in 1941, having graduated high school in '41; and in September I went to Holy Cross. And when the Japs attacked Pearl Harbor in December, then -- at the time at Holy Cross, they were just starting -- it was their first year of starting the NROTC, the Naval Reserve Officers Training Corps, and I was tempted to go into that. But then I said, if I go into that, how often -- that would interfere probably with my going ahead to be a priest. So I said I'd wait. But then when the war came, everybody on campus wanted to do something and get into -- be [in place], so to speak. All my classmates were either in the NROTC or they were joining up in the army or the navy or the marines or what. So I went up to join the Naval Air Corps, the D5, and I went into the office where you would sign up and fill your application in to join the D5 Program, which was naval training for air training. And when we -- this other young man with myself -- came up with me… we both had the same idea. Well, when we went in to see the priest who was taking the application, he looked over the thing, and he looked over what our admissions records said. So he turned and he said, "On this admission record you have here that you wanted to be a priest or to study medicine." And he said, "Do you still have that desire?" And I said, "Yes." He says, "Well, why are you signing up for this program?" And I said, "Because everyone else is entering the service." So he took my application and he ripped it up. And he said, "Listen," he says, "Uncle Sam will get all the men he needs in order to fight this war. But the church will need priests in order to serve these men. And if that's your desire, then you go and study for the priesthood."9 And shortly after that, about a month or so after that happened, a letter came down from the bishop in Springfield saying that if there were any young men at Holy Cross who wanted to study for the priesthood, they should now make plans to enter the seminary in the fall, in September. And so I went to see my pastor, and then plans were made for me to go into the seminary. LINDA: So was that in… LEO: No, I was at Holy Cross for three years. LINDA: Three years. LEO: Three years. Because we had gone -- this was in '43. Yeah, by the time I went into my third year and we were totally -- but after -- it was '42 when I went in to sign up for the -- well, I just thought that what he had said that he knew more about life than I did, and I always felt that they were always giving us proper direction. And so I thought, well, this might be the hand of the Lord telling me something, and maybe my time will come to share in some capacity or another, which, you know, it did later on because there again, too, then I was turned down from being a chaplain because I had an operation for cancer. I had a radical resection on my neck. I had three malignant tumors. And when I went to the navy, I went down in Boston to a Navy ad, and the bishop assigned me, called me into going to serve as a chaplain, and they refused my application on the grounds that I was -- I had cancer. LINDA: What year was this? LEO: Yeah, it was in 1951. It was the Korean War. So -- and then -- but that was years later. I always -- after I was ordained, I always felt at the time, well, not that I was being patriotic or anything, but I felt that all my classmates and the young men in my time had gone in and done their duty to the country and served. And so here was my chance in '50, in '51, and I was a priest, and I would go volunteer and then do my part. So I did. I volunteered, and when the bishop called me in to say that he was charging me to go and serve as a chaplain, I went down, but I was turned down.10 LINDA: Okay. Now when you left Holy Cross -- you left in 1943 to enter the seminary? LEO: Seminary. LINDA: And where did you go to seminary? LEO: We were all assigned to the Grand Seminary in Montreal, which was attached to the University of Montreal. LINDA: [Unintelligible - 00:26:40] LEO: No, our bishop then, Bishop O'Leary at the time, for some reason favored the seminary in Canada feeling that it was a very strict seminary, very rigid seminary, and that if you could last it out, then you really had a vocation. He felt that you really had the vocation. And they were very strict. But also there was -- it really wasn't because of the rigidity of the program, and it was a good program. But you know, intellectually it was a good program. But also, there were a lot of French people in the Springfield area, in the Springfield Diocese. And he felt very strongly that it wouldn't hurt to know one other language, for you as a priest to know another language in this area, which proved to be very true because after getting ordained, I used to hear a lot of French confessions even though I was in an Italian parish in Leominster. Parishioners from St. Cecilia would always come over to St. Anna's to confession. When I would go in to celebrate, even though I was in St. Mary's, the people at Notre Dame and Sacred Heart used to come to St. Mary's for confession. You know, another parish for confession. LINDA: Now why is that? LEO: And they were French. LINDA: Did they go to another parish because they didn't feel… LEO: Well, I think one of the things was that maybe they felt a priest in another -- it would be more private for them, you know? So they would come. And then there were other -- then too, it was the proximity of where they 11 were living. And sometimes our parishes were closer to them, the actual living residence, you know, for them to come to us. Those who lived would come to us. They wouldn't have to walk so far. LINDA: So you're saying that you did learn the French language? LEO: Oh, yeah. You had to then because in the seminary, everything was in Latin. Your books were in Latin. Your oral examinations were in Latin. Your written examinations were in Latin. Your texts were in Latin. Your class lectures were in Latin. And the only other language you heard was French. The spiritual lectures at night were in French. So you had to get to learn French. You know, we had to take French in the class, during classes there too. LINDA: Had you taken French at Holy Cross? LEO: I had taken French in high school. But at Holy Cross, I had taken the canon in Latin and Greek. But I never took French in college. But when we went up there, those two years, we had to study French. LINDA: So seminary school was two years? LEO: No, it was six years. LINDA: Six years. LEO: Six years. LINDA: Okay. LEO: So it was two years of philosophy and four years of theology. LINDA: That time, it must have been 1946. LEO: I was ordained -- I was ordained in December of '48, actually '49 was… LINDA: And where was this? LEO: My first assignment was in St. Thomas-a-Becket. LINDA: Where was that? LEO: In South Barre, Mass. LINDA: So maybe five months after that before you went to… LEO: I went from there to Leominster as an assistant, what we used to call a curate, the assistant curate. And I went down -- I went from there, from 1949 to 1951. So in 1951, I went to Leominster. And I went to St. Anna's 12 in Leominster in 1951 to 1953. And in 1953, I was then transferred to St. Mary's in Southbridge. And then in 1955, I was assigned to the Office of Catholic Charities in the diocese in Worcester; and I remained in Catholic Charities from 1955 to 1987. And then in '87, I was assigned to St. Anna's in Leominster, and then as pastor until 1992. No, no, no. Wait a minute. 1995. LINDA: '95? LEO: 1995. LINDA: And what happened after that? LEO: I was retired. LINDA: Retired. First of all, Italian. Did you speak Italian? LEO: I spoke a little at home. I used to speak with my mother, but my father always spoke English, so I didn't speak -- he didn't speak. My mother never really learned English. She would always speak Italian to us. She never even spoke any broken English but strictly Italian. 'Course we understood her. And then when I went into high school, I studied Italian. LINDA: When you were in high school? LEO: They started a new course, when I was in high school, teaching Italian in the public school system in Clinton. Then I took a couple of years of Italian there. That was funny. I was taking Italian, French, Latin, and English. And I used to sometimes get them confused a little bit, like sometimes my French teacher would say, "Well, that's an Italian word you're saying, not a French word." I had the facility to learn languages, and so I didn't mind it. I took -- I started learning languages and there just didn't seem to be any strain to the learning, you know, French or Italian or what. Then when I went to college at Holy Cross, my first three years at Holy Cross, I took Italian as a second language. LINDA: Did your mother urge you to become a priest?13 LEO: They always looked favorably upon it. They left it up to my decision. They never pushed me into it or anything like that. But they were always -- encouraged me along the way, you know, of what my intention was. My father was one who always said, "Well, you continue with school, and when the time comes, when you decide to be what you want to be, then we will do all we can to have you follow through." So my mother wasn't one that really, you know, would push us one way or another other than to be good and learn to do what is right in school and so forth. My mother never had much of an education herself in Italy and coming over here. Education was not a paramount factor in her life. She would just be very happy to see you succeed and so forth. I can find an example in the fact that they would go to mass and learn -- go to mission, canon missions and things like that, and their respect and reverence for religion before the Lord. I think those were the things that were the models for me. LINDA: Explain the Italian missions. LEO: Italian missions were -- because in Clinton, everything was in English. Every once in a while for the Italian immigrants who didn't speak English, the priest, the pastor used to have what they called a mission, Italian mission, and he would invite Italian-speaking priest into the parish for a week. And he would give a mission, like a retreat, you know, for just the Italian people so that they could go to communion and then go to confession, fulfill their obligations. See, at that time, it used to be like that you go at least to confession at least once during the year to fulfill your Easter duty and things like that. And this was the idea. This enabled them to go and speak with the priest, hear their language, hear the Word of God being preached to them in their 14 language that they understood, because a lot of them didn't understand English. LINDA: I had thought that the masses were said in Latin. LEO: They were said in Latin, but the sermons were always in English. Yeah. LINDA: So there wasn't an Italian-speaking sermon. LEO: No. The only ones at that time. There was one in Worcester. LINDA: Was that Our Lady of Mount Carmel? LEO: Yeah. And then there was one in Fitchburg. Those were the only two places during my growing up. And then later on, in 1937, St. Anna's in Leominster re-founded as a parish. But prior to that, there were only two locales in this area that had an Italian-speaking priest: Worcester, and later, Mount Carmel, and St. Anthony's in Fitchburg. LINDA: Now, when St. Anna's… LEO: You know, mother would go up every once in a while to go to confession there. But she would always attend mass at St. John's in Clinton. Because at that time, even though the sermon was in English, then the object was to attend mass, which was in Latin. And during the mass, they would pray and say their rosary and things like that. They had more personal devotion in celebration of the mass rather than in the sermon. The mass meant more to them than what was being said in the sermon. That was their faith, they were communing with the celebration of the mass, receiving communion, saying the rosary and prayers, and that meant more. Those were the acts of devotion, I think, for them. LINDA: Must have been… LEO: In Leominster. Yeah, I always worried more -- your first time or the ∂second time? LINDA: First time. LEO: Yeah. I was hoping that when I was ordained I would be assigned there. But for some reason or another -- I guess I was ordained thinking I was going to succumb to cancer. I had had the cancer operation my last year in the seminary, in my fourth year, and they didn't know whether I would be 15 living to be ordained in my class or whether they would ordain me before my time and before the rest of my class because of the nature of my illness. And at that time, when you were operated on for cancer, you had the -- they used to say the cure came -- wouldn't come until five years later. You had to wait five years to know whether you really got it or not. And so at that time, when I was first ordained, I know that the priest, the pastor who was at St. Anna's, wanted me to go there. LINDA: And who was that? LEO: It was Monsignor Gannon, Father Gannon. And I wanted to go there, too, because I liked him very much. But the bishop had other plans. He sent me to this small parish in South Barre, thinking, I suppose, for health reasons, it would be better for me to be in a small parish. But once Bishop O'Leary passed away and Bishop Wright became the bishop at the diocese, and Father Gannon or Monsignor Gannon then became the Chancellor of the Diocese, I was then sent up to St. Anna's in Leominster where he wanted me before and where I wanted to go before. So I was thrilled. To answer your question, I was thrilled to be at St. Anna's. I always loved that parish and still do. INDA: When you think of St. Anna's, what comes to your mind? LEO: Well, just I liked the people there, and I just liked everything about the spirit that prevailed there. I think I was young at the time, and the people were very cooperative. And no matter what you turned your hand to, it turned into success. And it was a source of great joy and great happiness for me to be working among these people and in the course they were going. LINDA: Were you the first Italian priest to be there? LEO: I was the first Diocesan Italian. When I was -- there was a pastor there when Monsignor Gannon went to become Chancellor, Father John Bassey then became the first Italian priest at St. Anna's, and I became the second.16 LINDA: Were your parents… LEO: Yeah. LINDA: How did they feel about you? LEO: Oh, they liked that. They enjoyed that, because they knew a lot of people too from the area, from Leominster. Leominster and Clinton are very close to one another. And there were a lot of mutual friendships that they had in this area. So they were very pleased with my being there. LINDA: What kinds of duties did you have, first as assistant? LEO: Well, you did everything, you know. You were in charge of the religious education. And you were having the altar boys, to take care of training the altar boys at the time. You had the religious education classes for the children who were going to public schools, setting up the classes for that and the courses for it. You had all of the duties, you know, like visiting the sick and going up to the hospital. At that time, at that time too we had, you know, a lot of activity for the youngsters, the different basketball teams that you were in charge of. But then also putting on activities, different activities. Each year, we put on a minstrel show, and we'd be involved in a lot of the direction of that. So there were all kinds of spiritual activities that you were involved in. You had your hand in almost everything except the administration in the parish. You really did all other work that was assigned to a parish and to a priest. LINDA: So it was much like being a pastor? LEO: Right, right, right. It was very active, very fulfilling. I enjoyed the task, I really did. As I said, the people were great. I mean, they cooperated. One of the great things was having a Humane Society, which was for men. I had the Men's Society; the pastor had the Women's Society. We had built ourselves up to over 400, about 450 men. We used to go to communion as a group every year. Every month we'd have 17 [unintelligible - 00:46:22] Sunday. That was a great joy and task, but I enjoyed it, at Leominster. And the other great thing was I had great rapport with the young people, and especially the high school youngsters and the football team. I used to hear their confessions before the football games. They used to come to communion every Saturday morning before the game. And you'd have all these young high school kids come in to confession on Friday night and then coming to mass on -- even public school kids. We even had the parochial school kids. And they'd come to mass on Saturday morning and they'd receive communion and go home and play football games in the afternoon. That was another wonderful thing that happened that I did. LINDA: Was there a school affiliated? LEO: At that time, no. But that was another great accomplishment that I was there to initiate the beginning of a school and to be in charge of developing a parochial school in the parish that we started. And then the task of setting up the classrooms for the first two classes, the pre-primary and the first grade, and building the classrooms for them and later on laying the plans for the school. So that happened in my time. And I remember saying to the bishop that this was the only thing that the parish lacked at the time was our own parish school. LINDA: When did the school open? LEO: It opened in 1951. LINDA: Was that when you were assigned to Leominster? LEO: It opened up in '53, I'm sorry… '53. LINDA: Okay. You accomplished all that in two short years? LEO: At the school, yeah. Like the first and second grade, but then I was transferred after -- then following that, the school was built. Right after I left, they started to build a school for the other grades that were to follow. LINDA: Okay.18 LEO: There were really no major areas of concern, I don't think, other than they wanted their parish, and then they wanted various services. They wanted educational programs for their children, religious educational programs for their children. And they were very -- the women were tremendous at St. Anna's. St. Anna's Society was a terrific group of women who worked hard and who ran spaghetti suppers and raised money in order to build and redecorate the church and keep different things going to provide for a rectory. And they were very tremendous and very, very much engaged in the parish in order to keep things moving and growing and building. It was really nice and remained -- it was impressive, you know. And at that time when I was there, they had a great program of religious devotions and activities and social activities that brought them together and enabled them to have a wonderful spirit within the community and the parish. LINDA: How did you feel -- I mean, not St. John's but Holy Cross? LEO: It didn't bother me at all. I mean, I just was treated very fairly. I never felt any kind of bias against me or toward me. And I felt I had every opportunity that everyone else did there. I don't think I was looked down upon in any way because I was Italian. I think the whole atmosphere was very good. It was all up to you to do what you -- I was going to Holy Cross because it was a good school and [congregation]. And I never had any -- being Italian never bothered me because there were so many other kids in my class that were Italian. LINDA: At Holy Cross? LEO: At Holy Cross. Especially, you know, from New York and the New York area, other areas of the country. It didn't bother me, you know. LINDA: Did you feel the same way at the seminary? LEO: At the seminary, it was the same. I really never felt that the Italian got in the way, you know, being Italian. The way people accepted you and 19 treated you was, you know, it was [unintelligible - 00:52:51]. You know, you may have to take this off. LINDA: Okay. We had an interruption. We stopped just for a few minutes to make sure that this is working. So please stand by. Okay. LEO: All right. LINDA: Did your parents always feel as accepted as you did, do you think, being Italian? LEO: I think my father had a hard time in the beginning when he came over because at that time, I know he had trouble going to church, in the upper church, that they were not allowed to go up and attend mass in the upper church. LINDA: What does that mean, the upper church? LEO: Well, at St. John's, there was a lower -- there was a church, a lower church and an upper church. You know, two floors, two levels. And in order to go into the upper church -- I think he used to have some troubles because if you didn't have what you called the coinage, the coin of the realm to go in, you were told to go downstairs to mass. And that bothered him. But then after a while, that changed, and it never endangered my father's faith. But it was very hard for him to take initially to be restricted as to where he would go in church, you know. So, you get over that. But I am… LINDA: And when did that stop? LEO: Oh, I think that stopped when he was older, when he was able -- when he became more [unintelligible - 00:55:10] and had the money to pay the initial [unintelligible - 00:55:14] lying on that seat, what they used to call the arbitrary fee in church. And he went in. 20 But see, the Gannon people never had to use money or to give money initially. The state financed the churches usually, so the people were never asked for money. LINDA: Let's stop for one minute, please. LEO: Yeah. LINDA: Linda Rosenbaum again, and we have continued the interview. … explaining about your father, how he felt a little different than you about being Italian because of probably the period of time. LEO: Right. LINDA: And you explained the church in Clinton, and then you were explaining the churches where they were not funded by the people. LEO: Right. And so that was strange for an immigrant, and especially Italian immigrants, to come over here and be expected to give money in order to go to church, for a seat fee and things like that, because they never had that practice in Italy. And at the time, they just didn't understand it. And they weren't ready for it then. But once he got on to the fact that this was the way it is here in this country, then he began to pay for his seat fee, as they called it, the pew fee, and then he -- then there was no problem at all. Although at times -- you see, in Clinton, Clinton was strongly Irish. It's an Irish community, a lot of Irish in Clinton at the time. The Polish had their church, and there weren't many French people in Clinton. The majority were either the Irish Catholics and Italian Catholics. I remember that's where Protestant people, especially in certain sections of the town. So at first there was -- at times, it was difficult to be -- yeah, some people would probably show great prejudice against the Italians in Clinton. In growing up, you know, sometimes you'd hear it. You know, you'd get a flavor of it. But it never seemed to be that much, and my father never 21 made much of it. He never, you know, exposed us to any difficulty in this regard or complained about any difficulty in this regard. He got along very well. He had a wonderful personality and then being a barber, he was well-liked in town, and he got along very well. And then they used to have their own little Italian community, their clubs, and they would go together and sit down, have their own socialization periods together. They would play cards or they'd have their own little friendly meetings in their clubs. And so it didn't seem to bother anyone. But every once in a while, you might get a flare-up of the Irish, being a little strong against the Italians. LINDA: Can you remember anything specific? LEO: Nothing really. I don't remember anything, none that I ever got hurt by, you know. You know, you just have that idea of having experienced or heard it said, you know, or some remark made. But then, you'd say, oh, it's that individual. It's not that whole class of people. It's that individual that has prejudice or bias. But there were feelings, there's no question about it, at times. Because you were Italian you didn't get the jobs or you didn't get the positions in school and things like this, you know. The teaching positions, the Italians didn't get a job as a teacher because of… But that was all political then because they would -- you had to run for an office or have somebody in office to kind of vote you in on the school committee. That was kind of a political thing where the majority of people voting for these committee members were Irish, and they would be the ones who would be in charge of making decisions for these appointments. So it was pretty hard to break the barriers there. But after, you know, really after the war, a lot of that all came crumbling down, you know. LINDA: After World War II?22 LEO: Yeah. During -- you know what I mean, everyone was involved in the war. And all families were there, and young men from all nationalities were involved, and so that whole idea of [unintelligible - 01:01:47] hear this, sometimes I did. But I know I didn't, no more than some place. Some of the Irish Leprechaun Club, you know, I was an honorary member of the Leprechaun Club, you know. LINDA: When was that? Was that in Clinton? LEO: Yeah. Yeah, that was some years ago now. But you know, I think that's -- you wouldn't see that, I don't think, around here now because they're in all kinds of professions in Clinton. LINDA: Uh-huh. LEO: And activities, and so… LINDA: So was that quite an honor, getting an award from the Leprechaun Club? LEO: Well, it was -- to me, it kind of showed that the biases were diminished, you know; that those who were not Irish were getting an award from this Irish Society, so to speak. LINDA: Do you remember about the year that you were awarded this? LEO: No, [unintelligible - 01:02:58]. LINDA: We can look for it later and I can insert that information. But it was not while you -- was it while you were living in Clinton? LEO: No. LINDA: No? LEO: No, I was there, but it was after I was a priest. LINDA: Okay. You were a priest. LEO: Yeah. LINDA: So tell me a little bit about the social clubs you had mentioned. I was thinking of a few things. A, there wasn't an Italian parish in Clinton. LEO: They had the Sons of Italy, the lodge of the Sons of Italy. And one group of Italians gravitated toward that. And then… LINDA: You mean from a particular region?23 LEO: Yeah. They'd be from different regions, you know, or different ideas, you know. There were those who felt that a man should have control of what the society has to say. They didn't want to be paying dues to national societies, you know. And for nationals to be taking away some of the money from the town in order to be supported. That was like -- that was the other group, what they called the Liberty Society; they [had too many progressive] Liberty Society. They were a group of Italians who felt that they had their own social group. But they would run things on their own, and whatever monies they made and so forth would benefit just them. And they would develop their own programs, their own health programs and sick programs and their activities, social activities programs. And so there were the two factions: The Sons of Italy and the Liberty Society. And there were groups, different groups, depending on who you were, and sometimes what sections of Italy you came from that was going to be different, these different groups. But it enabled the groups to have something, and they felt strength in their group, their union, and they were able to do things and accomplish things that would benefit them. So they were pleased with this. LINDA: Which group did your parents…? LEO: My father first belonged to the Sons of Italy, but then he decided to form and become a member of the other group, the Liberty Society. They didn't feel to try to be tied in on a national level. They felt that they could do more for themselves by having their own little organization of their own. LINDA: So did you say that he was a founding member? LEO: Yeah, he would have been a founding member in the Liberty Society. LINDA: And what year was that? LEO: Oh, boy. That would have been in the '30s sometime, early '30s. LINDA: And did your mother get involved with any of these societies?24 LEO: My mother was very -- was never very socially inclined, you know, in that respect. She was a homebody. Her home was everything. Her home and her family were everything, and her own little circle of friends. She had her own little circle of Italian ladies. LINDA: Were they all child-raising like her? LEO: No, no, they weren't. But they were in the neighborhood. They were Italian women in the neighborhood. They were never [unintelligible - 01:06:54], no. They were at different ones, some were in average homes. LINDA: Was there ever a language problem between the Italians? LEO: Between the Italians? LINDA: The different dialects? LEO: Not really. LINDA: No? LEO: No. I never encountered any. But my mother just would -- like, when I used to try to get my mother to go out to dinner, you know, she would always say, "No, we can eat at home." She just wasn't a really social butterfly. She was a hard worker and a great cook. Everyone used to love to come there to eat. LINDA: What kinds of things did she make? LEO: Oh, she'd make everything—[gnocchi], ravioli, lamb, all kinds of spaghetti, tortellini, manicotti, lasagna. She was a tremendous cook. One year we had the bar mitzvah. She made eggplant, you know, parmesan, veal cutlets, you know, all these wonderful foods, different types of chicken, cacciatore. She did all kinds of Italian cooking. And she used to bake, make her breads. She -- my mother used to get up early in the morning and prepare meals, you know. We only had a meal -- we always had three meals, you know, one with lunch and one with dinner at night. But then… LINDA: Was it just your sister?25 LEO: And my uncle. My mother's brother lived with us. Yeah. My four sisters. LINDA: Oh, four sisters. LEO: Yes. Four sisters and myself. [Unintelligible - 01:09:07] LINDA: Were you also the youngest? LEO: No, I was next to the youngest. But I always would get the choice piece. My mother would always make sure I was well taken care of. That used to get me angry at times because I didn't like to be shown favoritism at times. But she -- as I say, she didn't like going to these social -- these clubs. She just stayed at home. I don't know if she was shy or what. I think she was just happy in her home with her family, going with her family, going with her little group of friends. She had three or four Italian ladies, and they would come here. I remember them going out every week, they would make the circle, you know, go from one house to the other houses, spend the afternoon with each other and gab and knit and crochet. And then they had their little cordial drink, you know. And it was good. You know, it was always a great consolation. You know, you always come home and she'd always be there, you know. You never came home from school to an empty house or something. But she was always there. And if she wasn't there, you knew where she was. You knew she was at [the neighbor's], you know, this lady or that lady's home, whoever's turn it was. LINDA: It sounds like education was very important to your family. Was it important to your sisters as well? LEO: Oh, yeah. My father -- yeah, my sisters all -- they all wanted to learn, my sisters. One went to -- two went to training in the same business. One went to Boston College and earned a degree in nursing. And the other went to Georgetown and earned her degree in nursing. Then they went on and got their master's degree.26 And then my younger sister went to business school, you know. She picked up the business. She first started out as a lab technician, but then she didn't like it. And she then picked up a secretarial course. And then my oldest sister was a hairdresser. She wanted to be a hairdresser, so -- but my father always kind of encouraged education. He realized he didn't have it. And had he had an education, he would have done more. But he really maintained that we should go ahead and have a -- he encouraged us to go on. LINDA: What kinds of personal… LEO: Personal? Well, as a priest, it's kind of hard to tie into too many personal -- I got along. I tried to get along with everybody. I spoke up on personal things. They used to drive me around because we didn't have cars at that time. Wherever I wanted to go places or do something, I'd have to rely on somebody driving me, you know. LINDA: What were their names? LEO: One was [Analita Tarsey]. And then there was [Ben Veeny], and then the men of the parish. And [Bucky Angelini]. And [Chuck Antelushi]. He's around -- would be helpful to [unintelligible - 01:13:43]. Do you know Ann? LINDA: I don't know her. LEO: Yeah. And her husband. They're in this area. [Unintelligible - 01:13:58] Priest, you know, very personal. She'd do a lot to help me out. And then I was getting teachers for teaching religious classes, you know, religion classes. We had asked her to serve in this capacity. And I remember when I went back as pastor, I wanted her to become the president of the [Sahara] Society, which she did and did very well. And then when I suggested her name for Our Father's House for the homeless in the Fitchburg area, then she became the chairperson for three terms. So 27 I don't know how many terms she had. She must have been the chairperson for the [Madison] Society for a good ten years. Yeah. LINDA: What type of social clubs were there? LEO: They were -- each, it seemed that each province, different provinces of Italy -- you had the [Markagerian], the Singer or Giovani group where they had their own little social club. You had these -- I already said Giovani Club. We had the Santa Maria, their own convent, they were another group from Point [Saray] and St. James and those places. And then you had the Costo Novito, their group. And then other -- there were probably about three or four different. Salladini, the [Giovani], the Salladini Society. They were people from Pretaria and Commo and those places. Yeah, I would say there were about four or five major social clubs, Italian social clubs in Leominster. The only thing that ever united them was the church, you know. Otherwise, they would stay by themselves out here, you know. But the only thing that they kind of worked together on and would get behind together would be the church. And that was the unifying factor that brought them together in Leominster. They never -- and that was a funny thing, you know. You'd see them, the American Giovani would have their own club, the [Vergini] would have theirs. And then you have all the other people. I mean, they were all different groups. And, but then the church brought them together, and they'd get behind the church. And they were very strong and good. They worked together. They worked well together for the church then. But now most of those -- see, those were the old-timers. Today, you don't -- among the young, you don't see that. You don't see those clubs now in Leominster.28 But that was a way for them meeting together. You know, when they came over as immigrants, in the twenties and thirties, this is where they found their strength, in unity, in their own social gatherings, in their groups. Because, you know, no one else would bother with them, you know. LINDA: It's remarkable that they were able to contribute to not only -- there were conflicts there? LEO: Between each other? LINDA: In the church. LEO: In the church, no. LINDA: Perhaps… LEO: The church -- well, the reason was in the church, they had tremendous pastors. They had great leaders. They were with Monsignor Gannon, who first organized and founded St. Anna's Church. He was dearly, dearly revered by the people, and they would do anything for him. And then so on with the pastors who came along. I must say, they were very dedicated and devoted and loyal to their church and to their priests. They were always nice. They did church communion and would get along very well. LINDA: Did we -- I'm sorry. Go ahead. LEO: No, I just remembered, like the Holy Name Society when there were 450 members. And they'd each have their group line up and come to church, and they were from all different sections of Italy. They were unified in that communion of faith./AT/pa/ke/es

Transcript of an oral history interview with General Gordon R. Sullivan, conducted by Sarah Yahm at the Sullivan Museum and History Center on 23 April 2015, as part of the Norwich Voices oral history project. Gordon Sullivan was a member of the Norwich University Class of 1959. After graduating from Norwich University, he served in a variety of Army command and staff assignments in the United States, Germany, Korea and Vietnam. He became Chief of Staff of the U. S. Army on 21 June 1991. The Sullivan Museum and History Center at Norwich University was named in his honor. Topics of interest within the oral history include General Sullivan's Army career as well as his legacy, philosophy, and activities after his retirement from the U.S. Army. ; 1 Gordon Sullivan, NU 1959, Oral History Interview April 23, 2015 Interviewed by Sarah Yahm GORDON SULLIVAN: I have often talked -- I talk a lot to troops and groups and so forth and so on and I'm very quick to tell them that I have been in and around the United States Army since 1955 in one form or another, either as a cadet at Norwich when I took my oath in the summer -- late summer of 1955 -- and obviously as a commissioned officer in the United States Army since 1959, 1995. Then, in my retired life, other than a two-year period when I was doing something in the commercial sector which I frankly didn't -- it wasn't for me. I knew it wasn't for me. I did okay at it but I didn't want to continue doing it. The job was open as the president of the Association of the United States Army, which is the Army's professional association, designed to tell the story of land power and the story of the Army and to do whatever we could to help soldiers and their families. So, in reality, I've spent my adult life in or around the United States Army. Since I retired, in addition to the association and the United States Army, I've done a couple of things which, to me, fit with the way I wanted to live my life. One was to create with three other retired officers an organization known as the Marshall Legacy Institute, Marshall being General George C. Marshall, former Secretary of State who, in 1948, created the Marshall Plan; he and others who worked for him. The essential nature of the Marshall Plan was to help war-torn nations recover in a collaborative way, not in a Big Brother way where we went in and did all the work and they stood by and watched us. It was where we collaborated with them and enabled them to help themselves. So, by happenstance, I was asked, since I had been the chief of staff of the Army to help commemorate the fiftieth anniversary of the creation of the Marshall Plan. I found out that what they wanted was celebratory activities; a cocktail party and so forth and so on, which didn't interest me. So, I found some kindred spirits and we created the Marshall Legacy Institute, which has been around since 1997, and we have over 200 mine detection dogs out around the world. We have raised the money. The State Department has supported us, and these dogs are in some of the worst places in the world, enabling others to take landmines, a silent killer, out of the ground, and to provide safe living and a way of being; food, commerce, and so forth in war-torn countries such as in the Balkans, in Afghanistan, Iraq, African countries like Angola, one of the most mine-infested countries in the world, Cambodia, Sri Lanka, so forth and so on. We have -- those dogs have cleared, along with their indigenous handlers, millions and millions of square you-name-it -- square kilometers or yards or whatever, whatever metric you want, ground for people to live safely. I view that as sort of right up along with everything else I did when I was in uniform. It's the same kind of a business, making the world safe for others to live, save lives, not take lives, save lives. As a part of -- for some reason, let's put it this way. Sometimes in life, things happen that you really don't -- you didn't expect and so forth. I was asked to be a part of a study group in 2006. The study group was on -- conducted by CNA. That's otherwise known in a previous life as the Center for Naval Analysis. Well, I'm an Army general and it was kind of odd to be asked to do something 2 with the CNA but I was asked to do it and I did. It seemed like a good idea at the time. It was to look at the national security implications of global climate change. Well, the implications of global climate change, no matter how you feel about it, the trends of anything related to climate are going in the wrong direction; not the specifics. If you argue point data, there is always someone who has better data or different data. So, that becomes very contentious. All right, I think it was twelve retired admirals and generals were on this study group and by some fluke, I guess, I became the chairman of this group. We published a study in '07 which said that climate change is a national security threat or presents a national security threat to the United States of America. Failed and failing states, whether they failed because of drought or political reasons or why they failed, become like a Petri dish within which extremist groups grow, and that goes from Somalia to the Sudan and you name it; Syria and so forth. Syria was later but the ones we were dealing with at the time were mainly in the Middle East and Africa and we could see it. So, we published that study and it got some attention. Actually, we, within reason, steered away from the maelstrom of political stuff because we were the least likely people to say it. All of us were mostly operators. Now, we had one astronaut, a naval officer, and one of them was a nuclear -- you know, you would expect the Navy because of the nuclear-powered submarines and ships and so forth. So, they were scientists, really, and they had access to data and they knew about the phenomenon. But, the rest of us were either fighter pilots or I'm a ground combat guy or Marine -- Marines; you know, just people with a lot of experience in international stuff and defense and security. So, anyway, that study was replicated in '14 and said, "Well, this is what we said in '07. It's worse." Things got worse, and that's what we said; that not only was it bad then, but it's worse today. Obviously, we had Syria and various other garden spots on the table; Syria, Libya, on and on and on. Arab Spring was caused, in many places, since -- Arab Spring, what became known as Arab Spring, was caused by drought or one of the causes was drought in Russia, which -- and the Russians stopped exporting wheat because they had to -- they had a shortage of wheat so they stopped exporting it. That caused ripples throughout North Africa and Mesopotamia, specifically, Syria. SARAH YAHM: So, I have a couple questions for you, and I do want to -- you know, I feel like we're talking now for a little bit and I do want to sit down when I have more time to prepare and really give a couple hours. GS: I want you to do that. What I'm telling you is I put it all together and my time here at Norwich here as the chairman and it's all a piece. SY: Well, that's what I sense is that you felt this urgency to come in today. GS: I want you to know that in case -- I'm now 77, almost 78. I want to take advantage of you being here, me meeting you, so that you know how I really feel about it. SY: So, yeah, so you feel this urgency about your legacy. So, what -- so, you're telling me something now that it seems like you're afraid isn't in the historical record or won't be in the historical record. GS: It's not. SY: So, is it the idea that this global warming work, this landmine work, that is all part and parcel -- GS: That's all a part and parcel of how I view my life.3 SY: OK, and so you see this linear thread that goes through your life. GS: Yes. SY: So, if you were to articulate the values of that linear thread, how would you articulate it? GS: I think -- I don't know it. I think that when I sit here today, this morning I was talking about -- I was introducing these 200 things that you don't know about Norwich, and I said to myself, well, there's a lot I don't know about Norwich but I know about myself. I don't think I'm unique, by the way, in the history of Norwich. I think I'm just one of the people who went here. So, you have this museum which, you know, is -- I find this hard to say, but, okay, there's this museum here, and you've got some of my stuff. It doesn't -- it's hard -- yeah, how do -- what do I think? How do -- there's some stuff out there. There's nobody but me who could tell you why I think some of those artifacts tell the story. SY: No, you need to interpret the story of your life. GS: Yeah, I need to interpret it. SY: You need to interpret it. GS: It's me. I don't think -- SY: Absolutely. GS: I don't think -- I can go to things out there. I can show you one panel that shows me as a young man struggling to figure out who I am and Norwich, my buddies, this institution enabled me to mature and they didn't throw me out, because I was, struggling. I don't mean that in a -- I was struggling to figure out how I would fit in the world, and I don't think I'm unique and Norwich helped me do that. Okay? SY: Absolutely. GS: So, on the same panel, it goes from me being, you know, this guy I was who was whatever. I'm not apologizing for any of it because I don't have anything to apologize for. But, I can tell you it went from somebody who was immature to the chief of staff of the Army with the woman I was married to for 49 years standing beside me when I became the chief of staff in the Army. I will tell you, I'd do it all the same way and marry the same woman. SY: I think your vulnerability matters, and I think that's something that needs to go in the record, too -- the confusion of being a 20-year old, right? GS: Yeah, the confusion of being a 20-year old and now 70 -- in my late seventies. I'm reasonably healthy but I know my own -- I mean, I'm human. I've figured it out obviously since my wife essentially died, you know. I mean, well, she did die. I'm also struggling. I'm not struggling with it. I think I've accommodated. I understand it all but I know, okay, that's the way it is, and I want you to know it. SY: Yeah, and you're evaluating. You're in a moment in your life of evaluation, right? GS: Yeah, right. What did I do? What did I do with my life? SY: Yeah, and that has to be richer than a list of accomplishments, right? GS: It's not the accomplishments. It's what do you -- how does it fit? I think I am occupying a very large part of the space there, and there are many people like me and I know that, and they should be here, too. SY: Yeah, and we're actually -- I mean, we are collecting their voices, but maybe the key is to figure out how you're representative of a moment.4 GS: Yeah, whatever. You're the expert. I'm just here, and I don't think for one minute -- I have a hard time telling people. I talk about this as 'the museum.' SY: Not the 'Sullivan Museum.' GS: No, no, I don't say that. I have never said it. SY: So, we'll sit down and we'll talk and we'll have you curate the story of your life, you know, and that will help enrich our museum. I also think -- I mean, you oversaw a messy century, you know. The second half of the 20th century was a messy century, right? GS: Well, yeah, here's the cycle, though. I just came back from Germany. I was in the headquarters of the United States Army Europe. I went to Europe for the first time in 1965, 50 years ago, when the Soviet Union, the Warsaw Pact, was right up against the border. I went up into a part of Germany. I was about 40 miles from the inner German border in a tank battalion. I later commanded a tank brigade -- an armored brigade -- in the same division, the largest brigade in the US Army at the time; five maneuver battalions, three tank battalions, two mechanized infantry battalions, about 5000 men and women. There were some women. The Cold War -- so the Cold War is over. I go 50 years later. Twenty years ago, Russia was sort of off the screen militarily. So, I'm sitting in the room and I look out at this expanse of Europe and in Eastern Ukraine, there's this major penetration, this major red thrust. What goes around comes around. In my life, I have gone from an officer who spent twelve and a half years in Germany during the Cold War, became the chief of staff in the Army. I saw the Wall come down and now this, where the Russians are back moving again. I mean, it's -- what goes around comes around, and I'm seeing the nation-state, the concept of nation-states being questioned. Will the Middle East unravel so that it's just tribes? This is -- I mean, this has been in my lifetime, and I've been a part of it, in a sense. SY: No, in a very concrete sense. Does it lead you to despair? Does it lead you to -- GS: No, it doesn't lead me to despair. It leads me to understand that the cycles of history have a way of repeating themselves and it's the human interaction. That's missteps. Did we handle it right? Did we appreciate how -- well, how Russia would perceive what happened when the Cold War ended. How would the Russian people perceive it? Clearly, as an amateur looking at it, people say, "Well, Russia needs --." Russia has needs like any country, and they have always wanted to have the near abroad as a buffer. So, let's say that's real. Let's say that's true for the sake of argument. Then, now we have a nationalist. That's what he is. Putin is a nationalist and he has turned the switch. They sign up politically. They sign up. SY: Yeah, they always do. GS: They always do. They always have, and they are again, and here it is. So, look, that doesn't -- I don't think I'm the first Norwich grad to figure that out. I don't -- I wouldn't -- but it's been a part of my life, and I am what I am. What I am, for better or worse, is a soldier. I'm just a soldier that's retired. SY: Yeah. Could you talk a little about the connection -- so, you know, most of your life was concrete soldiering, right? GS: Yes, real soldiering. SY: Real soldiering. Now, you're talking about specifically this landmine work. How do you see the two as connected, because in one part of your life, you were in charge of --5 GS: Putting landmines in the ground. SY: Yes. GS: Right, and I wasn't -- I am a defender of that because it protects soldiers and so forth and so on because they do protect soldiers. It's one of these strange weapons. They protect soldiers and they kill soldiers. OK, so, in 1997, when I and three combat arms colonels -- retired colonels -- created this thing, this entity, we wanted to do something to help others and it was the mines. Get the mines out of the ground. Everybody was talking mines are bad but they were talking about it. Mines are bad, right? Got it. What are you going to do about it? We wanted to do something about it. It wasn't to philosophize. It was to take them out of the ground, help other people take them out of the ground; like to make things -- make something happen, action-oriented. That's more important to me than all the great ideas of the world. Yeah, global hunger -- I've got it. You know, make the world mine-free. Well, okay, if you want to take mines out of the ground, you can. We've actually, along with others -- there are other ways to take mines out of the ground mechanically and that's a lot of what Princess Diana was involved with -- Princess Diana was involved with and now Harry -- Prince -- SY: Yeah, the royal British family, yeah. GS: So, anyway, we -- so that's -- to me, that fits, okay? SY: Yeah, it's not something -- GS: Now, whether anybody else thinks it fits or not, I don't know, but to me it does. SY: But, to you, it doesn't seem like a contradiction to you? GS: It's not a contradiction to me. SY: Could you talk more about that? GS: Why? What? SY: Well, because I'm curious about getting at your sort of philosophy and understanding so that it does seem part and parcel of the same work. GS: It seems part and parcel of the same work because the country says -- I don't know where we are on the treaty, whether -- the chiefs have said, of which I was one; you know, in my former life, I was one of the Joint Chiefs, a member of the Joint Chiefs. We're protecting South Korea. We're partners with the South Koreans -- Republic of Korea -- and the UN protecting South Korea. Part of that defense involves the demilitarized zone, which is heavily mined. At certain points in Afghanistan and Iraq, I would suspect that there are mines which are -- you can turn them on and off. That type of protection is used, not much but it is periodically. It's there. It's available if they want to use them. I don't view that as much of a contradiction. These things are, as I say, you turn them on and you turn them off. You put them back in your rucksack and unless somebody hits one with a round or something, they're not going to detonate. SY: Yeah, they're safer. GS: Safer. SY: They're not going to get women and children 20 years later. GS: No. That's not -- no, that's not going to happen. SY: You know -- GS: So, anyway, I guess I'm a theory to practice guy. Okay, I've got the theory. I've got the concept and, okay, let's do something about it then.6 SY: That's the thread that goes through your life. GS: That's the thread for me. Let's do something about it. So, global climate change -- national security issue. I came up here and talked about that. You have the speech that I gave down here, and I gave another one at the Society of American Military Engineers, which -- a national security issue for the United States of America is -- and an economic issue and a health issue is we're running out of water -- fresh water -- fresh, potable water. Now, the Corps of Engineers, which US Army Corps of Engineers is responsible for a lot of that in some sense. So, I represent -- I'm trying to tell the Army story, right? It's my job -- Association of the United States Army. The Corps of Engineers is a part of it. The Army Medical Department -- just the researchers and medical researchers just discovered a vaccine which prevents Ebola. Walter Reed was an Army officer. So, we -- Lewis and Clark were Army people. SY: Do you remember, you know, the kid you were at Norwich -- the 20-year old kid -- and the world you lived in then? GS: Yes. SY: What do you think he would have thought of this particular world we're in now, of this US, of this globe? GS: Well, there's some that wouldn't have surprised him, given that I was a history major. I was quoted in the Boston Globe in 1989. I was giving a talk in Cambridge, Massachusetts in the Sonesta. I was at a conference. I was a three-star at the time. I was the chief of operations in the United States Army and before I got up to speak -- I was to speak on doctrine, Army doctrine -- I was handed a note that said, "Heads up. The Wall just came down and people are streaming and streaming into Berlin -- West Berlin." The heads-up was that the press was in the room. So, anyway, I gave my -- whatever I was going to say. The first question I was asked was, "The Berlin Wall just opened. What do you think?" I gave an honest answer. SY: What did you think? GS: I said, "I don't know what I don't know." I didn't. I mean, I was -- you know, I was obviously pleased. That was apparent, but in the back of my mind, I didn't -- you couldn't -- I couldn't predict it. SY: You couldn't -- GS: I couldn't then -- I couldn't predict it and I wasn't going to. SY: Your whole life had been a Cold War world. GS: Yes, I understand that, and I couldn't -- I didn't know what it would mean. Well, what it meant was genocide in the Balkans. What it has meant is a lot of things that aren't good. The whole world that we knew is over time coming apart, like the nation-state. Remember what I said earlier here? Will the nation-state, which was created by -- at the end of World War I -- will those boundaries hold in the Middle East? What about the Balkans? What about the Baltic nations? It's all a part. My uncertainty then -- it's all -- it's still playing out. What's the role of the United States of America? I have no idea. SY: What do you think it should be? GS: Well, I think everybody expects the United States of America to be what it has been since the end of World War II, like the United States of America, the leader; in some sense, the leader. I think we're struggling with that. Are we? Do we really want to be the leader? 7 What about a world where the United States is a reluctant leader? What kind of a world is that? I don't know. That's beyond me. All I know is what I know. That, by the way, if you can figure that out, all I know is what I know or what I feel -- SY: Yeah. Did you have any moments when you had -- when you were talking about you feel gut reactions that really helped you out, that steered you in the right direction? GS: A lot of time, a lot of time. I suppose there is some type that you could say this guy is this type of person. I'm pretty good at reading people. I can read -- I think I am, anyway. That may be a conceit of mine, but I think I am, and I can -- I don't -- yeah, sometimes I go by feel. Sometimes, when I'm doing things, which is why I like the give and take in a meeting, why I need to hear, I want to hear from people. I like ideas. I like the dialog because I learn from it. SY: Yeah, we're thinking a lot about this citizen soldier idea, right, which means a lot of different things to different people but to some people it means having the courage to stand up for what you believe in in moments where it's scary. Can you think of moments like that in your life where you pushed back out of your gut and it was scary? GS: Yeah, well, when you go up to Capitol Hill and you tell people things that politically they don't agree with or if the senator comes from a coal-producing state and you're there telling him that, hey, this climate change is serious, and certainly, one of the causes is carbon, hydrocarbons, whatever, in the air, okay, now don't ask me how many parts per million but for some reason, it's warmer in the last 10 years, like 4 or 5 of the years have been the warmest in recorded history. Something is going on which is warming the planet up. Is that a part of it? Perhaps, probably. You know, he's going to come back -- he or she is going to come back at you and say, "Well, you're smoking dope but it's not. It happens all the time, right?" Well, yeah, but you've got a lot of trends that are going in the wrong direction. Okay, but at any rate, yeah, sure, you know. People said, "Well, we need -- the country needs a peace dividend," which is all well and good. Right after the Cold War, the country did need a peace dividend but at some point, you get so small -- the Army gets so small that you wind up fighting wars. You fight two wars and the strength of the Army -- active Army -- was such that you asked too much from too few and you wind up with soldiers who are psychologically damaged because the same men and women went back and forth and back and forth. You think that's popular to say that? I don't care. It's true. SY: Yeah, I mean, right. You spent a lot of time in Capitol Hill, obviously the most partisan place in the country and you served under -- you were chief of staff under a Republican and then a Democrat, right? GS: That's correct. SY: How did you navigate that partisan world? GS: You just -- well, you know, first of all, you don't -- you're not partisan. I'm not partisan. Nobody knows what I am and that's the way I like it. I'm my own person. I'm essentially an independent and I decide. Frankly, many people like me -- I didn't vote when I was a chief of staff and before. I just didn't vote. SY: Talk about that. GS: Well, I think that that's fine. I mean, I didn't vote. I could have voted but I elected not to because I'm nonpartisan. I'm serving the country. Now, I know people would say, 8 "Well, you know, it's your duty to vote." Yeah, but when I -- the more senior I became -- first of all, I was overseas 17 years out of 36. In spite of what everybody says, getting absentee ballots to some of the places I was -- give me a break. It's not going to happen. You know, all the paperwork; who are you? What do you mean? Who? It wasn't worth it. Then, the more senior I became, it just became -- to me, it didn't make any difference. I was not going to be known as a Democrat or a Republican or anything. I didn't want to be known as anything other than as a soldier. But, I understand very clearly. There is a distinction between citizen soldier and soldier citizen. I always felt I was a citizen first. SY: What's that distinction? GS: Well, the distinction to me was that when I was retired that it was not -- I knew -- I always knew that I would leave the Army some day and that I would do something. Well, it just so happens so when it came, it came. I mean, I knew I was so I got a job. It just so happens that the job I ultimately have is related to the Army. SY: When you were here at Norwich and you were struggling just like any kid struggles, what were you struggling with? What were your ambitions? What were your visions? GS: I didn't know. I didn't know. I told somebody last night that, you know, one of my friends -- he's still a close friend of mine; like I talk to him once a week, anyway. He said to me -- I don't know whether I was a junior or a senior, but he said, "Well, what do you want to do?" I said, "Well, maybe," I think I answered him, "Well, maybe, I'll go in the Army," or maybe at that time I was writing a column for the newspaper for -- SY: The Guidon. GS: -- the Guidon. Sully's -- it was called Sully's Scratchings. I said, "Maybe, I'll get into the newspaper business or something, become a columnist or whatever." I mean, that seemed like a good idea at the time, you know. Whether I could have done it or not, I don't know but I thought it. Well, as it turned out, you know, as it turned out, it turned out. I found what I really liked. SY: When was the moment that you realized you had this passion? GS: In summer camp -- ROTC summer camp. SY: What -- GS: Went to Fort Knox. Well, I was very -- I found it very attractive what -- the kind of people I met there, the noncommissioned officers who were teaching the courses. Officers were sort of distant to cadets. It was the NCOs and I found that relationship in keeping with what I had done during the summer, working. I worked construction jobs and so forth and so on. I liked that kind of stuff, being outside and most of them were men who were doing labor and building things and making things. So, I think I found that attractive. SY: It seemed honest to you? GS: Well, it was honest. Yeah, it was an honest way of making a living, you know, but I knew I didn't want to do it for the rest of my life but -- and I liked that relationship. So, anyway, one thing led to another and I became a commissioned officer and I didn't want to stay a reservist because I thought that being a reservist was -- I mean, I didn't have anything against being a reserve officer but it was just I wanted to be a part of the -- in it, committed to being a soldier. Immediately upon becoming a regular Army officer, I was sent to Korea, and that's where I really, really knew that I was -- had chosen correctly.9 SY: Was there a moment when you knew it? GS: Well, I knew it as soon as I got there because it was -- first of all, the country, at that time -- it was in June of 1961. I had been at Fort Hood for a while but that was sort of kind of getting my feet on the ground. It was very, very under-resourced units and there was not -- it was not fulfilling at all. When I arrived in Korea, we were full up. We were up close to the DMZ. It was real soldiering, and that's where I learned how much I liked it. SY: Did you also learn that you were good at it? Was there a moment when you were like, oh, hey, I'm good at this? GS: No. I felt I was -- probably felt at that time I was a good platoon leader and company commander and I had a staff job for a while. Then, I volunteered to go to Vietnam and you can see a picture of me in that passport I gave yesterday. So, I went from Korea to Vietnam. Some people say, "Well, you know, why?" I said, "Because that's what I thought soldiers did." The chief of staff of the Army asked for volunteers and I thought that's what you do. You volunteer to go to war. That's what I was -- a professional soldier. So, I did that for 18 months and then I came back home. I didn't meet my wife. I knew my wife. I had gone to grammar --I'd gone -- I knew her. We grew up in the same town so I knew who she was as a kid. Then, we were in the same junior high school class. You know, like I'd known her forever. I knew her forever. Then, I went to public school, public high school. I blew that. My mother said, "This is not going to work out," so I wound up at what we called then a country day school -- a private school but not a live-in school. Gay was my classmate in summer school because she couldn't do math either and neither could I so I had to take a summer course. SY: Did you need more structure? Is that what happened with you and public school? GS: Yeah, it's probably the same thing. I mean, it was the same thing that you saw here. I had -- I'm the kind of guy that they would say, "Well, he has lots of talent but he doesn't apply himself because he's with his buddies and doing other things while he should be studying or something else." SY: You were like that at Norwich, too? GS: The same thing. It was the same thing. SY: What were you doing? GS: Well, I was working in the mess hall, selling sandwiches at night to make a couple of bucks for my buddy, actually, my buddy who I memorialized a building for him last week. I was a eulogist at his funeral. One of the things that's sort of fallen to me, you know, whatever, it's the sad kind of stuff is being the eulogist at two -- Jack (Dirgins?) who I came up here as a senior in high school when we both decided to come here. I went to high school with him and Norwich with him, and I'm the godfather of one of his children and I buried him. That's -- you know, that's hard duty -- SY: Yeah, it is. GS: -- because they're my buddies. I also -- my wife told me the day she died -- she said -- she gave me instructions. She said, "I want you to speak at my funeral service, not as an army general, as my husband." SY: Those are good instructions. GS: That's different. I said, "Are you sure?" She said, "I'm very sure." SY: What did she mean?10 GS: She meant she didn't want me to give some Army kind of speech. She wanted me to tell them what kind of a person she was. SY: She wanted you to be vulnerable. GS: Yeah, well, sure, sure. SY: It sounds like she was a good counterbalance. GS: She was a great counterbalance and a huge part of my life. SY: Yeah, 49 years? GS: Forty-nine years. One night she told me -- I was -- oh, I had something going on professionally and so forth and she was -- she said, "Look," we were in the kitchen, just the two of us. I think all the kids had gone by then. She said, "Look, I'm going to bed. I'm tired of listening to you, you know, sort of fuming around and stumbling around." She said, "Just remember this -- suck it up. It's a test." That was it. "Suck it up. It's a test," and it was and she was right, and how I handled it was a test and it all worked out. When I woke up the morning of her funeral and I had been through about eight drafts of what I was going to say, I had papers and notes all over the place. I laid in bed and I said to myself, "What would Gay have said?" She would have said, "Suck it up. It's a test." SY: That's beautiful. GS: Life's a test. I don't know whether I passed or not. It's a test. SY: Do you have doubts? GS: I have no doubts. That's false modesty. That's really not me. SY: So, you do think you passed. GS: I passed. (laughter) I passed. SY: All right! GS: OK? SY: OK. GS: I don't want Norwich -- anybody at Norwich University to think I think I failed. SY: Yeah. What are you proudest of? GS: I'm proud to say I'm a Norwich University graduate. I'm proud to say I was an American soldier and I don't care who knows it. SY: Proud of being a good husband? GS: I'm proud of being a good husband, and a good father, and a good grandfather. I'm proud of all of it. Was I as good a father as I could have been? Probably not. SY: Is anyone? GS: I don't know. I'm sure everybody has their doubts about that. Being a parent never ends -- never ends -- and being a grandfather is a joy. SY: Did you have to be away from them a lot? GS: Well, my children, I did, yes. My wife and I actually raised one of our grandchildren and that was the joy, extra joy, in our life. He's now a junior in college and doing pretty good. He's a good boy, thanks to his grandmother and me to some extent. Anyway, so that's what I wanted you to know, okay? SY: OK.11 GS: Now, I could show you some things in there which are more meaningful than others to tell that story but personally, frankly, I don't think that story holds. I don't think that what's in there -- I'm not arguing for any more space. You could probably do less and do the same thing. You've got some stuff. I mean, I can tell stories about almost everything you've got and how it all fits. SY: But, it sounds like, yeah, you have a slightly different narrative, so what -- GS: I have a different narrative than what a historian would pick out. SY: So, what would your narrative be? GS: Well, I think my narrative would be I can take you right in there right now and start -- and show you stuff that supports what I just told you. SY: All right. Do you want me to take the microphone and we can go in there? END OF AUDIO FILE

Alexander Dugin on
Eurasianism, the Geopolitics of Land and Sea, and a Russian Theory of
Multipolarity







IR has long been regarded as an
Anglo-American social science. Recently, the discipline has started to look
beyond America and England, to China (Theory Talk
#51, Theory Talk
#45), India (Theory Talk
#63, Theory Talk
#42), Africa (Theory Talk #57, Theory Talk
#10) and elsewhere for non-Western
perspectives on international affairs and IR theory. However, IR theorists have
paid little attention to Russian perspectives on the discipline and practice of
international relations. We offer an exciting peek into Russian geopolitical
theory through an interview with the controversial Russian geopolitical thinker
Alexander Dugin, founder of the International
Eurasian Movement and allegedly an important
influence on Putin's foreign policy. In this Talk, Dugin—among others—discusses his Theory of a Multipolar
World, offers a staunch critique of western and liberal IR, and lays out
Russia's unique contribution to the landscape of IR theory.




Print version of this Talk (pdf) Russian version




What, according to you, is
the central challenge or principle debate within IR and what would be your
position within this debate or towards that challenge?



The field of IR is extremely interesting and multidimensional.
In general, the discipline is much more promising than many think. I think that
there is a stereometry today in IR, in which we can distinguish a few axes
right away.



The first, most traditional axis is realism – the English school
– liberalism.



If the debates here are exhausted on an academic level, then on
the level of politicians, the media, and journalists, all the arguments and
methods appear new and unprecedented each time. Today, liberalism in IR
dominates mass consciousness, and realist arguments, already partially
forgotten on the level of mass discourse, could seem rather novel. On the other
hand, the nuanced English school, researched thoroughly in academic circles,
might look like a "revelation" to the general public. But for this to happen, a
broad illumination of the symmetry between liberals and realists is needed for
the English school to acquire significance and disclose its full potential.
This is impossible under the radical domination of liberalism in IR. For that
reason, I predict a new wave of realists and neorealists in this sphere, who,
being pretty much forgotten and almost marginalized, can full well make
themselves and their agenda known. This would, it seems to me, produce a
vitalizing effect and diversify the palette of mass and social debates, which
are today becoming monotone and auto-referential.



The second axis is bourgeois versions of IR (realism, the
English school, and liberalism all together) vs. Marxism in IR. In popular and
even academic discourse, this theme is entirely discarded, although the
popularity of Wallerstein (Theory
Talk #13) and other
versions of world-systems theory shows a degree of interest in this critical
version of classical, positivistic IR theories.



The third axis is post-positivism in all its varieties vs.
positivism in all its varieties (including Marxism). IR scholars might have
gotten the impression that postmodern attacks came to an end, having been
successfully repelled by 'critical realism', but in my opinion it is not at all
so. From moderate constructivism and normativism to extreme post-structuralism,
post-positivistic theories carry a colossal deconstructive and correspondingly
scientific potential, which has not yet even begun to be understood. It seemed
to some that postmodernism is a cheerful game. It isn't. It is a new
post-ontology, and it fundamentally affects the entire epistemological
structure of IR. In my opinion, this axis remains very important and
fundamental.



The fourth axis is the challenge of the sociology of international
relations, which we can call 'Hobson's challenge'. In my opinion, in his
critique of euro-centrism in IR, John M. Hobson laid the foundation for an
entirely new approach to the whole problematic by proposing to consider the
structural significance of the "euro-centric" factor as dominant and clarifying
its racist element. Once we make euro-centrism a variable and move away from
the universalistic racism of the West, on which all systems of IR are built,
including the majority of post-positivistic systems (after all, postmodernity
is an exclusively Western phenomenon!), we get, theoretically for now, an
entirely different discipline—and not just one, it seems. If we take into
account differences among cultures, there can be as many systems of IR as there
are cultures. I consider this axis extremely important.



The fifth axis, outlined in less detail than the previous one,
is the Theory of a Multipolar World vs. everything else. The Theory of a
Multipolar World was developed in Russia,
a country that no one ever took seriously during the entire establishment of IR
as a discipline—hence the fully explainable skepticism toward the Theory of a
Multipolar World.



The sixth axis is IR vs. geopolitics. Geopolitics is usually
regarded as secondary in the context of IR. But gradually, the epistemological
potential of geopolitics is becoming more and more obvious, despite or perhaps
partially because of the criticism against it. We have only to ask ourselves
about the structure of any geopolitical concept to discover the huge potential
contained in its methodology, which takes us to the very complex and
semantically saturated theme of the philosophy and ontology of space.



If we now superimpose these axes onto one another, we get an
extremely complex and highly interesting theoretical field. At the same time,
only one axis, the first one, is considered normative among the public, and
that with the almost total and uni-dimensional dominance of IR liberalism. All
the wealth, 'scientific democracy', and gnoseological pluralism of
the other axes are inaccessible to the broad public, robbing and partly
deceiving it. I call this domination of liberalism among the public the 'third
totalitarianism', but that is a separate issue.





How did you arrive at where
you currently are in your thinking about IR?    




I began with Eurasianism, from which I
came to geopolitics (the Eurasianist Petr Savitskii quoted the
British geopolitician Halford Mackinder) and remained for a long
time in that framework, developing the theme of the dualism of Land and Sea and
applying it to the actual situation That is how the Eurasian school of
geopolitics arose, which became not simply the dominant, but the only school in
contemporary Russia. As a professor at Moscow State University, for six years I
was head of the department of the Sociology of International Relations, which
forced me to become professionally familiar with the classical theories of IR,
the main authors, approaches, and schools. Because I have long been interested
in postmodernism in philosophy (I wrote the book Post-philosophy on the subject), I paid special attention to
post-positivism in IR. That is how I came to IR critical theory,
neo-Gramscianism, and the sociology of IR (John Hobson, Steve Hobden, etc.). I came
to the Theory of a Multipolar World, which I eventually developed myself,
precisely through superimposing geopolitical dualism, Carl Schmitt's theory of the Grossraum, and John Hobson's critique of
Western racism and the euro-centrism of IR.





In your opinion, what would
a student need in order to become a specialist in IR?



In
our interdisciplinary time, I think that what is most important is familiarity
with philosophy and sociology, led by a paradigmatic method: the analysis of
the types of societies, cultures, and structures of thought along the line
Pre-Modernity – Modernity – Post-Modernity. If one learns to trace semantic
shifts in these three epistemological and ontological domains, it will help one
to become familiar with any popular theories of IR today. Barry Buzan's (Theory
Talk #35)
theory of international systems is an example of such a generalizing and very
useful schematization. Today an IR specialist must certainly be familiar with
deconstruction and use it at least in its elementary form. Otherwise, there is
a great danger of overlooking what is most important.



Another very important competence is
history and political science. Political science provides generalizing,
simplifying material, and history puts schemas in their context. I would only
put competence in the domain of economics and political economy in third place,
although today no problem in IR can be considered without reference to the
economic significance of processes and interactions. Finally, I would earnestly
recommend to students of IR to become familiar, as a priority, with geopolitics
and its methods. These methods are much simpler than theories of IR, but their
significance is much deeper. At first, geopolitical simplifications produce an
instantaneous effect: complex and entangled processes of world politics are
rendered transparent and comprehensible in the blink of an eye. But to sort out
how this effect is achieved, a long and serious study of geopolitics is
required, exceeding by far the superficiality that limits critical geopolitics
(Ó Tuathail et. al.): they stand at the beginning of
the decipherment of geopolitics and its full-fledged deconstruction, but they
regard themselves as its champions. They do so prematurely.





What
does it entail to think of global power relations through a spatial lens ('Myslit prostranstvom')?  



This is the most important thing. The
entire philosophical theme of Modernity is built on the dominance of time. Kant
already puts time on the side of the subject (and space on the side of the
body, continuing the ideas of Descartes and even Plato), while Husserl and Heidegger
identify the subject with time altogether. Modernity thinks with time, with
becoming. But since the past and future are rejected as ontological entities,
thought of time is transformed into thought of the instant, of that which is
here and now. This is the basis for the ephemeral understanding of being. To
think spatially means to locate Being outside the present, to arrange it in
space, to give space an ontological status. Whatever was impressed in space is
preserved in it. Whatever will ripen in space is already contained in it. This
is the basis for the political geography of Friedrich Ratzel and subsequent geopoliticians. Wagner's Parsifal ends with the words of
Gurnemanz: 'now time has become space'. This is a proclamation of the triumph
of geopolitics. To think spatially means to think in an entirely different way
[topika]. I think that postmodernity has already partly arrived at this
perspective, but has stopped at the threshold, whereas to cross the line it is
necessary to break radically with the entire axiomatic of Modernity, to really
step over Modernity, and not to imitate this passage while remaining in
Modernity and its tempolatry. Russian people are spaces [Russkie lyudi prostranstva],
which is why we have so much of it. The secret of Russian identity is concealed
in space. To think spatially means to think 'Russian-ly', in Russian.





Geopolitics
is argued to be very popular in Russia nowadays. Is geopolitics a new thing,
from the post-Cold War period, or not? And if not, how does current
geopolitical thinking differ from earlier Soviet (or even pre-soviet)
geopolitics?



It is an entirely new form
of political thought. I introduced geopolitics to Russia at the end of the 80s,
and since then it has become extremely popular. I tried to find some traces of
geopolitics in Russian history, but besides Vandam, Semyonov-Tyan-Shansky, and a few
short articles by Savitskii, there was nothing. In the USSR, any allusion to
geopolitics was punished in the harshest way (see the 'affair of the
geopoliticians' of the economic geographer Vladimir Eduardovich Den and his group).
At the start of the 90s, my efforts and the efforts of my followers and
associates in geopolitics (=Eurasianism) filled the worldview vacuum that
formed after the end of Soviet ideology. At first, this was adopted without
reserve by the military (The Military Academy of the General Staff
of the Armed Forces of Russia), especially under Igor Rodionov. Then,
geopolitics began to penetrate into all social strata. Today, this discipline
is taught in the majority of Russian universities. So, there was no Soviet or
pre-Soviet geopolitics. There is only the contemporary Eurasian school, which
took shape at the end of the 80s. Foundations
of Geopolitics was the first programmatic text of this school, although I had
published most of texts in that book earlier, and some of them were circulated
as texts in government circles. Recently, in 2012, I released two new
textbooks: Geopolitics and The Geopolitics of Russia, which
together with The War of Continents
are the results of work in this field, along four axes. 





In
your book International Relations, not
yet published in English, you set out your Theory of a Multipolar World as a
distinct IR theory. What are the basic components of the Theory of a Multipolar
World—and how is it different from classical realism?



In order to be understood
and not get into the details, I can say that the Theory of a Multipolar World
seriously and axiomatically adopts Samuel Huntington's thesis about the
plurality of civilizations. Russia has its own author, who claimed the same
thing more than a hundred years ago: Nikolay Danilevsky, and then the Eurasianists.
However, everything starts from precisely this point: civilization is not one,
but many. Western civilization's pretension to universalism is a form of the
will to domination and an authoritarian discourse. It can be taken into account
but not believed. It is nothing other than a strategy of suppression and
hegemony. The following point follows: we must move from thinking in terms of
one civilization (the racism of euro-centric versions of IR) to a pluralism of
subjects. However, unlike realists, who take as the subject of their theory
nation-states, which are themselves products of the European, bourgeois, modern
understanding of the Political, the Theory of a Multipolar World proposes to
take civilizations as subjects. Not states, but civilizations. I call them
'large politeiai', or civilizations, corresponding to Carl Schmitt's 'large
spaces'. As soon as we take these civilizations—'large politeiai'—as subjects,
we can then apply to them the full system of premises of realism: anarchy in
the international system, sovereignty, the rationality of egoistic behavior,
etc. But within these 'politeiai', by contrast, a principle more resembling
liberalism, with its pacifism and integration, operates, only with the
difference that here we are not talking about a 'planetary' or 'global' world,
but about an intra-civilizational one; not about global integration, but about
regional integration, strictly within the context of civilizational borders.
Post-positivism, in turn, helps here for the deconstruction of the
authoritarian discourse of the West, which masks its private interests by
'universal values', and also for the reconstruction of civilizational identity,
including with the help of technological means: civilizational elites,
civilizational media, civilizational economic algorithms and corporations, etc.
That is the general picture.





Your
theory of multipolarity is directed against the intellectual, political, and
social hegemony of the West. At the same time, while drawing on the tools of
neo-Marxist analysis and critical theory, it does not oppose Western hegemony
'from the left', as those approaches do, but on the basis of traditionalism (Rene
Guenon, Julius
Evola), cultural
anthropology, and Heideggerian phenomenology, or 'from the right'. Do you think
that such an approach can appeal to Anglo-American IR practitioners, or is it
designed to appeal mainly to non-Western theorists and practitioners? In short,
what can IR theorists in the West learn from the theory of multipolarity?



According to Hobson's
entirely correct analysis, the West is based on a fundamental sort of racism.
There is no difference between Lewis Morgan's evolutionistic racism
(with his model of savagery, barbarism, civilization) and Hitler's biological
racism. Today the same racism is asserted without a link to race, but on the
basis of the technological modes and degrees of modernization and progress of
societies (as always, the criterion "like in the West" is the general measure).
Western man is a complete racist down to his bones, generalizing his
ethnocentrism to megalomaniacal proportions. Something tells me that he is
impossible to change. Even radical critiques of Western hegemony are themselves
deeply infected by the racist virus of universalism, as Edward Said showed with the
example of 'orientalism', proving that the anticolonial struggle is a form of
that very colonialism and euro-centrism. So the Theory of a Multipolar World
will hardly find adherents in the Western world, unless perhaps among those
scholars who are seriously able to carry out a deconstruction of Western
identity, and such deconstruction assumes the rejection of both Right
(nationalistic) and Left (universalistic and progressivist) clichés. The racism
of the West always acquires diverse forms. Today its main form is liberalism,
and anti-liberal theories (most on the Left) are plagued by the same
universalism, while Right anti-liberalisms have been discredited. That is why I
appeal not to the first political theory (liberalism), nor the second
(communism, socialism), nor to the third (fascism, Nazism), but to something I
call the Fourth Political Theory (or 4PT), based on a
radical deconstruction of the subject of Modernity and the application of
Martin Heidegger's existential analytic method.



Traditionalists are brought
in for the profound critique of Western Modernity, for establishing the
plurality of civilizations, and for rehabilitating non-Western (pre-modern)
cultures. In Russia and Asian countries, the Theory of a Multipolar World is
grasped easily and naturally; in the West, it encounters a fully understandable
and fully expected hostility, an unwillingness to study it carefully, and
coarse slander. But there are always exceptions.





What
is the Fourth Political Theory (4PT) and how is it related to the Theory of a
Multipolar World and to your criticism of the prevailing theoretical approaches
in the field of IR?



I spoke a little about this in the
response to the previous question. The Fourth Political Theory is important for
getting away from the strict dominance of modernity in the sphere of the
Political, for the relativization of the West and its re-regionalization. The
West measures the entire history of Modernity in terms of the struggle of three
political ideologies for supremacy (liberalism, socialism, and nationalism).
But since the West does not even for a moment call into question the fact that
it thinks for all humanity, it evaluates other cultures and civilizations in
the same way, without considering that in the best case the parallels to these
three ideologies are pure simulacra, while most often there simply are no
parallels. If liberalism won the competition of the three ideologies in the
West at the end of the 20th century, that does not yet mean that
this ideology is really universal on a world scale. It isn't at all. This
episode of the Western political history of modernity may be the fate of the
West, but not the fate of the world. So other principles of the political are
needed, beyond liberalism, which claims global domination (=the third
totalitarianism), and its failed alternatives (communism and fascism), which
are historically just as Western and modern as liberalism. This explains the
necessity of introducing a Fourth Political Theory as a political frame for the
correct basis of a Theory of a Multipolar World. The Fourth Political Theory is
the direct and necessary correlate of the Theory of a Multipolar World in the
domain of political theory.





Is
IR an American social science? Is Russian IR as an academic field a
reproduction of IR as an American academic field? If not, how is IR in Russia
specifically Russian?



IR is a Western scientific discipline,
and as such it has a prescriptive, normative vector. It not only studies the
West's dominance, it also produces, secures, defends, and propagandizes it. IR
is undoubtedly an imperious authoritarian discourse of Western civilization, in
relation to itself and all other areas of the planet. Today the US is the core
of the West, so naturally in the 20th century IR became more and
more American as the US moved toward that status (it began as an English
science). It is the same with geopolitics, which migrated from London to
Washington and New York together with the function of a global naval Empire. As
with all other sciences, IR is a form of imperious violence, embodying the will
to power in the will to knowledge (as Michel Foucault explained). IR in Russia remains purely
Western, with one detail: in the USSR, IR as such was not studied. Marxism in
IR did not correspond to Soviet reality, where after Stalin a practical form of
realism (not grounded theoretically and never acknowledged) played a big
role—only external observers, like the classical realist E.H. Carr, understood
the realist essence of Stalinism in IR. So IR was altogether blocked. The first
textbooks started to appear only in the 90s and in the fashion of the day they
were all liberal. That is how it has remained until now. The peculiarity of IR
in Russia today lies in the fact that there is no longer anything Russian
there; liberalism dominates entirely, a correct account of realism is lacking,
and post-positivism is almost entirely disregarded. The result is a truncated,
aggressively liberal and extremely antiquated version of IR as a discipline. I
try to fight that. I recently released an IR textbook with balanced (I hope)
proportions, but it is too early to judge the result.





Stephen
Walt argued in a September
article in Foreign Policy that Russia 'is nowhere near as threatening as the old Soviet
Union', in part because Russia 'no longer boasts an ideology that can rally
supporters worldwide'. Do you agree with Walt's assessment?



There is something to that. Today, Russia
thinks of itself as a nation-state. Putin is a realist; nothing more. Walt is
right about that. But the Theory of a Multipolar World and the Fourth Political
Theory, as well as Eurasianism, are outlines of a much broader and large-scale
ideology, directed against Western hegemony and challenging liberalism,
globalization, and American strategic dominance. Of course, Russia as a
nation-state is no competition for the West. But as the bridgehead of the
Theory of a Multipolar World and the Fourth Political Theory, it changes its
significance. Russian policies in the post-Soviet space and Russia's courage in
forming non-Western alliances are indicators. For now, Putin is testing this
conceptual potential very gingerly. But the toughening of relations with the
West and most likely the internal crises of globalization will at some point
force a more careful and serious turn toward the creation of global alternative
alliances. Nevertheless, we already observe such unions: The Shanghai Cooperation Organization, BRICS, the Eurasian Union—and they require a new
ideology. Not one like Marxism, any universalism is excluded, but also not
simple realist maneuvers of regional hegemons. Liberalism is a global
challenge. The response to it should also be global. Does Putin understand
this? Honestly, I don't know. Sometimes it seems he does, and sometimes it
seems he doesn't.





Vladimir
Putin recently characterized the contemporary world order as follows: 'We have entered a period of differing interpretations and
deliberate silences in world politics. International law has been forced to
retreat over and over by the onslaught of legal nihilism. Objectivity and
justice have been sacrificed on the altar of political expediency. Arbitrary
interpretations and biased assessments have replaced legal norms. At the same
time, total control of the global mass media has made it possible when desired
to portray white as black and black as white'. Do you agree with this
assessment? If so, what is required as a response to this international
situation?



These are true, but rather
naïve words. Putin is just indignant that the West establishes rules in its own
interests, changes them when necessary, and interprets allegedly 'universal
norms' in its own favor. But the issue is that this is the structure of the
will to power and the very organization of logo-phallo-phono-centric discourse.
Objectivity and justice are not possible so long as speech is a monologue. The
West does not know and does not recognize the other. But this means that
everything will continue until this other wins back the right to recognition.
And that is a long road. The point of the Theory of a Multipolar World is that
there are no rules established by some one player. Rules must be established by
centers of real power. The state today is too small for that; hence the
conclusion that civilizations should be these centers. Let there be an Atlantic
objectivity and Western justice. A Eurasian objectivity and Russian justice
will counter them. And the Chinese world or Pax Sinica [world/peace: same word
in Russian] will look different than the Islamic one. Black and white are not
objective evaluations. They depend on the structure of the world order: what is
black and what is white is determined by one who has enough power to determine
it.





How
does your approach help us understand Russia's actions on the world stage
better than other IR approaches do? What are IR analyses of Russia missing that
do not operate with the conceptual apparatus of multipolarity?



Interesting question. Russia's behavior
internationally is determined today by the following factors:



First,
historical inertia, accumulating the power of precedents (the Theory of a
Multipolar World thinks that the past exists as a structure; consequently, this
factor is taken into account from many sides and in detail, while the
'tempocentrism' (Steve Hobden, John Hobson) of classical IR theories drops this
from sight. We have to pay attention to this especially taking into
consideration the fact that Russia is in many ways still a traditional society
and belongs to the 'imperial system' of IR.) There are, besides, Soviet inertia
and stable motives ('Stalinism in IR');



Second,
the projective logic of opposition to the West, stemming from the most practical,
pragmatic, and realist motivations (in the spirit of Caesarism, analyzed by
neo-Gramscians) will necessarily lead Russia (even despite the will of its
leaders) to a systemic confrontation with American hegemony and globalization,
and then the Theory of a Multipolar World will really be needed (classical IR
models, paying no attention to the Theory of a Multipolar World, drop from
sight the possible future; i.e., they rob themselves of predictive potential
because of purely ideological prejudices and self-imposed fears).



But if an opponent underestimates you,
you have more chances to land an unexpected blow. So I am not too disturbed by
the underestimation of the Theory of a Multipolar World among IR theorists.





In
the western world, the divide between academia and policy is often either
lamented ('ivory tower') or, in light of the ideal of academic independence,
deemed absent. This concerns a broader debate regarding the relations between
power, knowledge and geopolitics. How are academic-policy relations in Russia
with regards to IR and is this the ideal picture according to you?



I think that in our case both positions
have been taken to their extreme. On one hand, today's authorities in Russia do
not pay the slightest attention to scholars, dispatching them to an airless and
sterile space. On the other hand, Soviet habits became the basis for servility
and conformism, preserved in a situation when the authorities for the first
time demand nothing from intellectuals, except for one thing: that they not
meddle in socio-political processes. So the situation with science is both
comical and sorrowful. Conformist scholars follow the authorities, but the
authorities don't need this, since they do not so much go anywhere in
particular as react to facts that carry themselves out.





If
your IR theory isn't based on politically and philosophically liberal
principles, and if it criticizes those principles not from the left but from
the right, using the language of large spaces or Grossraum, is it a fascist theory of international relations? Are scholars who characterize your thought as 'neo-fascism',
like Andreas Umland and Anton Shekhovstov, partially correct? If not, why is that characterization
misleading?



Accusations of fascism are simply a
figure of speech in the coarse political propaganda peculiar to contemporary
liberalism as the third totalitarianism. Karl Popper laid the basis for this in
his book The
Open Society and its Enemies, where he reduced the critique of
liberalism from the right to fascism, Hitler, and Auschwitz, and the criticism
of liberalism from the left to Stalin and the GULAG. The reality is somewhat
more complex, but George
Soros,
who finances Umland and Shekhovstov and is an ardent follower of Popper, is
content with reduced versions of politics. If I were a fascist, I would say so.
But I am a representative of Eurasianism and the author of the Fourth Political
Theory. At the same time, I am a consistent and radical anti-racist and
opponent of the nation-state project (i.e. an anti-nationalist). Eurasianism has
no relation to fascism. And the Fourth Political Theory emphasizes that while
it is anti-liberal, it is simultaneously anti-communist and anti-fascist. I
think it isn't possible to be clearer, but the propaganda army of the 'third
totalitarianism' disagrees and no arguments will convince it. 1984 should be
sought today not where many think: not in the USSR, not in the Third Reich, but
in the Soros Fund and the 'Brave New World'. Incidentally, Huxley proved to be
more correct than Orwell. I cannot forbid others from calling me a fascist,
although I am not one, though ultimately this reflects badly not so much on me
as on the accusers themselves: fighting an imaginary threat, the accuser misses
a real one. The more stupid, mendacious, and straightforward a liberal is, the
simpler it is to fight with him.





Does
technological change in warfare and in civil government challenge the
geopolitical premises of classical divisions between spaces (Mackinder's view
or Spykman's) heartland-rimland-offshore continents)? And, more broadly
perhaps, does history have a linear or a cyclical pattern, according to you?



Technological development does not at all
abolish the principles of classical geopolitics, simply because Land and Sea
are not substances, but concepts. Land is a centripetal model of order, with a
clearly expressed and constant axis. Sea is a field, without a hard center, of
processuality, atomism, and the possibility of numerous bifurcations. In a
certain sense, air (and hence also aviation) is aeronautics. And even the word
astronaut contains in itself the root 'nautos', from the Greek word for ship.
Water, air, outer space—these are all versions of increasingly diffused Sea.
Land in this situation remains unchanged. Sea strategy is diversified; land
strategy remains on the whole constant. It is possible that this is the reason
for the victory of Land over Sea in the last decade; after all, capitalism and
technical progress are typical attributes of Sea. But taking into consideration
the fundamental character of the balance between Leviathan and Behemoth, the
proportions can switch at any moment; the soaring Titan can be thrown down into
the abyss, like Atlantis, while the reason for the victory of thalassocracy becomes the source of its
downfall. Land remains unchanged as the geographic axis of history. There is
Land and Sea even on the internet and in the virtual world: they are axes and
algorithms of thematization, association and separation, groupings of resources
and protocols. The Chinese internet is terrestrial; the Western one, nautical.





You
have translated a great number of foreign philosophical and geopolitical works
into Russian. How important is knowledge transaction for the formation of your ideas?



I recently completed the
first release of my book Noomachy,
which is entirely devoted precisely to the Logoi of various civilizations, and
hence to the circulation of ideas. I am convinced that each civilization has
its own particular Logos. To grasp it and to find parallels, analogies, and
dissonances in one's own Logos is utterly fascinating and interesting. That is
why I am sincerely interested in the most varied cultures, from North American
to Australian, Arabic to Latin American, Polynesian to Scandinavian. All the
Logoi are different and it is not possible to establish a hierarchy among them.
So it remains for us only to become familiar with them. Henry Corbin, the French
philosopher and Protestant who studied Iranian Shiism his entire life, said of
himself 'We are Shiites'. He wasn't a Shiite in the religious sense, but
without feeling himself a Shiite, he would not be able to penetrate into the
depths of the Iranian Logos. That is how I felt, working on Noomachy or translating philosophical
texts or poetry from other languages: in particular, while learning Pierce and
James, Emerson and Thoreau, Poe and Pound I experienced myself as 'we are
Americans'. And in the volume devoted to China and Japan, as 'we are
Buddhists'. That is the greatest wealth of the Logos of various cultures: both
those like ours and those entirely unlike ours. And these Logoi are at war;
hence, Noomachy, the war of the
intellect. It is not linear and not primitive. It is a great war. It creates
that which we call the 'human', the entire depth and complexity of which we
most often underestimate.





Final
question. You call yourself the 'last philosopher of empire'. What is
Eurasanism and how does it relate to the global pivot of power distributions?



Eurasianism is a developed worldview, to
which I dedicated a few books and a countless number of articles and
interviews. In principle, it lies at the basis of the Theory of a Multipolar
World and the Fourth Political Theory, combined with geopolitics, and it
resonates with Traditionalism. Eurasianism's main thought is plural
anthropology, the rejection of universalism. The meaning of Empire for me is
that there exists not one Empire, but at minimum two, and even more. In the
same way, civilization is never singular; there is always some other
civilization that determines its borders. Schmitt called this the Pluriverse
and considered it the main characteristic of the Political. The Eurasian Empire
is the political and strategic unification of Turan, a geographic axis of history
in opposition to the civilization of the Sea or the Atlanticist Empire. Today,
the USA is this Atlanticist Empire. Kenneth Waltz, in the context of neorealism
in IR, conceptualized the balance of two poles. The analysis is very accurate,
although he erred about the stability of a bipolar world and the duration of
the USSR. But on the whole he is right: there is a global balance of Empires in
the world, not nation-States, the majority of which cannot claim sovereignty,
which remains nominal (Stephen Krasner's (Theory
Talk #21) 'global hypocrisy'). For
precisely that reason, I am a philosopher of Empire, as is almost every
American intellectual, whether he knows it or not. The difference is only that
he thinks of himself as a philosopher of the only Empire, while I think of
myself as the philosopher of one of the Empires, the Eurasian one. I am more
humble and more democratic. That is the whole difference.





Alexander Dugin is a Russian philosopher,
the author of over thirty books on topics including the sociology of the
imagination, structural sociology, ethnosociology, geopolitical theory,
international relations theory, and political theory, including four books on
the German philosopher Martin Heidegger. His most recent books, only available
in Russian at the moment, are Ukraine: My
War and the multi-volume Noomachia:
Wars of the Intellect. Books translated into English include The Fourth Political Theory,
Putin vs. Putin: Vladimir Putin Viewed
From the Right, and Martin Heidegger: The Philosophy of
Another Beginning.






Related links





Who is Alexander Dugin? Interview with Theory Talks editor Michael Millerman (YouTube)
TheFourth Political Theory website (English): 
Evrazia.tv
(Russian) 
Evrazia.tv
(English) 
Geopolitics.ru
(English version)
InternationalEurasian Movement (English version)
Centerfor Conservative Studies (Russian)

Print version of this Talk (pdf) Russian version

Transcript of an oral history interview with Rollin Reiter, conducted by Jennifer Payne on 5 October 2013, as part of the Norwich Voices oral history project of the Sullivan Museum and History Center. Rollin S. Reiter graduated from Norwich University in 1950 and earned earned his master's in business administration from the Harvard Business School in 1952. In his interview, he discusses his experiences running his family's business, Reiter Dairy, as well as his military service in the Korean War and with the Army Reserve and Coast Guard Auxiliary. ; 1 Rollin Reiter, NU '50, Oral History Interview October 5, 2013 Sullivan Museum and History Center Interviewed by Jennifer Payne JENNIFER PAYNE: This is Jennifer Payne with the Norwich Voices Oral History Project. Today's date is October 5th, 2013 and I am here with Rollin—Did I say it right? ROLLIN REITER: Um-hm. JP: Good. Reiter, Class of '50. So, Mr. Reiter, thank you for being here so early this morning. RR: Okay. JP: Where are you from? RR: Born in Akron, Ohio and we live in Canton, Ohio, except eight months a years, we're in Florida. We're Florida residents now in Key Largo, Florida. JP: Nice area. RR: That's where we live. JP: And your age is? RR: I'm eighty-five. JP: Eighty five. And you attended Norwich in 19— RR: Yeah. I came here in 1946 out of high school, graduated high school at Copley, Ohio and, on the farm, and came to Norwich. I didn't know anybody here—know anything about it, but was right after the War. The War was really a defining event in my life and most people of this age. And I got a postcard in the mail that talked about Norwich University. I admired uniforms and I missed, just missed the military. I was—had my physical and was ready to go but then the bomb dropped and everything was postponed. So, I did come to—applied to Norwich and was accepted and came here. My mom and dad brought me up, dropped me off and that was it. There was another student here from Akron area named Crile. I think it was Gary Crile. In Cabot Hall, where we lived, in the basement, there were two Ohio people. So, it wasn't unusual for Ohio students to be here, but that's how I got here was very, very simple. JP: When you were—when you were here, what activities did you do? RR: I was company commander, eventually, of Troop B and I was president of SAE when they had fraternities then. And I was Russ Todd's roommate and the two of us had a lot 2 of fun. Life at Norwich for us was really interesting and fun. And then, I had very good friends here, as most people do that come to Norwich. You develop some great friendships. It was Russ Todd and Jim Ricker and the others in Troop B and SAE. Other than that, I didn't—I wasn't an athlete or any. I did ski a little bit across the hill, across the road. JP: That's great. RR: Yeah. JP: What was it like with Russ Todd as a roommate? Did you guys get in—did you do many tours? RR: I never walked a tour, never walked a tour. Never exceeded ten demerits apparently. I'm just sort of a conformist. I like the military and I like military discipline so I got along okay. Russ was—he's more aggressive. He's a different kind of guy but the two of us hit is off really well. JP: Did you have a nickname? RR: Yeah. I had a couple. My middle initial is Steese and a couple people, like Russ, used to call me Steese. And then, because of my adventures on the range at Fort Meade when we went for our summer training, I was pretty good and some of them called me Alvin. JP: Alvin? RR: For Alvin Yorke, you know? "Oh, Alvin!" JP: Oh, Alvin! RR: Yeah. JP: What was Fort Meade like? RR: That was fun. That was our junior year and we all went to Fort Meade and then we were shipped—we took buses down to A. P. Hill for tank firing because there's no range at at Meade. So we went to A. P. Hill and that was fun. We lived in tents down there for the training and the weekend off, the three of us, Ricker, Todd, and myself went down to Williamsburg and travelled that area and had a lot of fun. Russ had a car so that was an advantage. JP: What kind of car was it? RR: It was a '37 Ford. Yeah. JP: Fun.3 RR: Is that right? Yeah. That's right. Yeah. JP: How big were the tents? RR: Oh, they were two or three man, I think, down there. Most rain I've ever seen in my life occurred at A. P. Hill while we were there. JP: Really? RR: Um-hm. JP: Did you guys get washed out? RR: That's—the Boy Scouts use A. P. Hill even. That's a great place for outdoor gatherings and maneuvers and things and large groups of people. JP: So when you left Norwich, what did you do? RR: Let's see. I graduated in June and Russ took his regular commission. I was offered a regular commission. Didn't take it. I took my reserve commission and went back to Akron and worked at the company dairy—at the dairy company, milk and ice cream processing. Applied at Harvard Business School and was accepted and went to Harvard Business School that fall and graduated there in 1952. It's a two year course, MBA. That was very interesting. That was a whole other life at Harvard Business School. That was—having been at Norwich, Harvard Business School was clear the other opposite. It was Ivy League and my roommate was from Yale. He taught me what it was like to be an Ivy Leaguer. We had a lot of fun. He and I had a lot of fun like Russ and I had and we probably had more fun than we really should have but we passed. That was the business school. I was in the Reserve, the Army Reserves, and attended Reserve meetings, out at Boston Army Base during that period. Every week, I would show up and the guys in the unit would say, "You still here? You should be in Korea. How come you're still here?" That's when Korea was on. Everybody was excited about Korea. I attended there and the summer camp there was at Fort Drum, New York. Went to that. Then, I went back to Ohio after business school. Worked at the dairy. Because I had no obligation coming out of Norwich with a commission, like they do, later they had two year, one year, six year. I had no obligation, so I was in the draft. I was ready to be drafted even though I had a commission. So, the only way I could avoid going in as a private was to volunteer. I volunteered for active duty as a reservist and took a three year active duty stint. That was kind of a funny thing that you could be drafted and yet you had a commission and were ready to serve at any time you were really asked to, as an officer, reserve officer. I liked the Army. It was fun. I had—when I was at Norwich, in my senior year, somebody came up from somewhere to talk to us about the Counter Intelligence Corps and going in to Intelligence and that we could go down to Dartmouth and take a lesson or have a lecture or something 4 down there on the Counter Intelligence Corps. I went and I applied. When I went on active duty, I was sent to Fort Holabird in Maryland for the Counter Intelligence school. That had to do with security and all those sorts of things. And then, before you could go overseas, you had to go through your basic armor or arm course which would be armor and I was sent to Fort Knox for the Basic Officer's Armor Course Number One. That was their first one of a certain type of basic course from for armored officers. Because I'd been in about six months, I was the senior guy in the class and all the Class of '51 from Norwich, part of that time—he happened to be aide to General, not Taylor, but anyway, he was an aide to a general there. Shorty somebody. Yeah. Russ and I were, again, together and all these guys from Norwich and I had a car and we had a good time. Then, while we were there, the truce was declared in Korea. That was nice to hear. I was out of there in October and was shipped to Seoul, Korea. Well, to Tokyo, and then assigned to the 308 CIC in Seoul, Korea. I went over there for a year. That was interesting work. Was Counter Intelligence Corps attached to the Eighth Army Forward in Seoul and I worked with the Intelligence people at G3, so Eighth Army there. We had the detachments up on the line at all the online divisions. Then, they had an offer. If you would agree to stay in the Far East for another year, you could transfer back to Japan. So, I did that. After a year in Korea, transferred to Japan. Spent a year there with the 441 st CIC which was out of Tokyo. We were located right downtown in the former Kanpai Thai headquarters along the moat. This place we had was where a couple of Jimmy Doolittle flyers were executed in the garden there. It was a pretty little place. But that's where some of his flyers that had been shot down or captured were imprisoned and killed there in that garden. Then, that tour was up. In '56, I came back to San Francisco on E.D. Patrick Troop Ship. We flew over but we came back on a troop ship. It was full of Japanese and Korean war brides mostly. JP: Really? RR: Just full of them and that was one of the things after the truce that the CIC did a lot of was clear these people. They had to have clearances. When they married a Japanese or Korean, they had—those brides had to be cleared before they could come back to the great PX, like they called it. We had a troop full of war brides and so forth. Up in the prow of the ship, we had a lot of army prisoners, criminal types that were being shipped back to the states. Not war prisoners but criminal prisoners, including one guy had butchered his chef, his mess sergeant or something like that. We, the three of us, officers were coming back in a state room, probably the only three in the whole boat that didn't get sick all the time. It was eleven days in rough weather in December. We were supposedly in charge of these prisoners up in the prow of the ship. It got out of hand. We didn't know anything about guarding prisoners and all like that. Halfway over, we had to call on the Marine detachment that was on board and they took over the prisoners and straightened things out. I'll never forget that. That was fun. We never got above the deck, up on the deck, the whole eleven days. It was so rough. JP: What happened?5 RR: Everything slid off all the tables and it was a mess. The luggage in our state room—we had—three of us were in a little state room. The luggage would keep going back and forth across the floor all the time. Anyway, that was the trip back to Oakland and it was a great experience. I like the Army a lot. I stayed in the Reserve in Akron, was in a Reserve, military intelligence unit in Akron. Taught there in the local command and general staff school. Then, it came time to go to Fort Leavenworth, to command and general staff school and so forth. It was becoming difficult because the business that I was in—I was running the business now myself. It was hard for me to get away as much as was required. Unfortunately, I made the decision to retire from the Reserve. With eighteen years, I retired as a major from the Army Reserve. That's where that stands. I'm retired. That went on and I was very deeply involved in the milk and ice cream processing business in Ohio. We bought—I bought another plant in Springfield, Ohio and we bought branches all around the state. We grew like crazy. We were doing, oh, maybe a hundred million dollars worth of sales when, toward the end there—when I sold the business in 1986 to Dean Foods in Chicago. Then, I went to work for Dean Foods in Chicago. Meanwhile, we had built a really nice business in Ohio. We had some stores. We had a little adventure into the restaurant food business distribution. It was a good—we had a bout five hundred employees at the top. It had grown quite a bit. It was an interesting dairy for Dean Foods to acquire. I went to Franklin Park, the Dean headquarters, and I was responsible for about twenty dairies, mostly in Texas and the South and Miami and Athens, Tennessee and so forth. I had almost three billion dollars worth of sales under me there. I did a lot of travelling. But I was there for a short period because the understanding was, at Dean, when you're 65, you retire. So, on my sixty-fifth—near my sixty-fifth birthday, I was allowed to finish out the fiscal year, walked out, and that was it. That was a great experience because I was there with no obligation beyond doing what I'd been brought in to do. I wasn't concerned about my future or anything like most of the people in the company. I was sort of a free spirit. I enjoyed that a lot. Dean was a great company to work for. They have since sold out. They have been bought by a company in Dallas. It's still called Dean and it's still on the New York Stock Exchange and so forth. That was basically my business experience. I retired and we moved straight to Florida to a place called the Ocean Reef Club in Key Largo, Florida. We knew of that because my sister had married a fellow that had property there and was important in the Ocean Reef Club functioning and so forth. We used to visit them. After a few years, they said, "That's it. If you're going to keep coming down here, you've got to get a place." That was good advice. We should have gotten several places. That was 1993, I think. We moved to Ocean Reef, bought a house, became Florida residents. We spend eight months down there and four months back in Ohio, where we kept our home, which is really a nice place too because it's on a golf course and very green. It's stood empty the whole time we were in Chicago. So, that's where we are today. We're living at Ocean Reef Club in Key Largo, Florida. It's sort of a development but there's, around it, there's nothing but state and federal parks. It's not spreading out a lot. You can't go down the road and buy something cheaper like you can up, further up in the state. I became active there with the Coast Guard Auxiliary. I guess I have a thing about uniforms. We joined. My wife and I joined the Coast Guard Auxiliary. This December, we will have been in that for twenty years. I wound up commander of 6 a— the Keys, the units in the Keys, from Key Largo on down to Key West. I had five units and about four hundred volunteers in that, that division. I was the division commander. But that, of course, was all volunteer work. It was very close with the Coast Guard. It was very interesting. They—I was in on their meetings at Key West with Sector Key West. They trained with us and we trained with them. Our people even sat and ran their radio communication sections at their Coast Guard stations. It was really an interesting relationship that we had with the Coast Guard. That was twenty years of that kind of activity too. JP: All those hurricanes! RR: Yeah. I put in eighteen years with the Army Reserve and twenty with the Coast Guard. I never got any retirement because I didn't quite make it the last two years. That's what I've been doing down there, playing some golf. My wife plays tennis and golf. We belong to the local racket club. That really is our life there. They have a unique unit called OR Cat, Ocean Reef Cat. It has a, we have three hundred feral cats on the property, running around. JP: Three hundred? RR: Three hundred. There used to be more but there's three hundred. They're all neutered and spayed. There's eighty feeding stations that are serviced every day for these cats. You see them. You go down the street at Ocean Reef and you see OR Cats, walking around or hanging around the feeding station or fighting off the raccoons who also eat in the feeding station. We build a really nice room or a building to service these cats. It's a beautiful, air-conditioned building with lots of couches and every cat tree you've ever seen or heard of. There's about a hundred cats in there who can't quite make it on their own outside. We have a veterinarian. We have a groomer and five or six veterinary assistants, running this installation with these cats in there. It's like the Green Briar for cats. It's wonderful! You go in there and these cats come from all directions and climb all over you because a lot of them were probably dropped off. When somebody that mows the lawn, or paints or something has a cat they don't want, they come into Ocean Reef to work. They just drop it off and they know OR Cat will grab it and take care of it. So, there's these wonderful cats and we adopted two of them. They're part of our family. When we go to Florida, there's always the four of us. Dory and I in the front and the two cats sitting in the back, sleeping or walking around or sitting beside us on the armrest. They sort of determine how we do things. We smuggle them into motels where we're not supposed to. Dory won't stay in any place that takes pets. She wouldn't want to stay there. We smuggle our two in in a piece of luggage that looks like a nice suitcase. That's one of our activities down there. We had a boat but we sold that. We're on the water. We have a fifty foot dock. I let my neighbor use it because he's got a seventy-two foot boat and a thirty foot boat. The deal is he can use our dock but he must keep us in fish, all the fish we can eat, when he's always bringing us fresh fish when he goes out. That's the deal there.7 JP: The cats must like that too. RR: Huh? JP: The cats must like that too. RR: Yeah. Yeah. They like that. They're not allowed to go outside. That's the deal when you adopt a cat. You sign that you will not—they can't—they've got to stay in the house. They're all spayed and neutered and well-behaved. JP: That's wonderful. RR: Yeah. They spend their time chasing lizards around the pool. We have a nice pool that's all screened in. There's these lizards that get in the hole somehow. The cats chase them all day and have fun with them. JP: Catch their tails and— RR: Yeah. Yeah. They take their tails off and then they play with them, you know. They never actually kill them. We have to do that. Last—two years ago, they discovered two snakes in our house. They weren't big ones but we knew by their activity that there was something under that chair. We had a little—what they call a corn snake. The kitties discovered that and a week later was another one. You never know down there. It's a funny area for animals and things. Right now, we have a big problem with invasive species of animals in Florida, especially Burmese pythons. Oh. They're taking over the Everglades. They really have. You used to be able to go into the Everglades and see pretty birds and animals and alligators and baby alligators. Now, the pythons have just about cleaned all that out. They claim there may be a hundred thousand pythons in the Everglades. They found they've really acclimated to the Everglades. They're full of pythons now. It's a shame. They've tried to kill them or hunt them out or put bounties on them but it hasn't been very successful. We have those and we have iguanas. They're starting to spread over the area and a couple of other invasive species. It's interesting from a wildlife standpoint. They aren't in Ocean Reef yet but, well there was one python found in Ocean Reef, a big one. They get up to fifteen feet or so. They're big. JP: That's a big snake. RR: Um-hm. Yeah. That's where I am right now. JP: Wow. This business that you sold, your family dairy, this was called? RR: Reiter Dairy. JP: Reiter Dairy and—8 RR: Yeah. My grandfather had started it way back in the Depression. I used to go to work with my dad there back in the thirties. That developed. They were in the butter business and got into the bottled milk business. It was never really very big. It was home delivery in those days. That sort of fizzled out. Then, we became really big in trailer load of deliveries of milk to supermarkets, big stuff, all over the state of Ohio and a lot of private label milk in other people's names, you know, for a supermarket. Then, we got in the ice cream business. We made about five million gallons of ice cream a year, which is not a big operation but it was—it was well-equipped and a good product. We covered most of Ohio out of there. That—they have since moved most of our Akron operations to the plant I bought in Springfield, Ohio. It's still Reiter Dairy down there in a pretty big way. But I haven't been down there to look at that since they've expanded it. In back of all this, I think the basic foundation that was laid, that I achieved at Norwich University was very important in all of this, maybe more so than my MBA training at Harvard. Like Sevie said the other night, there's a secret ingredient here at Norwich University, or a special ingredient that provides, imbues the graduates with a leadership ability through a discipline achieved by military-type life. I think that's a unique thing that is so valuable to Norwich graduates. It's a unique way of life here that they never forget. It just molds the way they approach life with discipline, discipline learned through the military culture. I didn't come here to be a professional military man and I was—I was attracted by the concept of the citizen soldier. I wanted to be able to be a soldier if I was needed and when I was needed but I didn't want to be a professional soldier as opposed to Russ Todd, who went on to be a major general and a division commander. That was—it was so important, I think. Norwich was little when we came here in '46, it was—compare today— today, it was nothing. It was really pretty rough around the edges and the veterans were coming back during that period. We were, for a while, kind of mixed in with the veterans. Then the class, my class, was one of the first really Cadet Corps classes after the War. The veterans, if they were going to be there, had to be in the Cadet Corps, for the most part. That was important for that to happen, I think. They've dropped the fraternities. I don't think the fraternities were very complimentary to the military way of life. There was always a little underlying conflict there, your interests and your loyalties. They did do away with fraternities which I think was a good move. General Harmon did that. That kind of life was very important and I had some great friends. Some of whom have passed on, you know, already. Not too many of us left in our class. We've been treated real nice as old guard. I mean, they—we've been introduced. It's been a—they've taken good care of their old-timers. Yeah. Do you have other questions? JP: I would like to ask, what did advice would you give a rook on how to survive and thrive? RR: Yeah. Yeah. That was one of the questions that you asked me and that's an important question, especially today. I just read a book by Tom Friedlander. He wrote "The Earth is Flat" concept about how we're part of the world economy, which we are. A young man going out into the world today has got a real serious decision to make as to how he's going to approach his job, what he's going to do to sustain his job and not be part of the, part of the economy that doesn't make it. I'd say that to remain in their—retain their integrity and retain their interest in doing a little more than is required in your job and looking for ways to do jobs better. It's the givers who are going to succeed, not the 9 takers. I think it's important for them, going into whatever they do, to be a part for progress and for improvement in order for them to survive. To be one of the survivors, they've got to be one of the people that knows how to improve things and do things in a better way even though it may be threatening, eventually, to their own job but people that can contribute in some way with innovation is what going to be important. Of course, the peak of that would be an entrepreneur that knows how to start his own business and has that determination. That is really great too, I think. It's going to be a tough world out there, a different kind of world, but I think Norwich has prepared them for that in a much better way than a lot of other civilian universities or concepts, especially some of the academic paths that they could choose that—it's got to be pertinent, these days, if they're going to survive and be successful. I think they learn that here. I think that the sciences are going to be extremely important. Be it engineering and that sort of thing, would be a great field to follow. I was reading somewhere, I think it was Harvard Business School, about some of their graduates and where they were going. Some of the more successful have done things like join railroads, Union Pacific or something like that, positive type jobs that have room for innovation and improvement in the economy. JP: Is there anything else you'd like to add? RR: Well, I've been really lucky. I really have. Health has been, I've had some health problems but they've all been fixable. I have two new knees. I had a hip repair. I broke this knee a couple years ago on a rug, slipped on a rug and the doctor in Key Largo said it was the worst break he ever fixed. It was right where the artificial knee is. He put in a steel plate and a cadaver bone and seventeen screws and I've got a, he gave me a copy of the X-ray. It's suitable for framing. I mean, it's really neat. All these screws and wires are in there. He said he couldn't believe it when I got up and walked across the room. He said, "I didn't think you would ever walk on that leg again." JP: You're moving it like nothing's wrong with it. RR: Yeah. As I said, everything that has happened to me, I broke my arm. I broke my shoulder. They've all been fixable. Go to the garage and get it repaired. It's nothing internal that's eating away at you, at least, yet. So, I've been really lucky in that respect. My wife has been so good to put up with nursing me and pushing me around in a wheelchair or whatever has to be done. We've had a great marriage. We have two sons. One's at Arizona State. He's a vice president of Arizona State and his wife is also a vice president in development for their new school of sustainability, whatever that is. Sustainability is a big deal down there. She's set up schools in Amsterdam and Hong Kong and everything with this sustainability concept. The other one, my other son, younger son, is in Chicago at the McCormick Estate, which is called Cantigny. He's in charge of publications and speech writing and all that kind of thing at Cantigny. Cantigny's about a four hundred acre property where Colonel McCormick lived. He was one of the founders of the Chicago Tribune. Colonel McCormick was in the first division, the big red one, in the First World War, an artillery officer. The first battle they fought in France was at a town called Cantigny. So, his home in Chicago was 10 called Cantigny. There's this beautiful estate home, big mansion, home and then the property. He put a museum dedicated to the First Infantry Division on that property. It is first class. It is a beautiful museum. The First Division has meetings there sometimes. Outside, around the museum is a copy of just about every tank that the United States has ever used. They're sitting there, in the grass. Kids can climb all over them. There's an Easy Eight and all kinds of tanks, modern ones and really old ones, sitting around the museum. There's beautiful gardens. There's two eighteen hole golf courses, which are first class courses. It's all open to the public. They've had ten thousand scouts there for a Scout-A-Rama and all kinds of things and weddings. That's where he is. He loves it there, close to his home in the Glen Ellyn area. It's in Wheaton, Illinois is where Cantigny is. Anybody in the Chicago area should visit there. They'll never forget it. That's where they are. I have four grandchildren, two in each place. One of them just got his—in Arizona—one just got his master's in environmental engineering from Stanford. The other is in a discipline, a school for entrepreneurs at Arizona State, in an honors type course, doing really well. That's what they're all doing. I can't think of any other highlights to talk to you about. At Norwich, we did a lot of pranks. We probably got away with much more than we should have, Russ and I. We really did. JP: Care to talk about any of those? RR: We hid behind our authority and that was— that's not really fair. That's not nice. I remember we would take a cigarette and put it, we had M80s, a lot of M80s from having been at summer camp. We had put an M80 and a cigarette, light it, take it down the hall and put it underneath the hall door. The fire door's at the end of the hall. Then, go back in the room. Pretty soon, it be just, "Boom!" You'd dash out into the hall, "Who did that?" And get everybody all excited. Russ told about—I don't remember—when we went around at the summer camp and collected all the guidons from the various units over there with the, telling them they were needed for a wedding that was going to be held. We got away with everybody's guidon and brought them home, I guess. We did a lot of stuff like that. I was surprised. I remember when this time of year, we always had a jug of cider hanging out the window on a string. I mean, that was how you keep it cool. We always had ours hanging up. I didn't see any hanging under the barrel. I think they've straightened that out. They don't allow stuff like that anymore. JP: I've heard about those jugs. RR: Yeah. JP: You'd have a glass jug. RR: Yeah, or a plastic, milk-type jug full of cider, hanging out the window. JP: To keep it cold. RR: Yeah.11 JP: And it would ferment because it wasn't pasteurized. RR: It might. Yeah. It might. But we didn't—there wasn't any drinking problem. I don't even remember a smoking problem. Maybe there was, but I don't remember that. A lot of the things they worry about today, we didn't have those problems that we knew of. Yeah. I remember when we were rooks and the first year, in '46, and once in a while, things would get out of hand. Discipline would break down. The ultimate threat was, "If you guys don't straighten out, we'll call Jackman. Jackman would send the veterans down and straighten you guys out." They did. There were a couple veterans that were really tough and they'd come in and crack down. It was always cracking down. They'd get us out in the hall at night and dress us down and straighten us out and then go back to Jackman. Those were tough days. Discipline wasn't like it should be, like it is now. We did have horses. We had forty horses. RR: Oh, you did. JP: Yeah, my freshman year and the old, grisly cavalry sergeants to go with them. They were really old cavalry guys. The officers brought their own polo ponies with them. Some of the ROTC instructor officers had their polo ponies here. They'd play polo. Then, sophomore year, I think they took all those horses out to Fort Leavenworth or somewhere. Auctioned them off or did something. That was all gone. All the horses were gone and they brought in little tanks. I forget the name of those small tanks, Sheridan Tanks. From then on, it was tanks. The horses were fun. Some guys were better at that than others. They'd take us out there and we'd go up and down those sand hills where the National Guard thing is up here now. We'd go down those hills on our horses. JP: That's pretty hard. RR: Everybody had boots and jodhpurs. It was great. That was more the old cavalry. JP: Well, you turned out all right. RR: Yeah. I had a horse at home in Ohio. When I was at Fort Knox, I chummed around with the guys at the stables and I bought a horse down there. They helped me build a trailer and I trailed the horse home, when I was done at Fort Knox. JP: What kind of horse was it? RR: It was just a riding horse. There's lots of horses down there around Fort Knox so it wasn't hard to find one. The guys at the stables I think helped me find a horse. Meanwhile, I had gone into Louisville and bought a truck. I must have been loaded with money because I paid cash for a nice, brand new Ford pickup. That's what I trailed the horse back home with. That was fun. That's about it. JP: Okay. 12 RR: I thought you might be interested in. JP: Thank you very much for your time. RR: Oh. You're welcome. JP: Really appreciate it. RR: Okay. Track 1 ends. Track 2 begins. JP: We're back with Mr. Reiter, talking about the board of trustees. RR: Yeah. JP: Tell me about the board of trustees. RR: Addendum. When Russ came back from Europe and accepted the presidency of Norwich University. That was really an important thing. He called me and asked me if I would be on the board of trustees, which I agreed to do. I forget who the chairman was. Phil Marsilius was chairman. I was on the board for a while and then Phil resigned, retired from the board chairmanship. I became the chairman of the board of trustees for, I think, about fifteen years. JP: When was this? RR: I don't know. It was in the seventies. JP: We can check after. RR: During Russ's period of the presidency, he's the twenty second president. Twenty second or twenty third, I forget. Twenty second, I think. That was a trying time. Russ had some—was difficult to—for him, in some ways, to adjust from the military discipline for getting things done to the academic way of getting things done where everything has to be staffed around a lot and researched. Russ was used to issuing an order and it didn't always work that way. But things worked out for the better. Charlie Adamson then took over as chairman when I left that job. The biggest thing we did, I think, was search for a new president and get Rich Schneider on board. That was a big job. The board worked really hard on that. I was involved but I had people on the board that were very good at doing that search. That turned out great. I remember that, interviewing Rich and others and so forth. That was a good move and it's turned out to be a really great move. Rich has done a marvelous job. He's brought the university into a more modern time. You can see it when you walk around. It's just amazing what's been done as a result. But that was interesting work on the board. There were a lot of great people on that board. I don't 13 think there's very many of them still on there that I recognize but it's been onward and upward and hugely successful, really great. End of addendum. JP: End of addendum. Thank you.

PATRONIZE OUR ADVERTISERS. Low Prices Publishers ot THE GETTYSBURG NEWS 142 Carlisle St., Gettysburg, Pa. IIIIM1I * LITTLE, LTD. AMOS ECKERT Latest Styles in HATS, SHOES AND GENT'S FURNISHING .Our specialty. WALK-OVER SHOE AMOS ECKERT Prices always right The Lute&n puMigging pouge. No. 1424 Arch Street PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Col-leges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and devel-op one of the church institutions with pecuniary advantage to yourself. Address H. S. BONER, Supt., THESE FIRMS ARE O. K. PATRONIZE THEM. Chas. S. Mumper. ^^ FURNITURE Picture Frames of all sorts Repair work done promptly will also buy or exchange any second-hand furniture. 4 Chambersburg St., - - - GETTYSBURG, PA. * 1850^-1902 * Our Name has stood as a guarantee of Quality for over half a Century JEWELlEH AND SIIiVEHS]V[ITj4 214 and 216 Market St., - . Harrisburg, Pa. Latest Designs Prices Reasonable DO YOU KNOW WHERE The Choicest Candies, The Finest Soda Water, The Largest Oysters, The Best Ice Cream, Can he found in town? Yes, at Young's Confectionary On Chambersburg Street, near City Hotel, Gettysburg, Pa. IF YOU CALL ON C. fl. Bloehep, Jemelei*, Centre Square, He can serve you in anything you may want in REPAIRING or JEWELRY. 1 WE RECOMMEND THESE FIRMS. The Pleased Customer is not a stranger in our estab-lishment— he's right at home, you'll see him when you call. We have the materials to please fastidious men. J. D. LIPPY, IXEerelaa.rrt Tailor, 29 Chambersburg Street, GETTYSBURG, PA. CITY HOTEL, Main Street, - Gettysburg, Pa. Free Bus to an from all trains. Thirty seconds' walk from either depot. Dinner with drive over field with four or more, $1.35. Rates, $1.50 to $2.00 per Day. Livery connected. Rubber-tire buggies a specialty. John E. Hughes, Prop. L. M. ALLEMAN, Manufacturers' Agent and Jobber of Hardware, Oils, Paints and Queensware, CETTYSBURC, PA. The only Jobbing House in Adams County. BUS. E. BARBEHEHH, THE EACLE HOTEL Corner Main and Washington Sts. Drag Stoi*e, 36 Baltimore St. HOT AND COLD SODA AND CAMERA SUPPLIES (J. B. Ipfamillei1 Dealer in Hats, Caps, Boots and Douglas Shoes, GETTYSBURG, PA. WEIKERT & CROUSE, Butchers, Everything in this line we handle. GIVE US A TEIAL. Baltimore Street, - Gettysburg. THE PHOTOGRAPHER Now in new Studio 20 and 22 Chambersburg Street, Gettysburg, Pa. One of the finest modern lights in the country. PATRONIZE OUR ADVERTIZERS. X"i. -well dressed eustom.er is tlae best advertis2ment. "We; aim to gi\7-e you tlxe UNTe-west Styles, both, in "Woolens and. IXEalte-Lip. * Ulill m. Selicjman, TaiiOP, 7 ChambePsbupg St., Gettysburg, Pa. R. A. WONDERS Corner Cigar Parlors. A ful'i line of Cigars, Tobacco, Pipes, etc. Scott's Corner, opp. Eagle Hotel GETTYSBURG, PA. Pool Parlors in Connection. GO TO McDannell's Restaurant, 8 Baltimore St., Gettysburg. Everything in Season. Oysters in all Styles. Open from 7 A. M. to 2 A. M. JAMES McDANNELL, Prop. Established 1887 by Allen Walton. Allen K. Walton, Pres. and Treas. Robt. J. Walton, Superintendent. Brown Stone Compaq, and Manufacturers of BUILDING STONE, SAWED FLAGGING, and TILE, WALTONVILLE DAUPHIN COUNTY. PEMA. Contractors for all kinds of cut stone work. Telegraph and Express Address, BROWNSTONE, PA. Parties visiting Quarries will leave cars at Brownstone Station, on the P. & R. R.R. r THE GETTYSBURG JIEKCURY The Literary Journal of Gettysburg College Vol. XI. GETTYSBURG, PA., JAN., 1903 No. 7 CONTENTS "THE MELANCHOLY JACQUES," 218 LYMAN A. GUSS, '04. A CULTIVATION OF SOCIAL QUALITIES, . 222 C. EDwiN BUTLER, '05. REST AND CLEAR THINKING 225 M. DH.I.ENBECK, '05. THE FORCE OF PUBLIC OPINION IN THE RECENT COAL STRIKE 227 EDWARD B. HAY, '03. HAVE WOMEN A SUPERIOR FITNESS FOR TEACHING ? 230 FRANK LAYMAN, '04. THE RIGHTS OF THE PEOPLE, 232 JOSEPH E. ROWE, '04. THE HERMIT'S HOME 234 W. W. BARKI.Y, '04. "PEACE ON EARTH" (Story), . 239 H. S. L., '03. EDITORIALS 245 A New Year's Resolution. EXCHANGES ■ ■ , 24g 218 THE GETTYSBURG MERCURY. "THE MELANCHOLY JACQUES. LYMAN A. GUSS, '04. DRYDEN says in one of his writings: "But Shakespeare's magic could not copied be, Within that circle none durst walk but he." This fact is truly exemplified in his marvellous production "As You Like It." Perhaps the magic is not so real as that found in "The Tempest," yet the wonderful insight which the author had of human nature, as strongly depicted in the play, as well as the idealism associated with its composition and the irregularity of action, give it a magical strain throughout, and this very quality perhaps explains to a great extent its univer-sal popularity. Jacques, the Melancholy, although a subordinate character, is nevertheless an illustration of Shakespeare's intimate acquaint-ance with the tendencies of the human mind under its various conditions. It has been said that Jacques, Touchstone and Audrey were innovations of Shakespeare's own invention intro-duced into "As You Like It," and that they are in no way as-sociated with "Rosalynde"—the source of the play. This fact all the more displays the author's creative power. Jacques, especially, is quite an indispensable character and had he been left out, the composition would certainly be lack-ing in that variety of form and action which conduces so much towards making it interesting. Jacques is classed with Touch-stone, and the melancholia of one and the frivolousness of the other in their conversations render them entertaining and often instructive, as when Jacques explains his own melancholy and the cause thereof. It has been supposed that Shakespeare meant to hold up to ridicule a tendency towards melancholia in his own nature, and that Jacques is merely a representative of himself. If such is the case, of course such tendency has been greatly exaggerated and enlarged upon. The other explanation that Jacques is in- THE GETTYSBURG MERCURY. 219 troduced for the purpose of depicting a phase of French life, seems the more plausible. Shakespeare was a great portrayer of human life and its environment, and it is quite natural that such a character should be developed in the play to bring out the marked difference between such a life as Jacques lived and that of the nobler characters. In Jacques we see the fruits of evil as they invariably fall upon one who disregards the laws of chaste living. Jacques having been in his time deeply en-grossed in much evil, and having had much experience as a sensuous profligate, has now become a confirmed cynic, and is able to see nothing bright in life whatever. Jacques is not a fool by profession and accordingly covets the office of the fool which it is Touchstone's right to hold. He is comical, meditative and witty, but his "merry sadness" per-vades his life throughout and really justifies the statement: "but it is a melancholy of mine own, compounded of many simples, extracted from many objects." Apparently of good parentage, he is a slave to his own feelings and through this very weakness has obliterated every enjoyment from life. In his profligacy he found no lasting pleasure and he, now unable to appreciate the right side of life, gives free rein to his senti-mental melancholy, and rails on the world in general in the turbulence of his passion. He has grown accustomed to this kind of life and even confesses: "I do love it better than laughing." He seems to delight in expressing his dark views of life and ostentatiously vents this contemptuous dislike for men and even life itself. His meditations are often profound and philosophical as when he says : "All the world's a stage, And all the men and women merely players : They have their exits and their entrances ; And one man in his time plays many parts, His acts being seven ages." The other characters are developed in spirit and fortitude amid the wild life of the forest and are inclined to regard life as a sort of merry and frolicsome existence, but Jacques can only 220 THE GETTYSBURG MERCURY. see it as a stern and seriously reality, full of misfortunes and stumbling blocks and scarcely worth the living. We must believe that Jacques is even still in love with his old habits and practices and that the melancholy name which he presents is only the mask of folly. This is quite manifest from his dissatisfaction from the correct standards of living as em-ployed in the duke's Arcadia. He seems to have found a most apt place in which to condemn the world and all in it. He is too foolish to know that his own morbid silence, which he be-lieves to be a virtue by saying, "Why it's good to be sad and say nothing," is only an exposure of his cynical and often pre-tentious wisdom. But for all his apparent fault and vice Jacques has a place in "As You Like It," and a place which no one but Jacques could properly fill. His vice and depravity teach a lesson in morals. His melancholia points out the dejected and dissatis-fied lot of him who practices it. It shows that there is a bright and a dark side of life and contrasts the two in a realistic man-ner. Again Jacques is always acting his own counterpart and his dispensations of satire are really harmless in themselves. He thereby proves to us that the melancholy nature is quite certain to be of no hurt save to him who courts it. Even the wit of Jacques is dampened by the slanderous sentimentality which he hurls at his audience. For instance: Orlando easily gets the better of him in their private meeting in the forest. Jacques says that if he looks in the brook, at the instigation of Orlando, for a fool: "There I shall see mine own figure." Or-lando replies: "Which I take to either be a fool or a cipher." This statement puts the climax on all and Jacques withdraws. In short Jacques is a minus quantity in a minus world so far as he has the power and faculty of enjoying life. Shakespeare has justly been called a poet—not of an age, but of all time and his right to be so called has never been challenged. "As You Like It" goes a great way towards sub-stantiating this fact. The poet's careful handling of his char-acter and his penetrating insight into human nature comprises, in brief, the secret of his success. No one other than he could 221 THE GETTYSBURG MERCURY. have made a Jacques, and no one else could have made him a melancholy Jacques. He is one of the many characters in which the magic of the author wonderfully asserts its power. THE GOLDEN APPLE. When Paris entered college he took an apple there. The first day came three callers, three goddesses so fair That Paris was a-wondered, to know what brought them there. The fair ones cried together, "Come, Taris, noble lad, Where is thy golden apple ? Wouldst thou not make us glad By giving us thine apple ? Be generous, noble lad." Then spake the first fair goddess : "Deep Wisdom is my name, Give thou but me the apple and far shall spread thy fame.— I'll give to thee much learning, a great and honored name." Up spake the second goddess : "Thy apple give to me— Behold a foot-ball hero, an athlete thou shalt be ; And thou shalt have great glory if thou givest it to me." The third smiled on young Paris as but a goddess can— "I'll make thee to the maidens fair—a winsome lady's man." To her the apple Paris gave, and was a lady's man. —77/(? Haverfordian. 222 THE GETTYSBURG MERCURY. A CULTIVATION OF SOCIAL QUALITIES. C. EDWIN BUTLER, '05. THIS subject resolves itself into a question: Should or should not social qualities be cultivated ? The negative side of this question could in no manner be sustained by a body of college students, for they, by the very fact of their be-ing in a college, sustain the affirmative. Their fraternities, their societies, their Young Men's Christian Association and all their organizations speak in favor of such a cultivation. Having done then with the negative side of this question, since it is mutually agreed by all that it should be cultivated, it will be well for us to consider why they should be cultivated, or why we should be advanced in the social life. A man should cultivate social qualities first for his own sake, for his own advancement, for his own pleasure and for the pleaure of others. Witness a man low in life, groveling among the filth and slurps of the city, without a penny to purchase for himself the necessaries of life and without a chance to earn money. He will not starve; he gets food, but how? In the dark night, when all the earth is in slumber, by stealth he comes forth and obtains that which he must have to keep the fire burn-ing within him. He will not associate with others, because he cannot; he lacks something which they possess—social quali-ties. Now witness a man with the social side of his nature fully developed. You see him mingling with the very best people in the town, in the state, and in the nation. Every learned man knows him; all speak well of him and each one is glad to call him his friend. He is much sought after. Behold him going down the street, body erect, a bearing fit for a king, yet a smile and a glad word for all. A tower of wisdom; an encyclopedia of humor and a wealth of wit that rivals the Irish-man. What a vast difference between this and the former man! One the despised outcast of all circles; the other the idol, the light, the joy of every man, woman and child. And not only should one be educated socially for his own THE GETTYSBURG MERCURY. 223 benefit, but for the sake of the home, the family bonds, and the the family associations. The sacred bond of matrimony is the relation of a man and a woman, legally united for life as hus-band and wife. Consider the torture and distress of that man and that woman, if they are uncultivated in social life. Note their offspring, as to paternal and maternal respect. All is not harmony and happiness in that home. The rough, untrained side of nature asserts itself and lo ! wheels of sociability do not work in unison. How unfortunate that home! All around it is gloom and despair; the shrubbery, the fence, and even the very doors frown upon you. You turn your back upon this home and across the street you go, here you enter a yard with roses and shrubbery, thick with foliage. Sunlight is scat-tered everywhere and entering those bright rooms, you are greeted with a smile and a warm handshake. Verily, you say, What peace and contentment there is here! O Life, how en-joyable art thou! But not alone for the individual and for the home should so-cial qualities be cultivated. These would be sufficient causes for their cultivation, if there were no more. However, there is a step higher than the home, and that is citizenship. In order for a nation to rank among the other nations of the globe, she must have a certain degree of social cultivation, and in order for her to rank first, to stand at the head, to be a leader of all other nations—as dear old America is—she must have more than a degree; a thorough development of those powers are necessary. Our beloved land is a government by the people. Each individual in that great governmental wheel is as a spoke in the wheel of a vehicle. Let one be not up to the standard, and the whole wheel is weakened. Let .half a dozen be un-sound and the wheel will totter and fall. How important is it then that every man, woman and child be a sound and faithful spoke, each performing his separate function, not only to the best of his ability, but, in addition, striving to do his utmost in behalf of a nation so dear. The man that can make a home so happy and peaceful, as the one already visited, is the same man that can strengthen this grand republic. He it is that can make 224 THE GETTYSBURG MERCURY. her stand forth as leader, and as head in all industrial and com - mercial, political and governmental, religious and social affairs. America wants you, young man! She has need of you ! She wants you not alone for your own sake, not alone for the home's sake, but for the advancement and elevation of these United States, the home of a free people. She wants wrought deep in every man's heart a full sense of the social qualities in America to-day. AI.CAEON TO HIS LOVB. Sweet as the thyme to honey bees, Sweet as to birds their nesting trees, Are you, Nea, to me. When Aphrodite, in her shell, Came gliding to music's swell, Across the dawn-lit sea ; With flower-inwoven tresses crowned, The rose-lipped goddess smiled around Upon the Naiads near; While all the golden-winged Loves, And softly-cooing turtle doves, Flew round their mistress dear. Most fair she was as gaily borne She came at blush of early morn Along the violet sea. Yet you, sweet maid, are fairer far, More lovely than the evening star, And so shall ever be. —Georgetown CollegeJournal. THE GETTYSBURG MERCURY. 225 REST AND CLEAR THINKING. M. DlIXENBHCK, '05. THE greatest gift that a man receives from his Creator and the one that places him preeminently above all other creations of the Infinite, is the power of reason. He, alone, of all the various forms of life, is able to think intelligently and, by thinking, to arrive at just conclusions. The horse and the dog have a certain instinct, which possibly could be called reason, noticeable in their recognition of persons and objects and often shown in their playful moments. But it is left to man to be the worthy possessor of a faculty, with which he holds up to his mental vision, the different sides of a perplexing question or the arguments for or against a cer-tain course of action, and decides whether the one side is of more weight or of less weight, or, whether it is right or wrong to do that which his nature prompts him to do. This faculty is the reasoning faculty, and is synonymous with clear thinking. Every action is preceded by thought. This is true in all cases, providing the mind is in a normal and healthy condition. Even in moments of extreme danger and in times requiring immediate action, thought must come first. In such instances, however, reason plays but a small part and the action seems prompted by a kind of instinct. There is no time for clear thinking, and therefore the action is not always—and indeed not generally—of the wisest. In our day, we read and hear so much of "intense activ-ity" and "the strenuous life," that we are almost led to believe that rest and clear thinking are not elements in a successful life; that thought and action must be simultaneous ; that there can be no time for meditation. The truth is, however, that rest and clear thought are essentials to success. There must be mo-ments of leisure and rest of active bodily duties in every life, else there can be no growth in either the mental, physical or spiritual natures. 226 THE GETTYSBURG MERCURY. Indeed, most of the great thoughts of the great minds of the world have come to us through the resting moments of the men whom they have made famous. The greatest inventions of the age have been conceived in the quiet and peace of a workshop. Our deepest and holiest and noblest thoughts are the product of our meditations. It is then that reason has full sway and clear, straightforward thinking is accomplished. It is then that we weigh our thoughts and actions in the scale of reason and decide upon our course. Hurry and bustle are in no way conducive to clear thought. That "a rolling stone gathers no moss" is as true from an intellectual standpoint as (rom a financial standpoint. Many instances are related of the deep thoughts of great men while alone and resting. Reason and clear thinking, then, are products of rest, and if we be numbered with the bright and earnest men of our day we must take time to think. THE GETTYSBURG MERCURY. 227 THE FORCE OF PUBLIC OPINION IN THE RE-CENT COAL STRIKE. EDWARD B. HAY, '03. AMERICANS are good natured. They accept the inno-vations of everyday life, annoying though they some-times Be, much as a matter of course. If it rains to-day it will be pleasant tc-morrow. If the individual is wronged, he feels confident that the law will take his part, and eventually cause his rights to be granted. The multitude may be wronged, but they feel that outraged justice will soon be avenged under the watchful eye of Uncle Sam, and all will be well again. Hence it is that public grievances sometimes assume immense propor-tions before the people rise up en masse to enforce recognition of their individual welfare. No other nation would or could patiently endure so long. When, however, the American people unite in their deter-mination to eradicate some evil the stress becomes unendurable and something must give way. If a dead-lock between two op-posing forces over which no existing authority has control is the source of public disturbance, then some supreme authority must be found or assumed. In a nation ruled by its people, public opinion has unparalleled force. If existing laws or precedents will not serve to adjust disputes of universal significance, then public opinion may demand that new laws or precedents be established which will meet the exigencies of the case. Such indeed has been the course and force of public opinion in the recent great coal strike in Pennsylvania. At the start, this strike caused little attention outside the ranks of those then immediately concerned ; namely the miners and operators. Slight disagreements are constantly occurring between capital and labor, resulting in strikes, the small and local character of which causes little general consideration. When, however, a disagreement occurs which takes out of the market a product of the soil in universal use, then the interests of a third party are effected, and this party is the general public. 228 THE GETTYSBURG MERCURY. Thus a-third and most powerful claimant of rights enters the dispute and we may rest assured that this final contestant, being now the party most interested, will compel a recognition of its claims. As is its custom, the force of public opinion developed grad-ually in the late strike as the conditions and causes of the dis-cord became better known, and as individual' interests became more and more generally affected, until finally its impetus was so great as to overcome the strength of the two great antagon-istic forces. There has been but a single parallel in the past decade to this remarkable manifestation of the action and force of public opinion in our land, but this had its source without our borders. Hence, we will venture to say that the Pennsyl-vania coal strike afforded the best opportunity of recent years for the economist to study the various phenomena of public opinion as the ruling force of a free people. First, the people read in their morning papers that the miners of the anthracite coal region had struck for higher wages. Well, a strike was no particular novelty. Nor was there any-thing very marvelous in the fact that men should demand greater remuneration for their services, if they felt they deserved it Curiosity more than sentiment or established opinion led the populace to glance with some interest over the strike situation each day. Some people took sides with the miners, others with the operators, according as their journals viewed the subject, or as similar previous occasions had prejudiced them. The strike became a prominent and interesting topic of discussion. Such a variety of views was to be found that most people were more or less confused and were unable to sustain convictions favoring either side for any considerable time. This was all well enough during the warm summer months. Few people outside the contending combinations were affected then. But, now the Fall comes on apace. People awake to their peril. The contention of these phantom-like forms of labor and capital is no longer a midsummer night's dream. Fall is here, Winter approaches, and still no coal. Rich and poor alike now raise their voices, the former in the interest of their impeded business, the latter in defense of their THE GETTYSBURG MERCURY. 229 very lives. All classes suddenly discover a great interest in common. They rise to protect themselves. But, who are the offenders? Upon whom shall their righteous indignation fall ? Each party in the determined struggle before them claims that the other is the aggressor and brings forth proof to this effect. The outraged populace is bewildered but none the less deter-mined. They move from appeal to request, from request to demand that the dispute be terminated. He, in whom public opinion finds its culmination, the President of the United States, now moves in the matter. With the nation at his back, Presi-dent Roosevelt calls the heads of the opposing forces together for a conference, and requests a settlement in the interests of humanity. Mr. Mitchell for the strikers promptly agrees to accede to the universal interests, leaving the personal grievance of his party to arbitration. But, the operators: no, it is no-body's business but their own if they choose to freeze and starve the nation. They are a power sufficient unto themselves. Now the offenders have at last been discovered and the full force of public opinion swoops down upon their unfortunate heads. Its force is appalling. No power could long resist it. And so we find these haughty gentlemen soon succumb to the inevitable. They are forced to concede to a proposition of their adversaries for settling the dispute, for they are now in the power of public opinion, and public opinion is no recog-nizer of persons. May those hereafter tempted to disturb the public learn from the outcome of this contest that under a government of the people, by the people and for the people, if written laws are inadequate the voice of the people is law. Then the great coal strike of the anthracite miners of Pennsylvania during the Sum-mer and Fall of 1902, with its resultant struggle among the forces of capital, labor and public opinion, will have had a bene-ficent effect by establishing the supremacy of public opinion as an active and powerful arbiter for the interests ol the nation. ■ 230 THE GETTYSBURG MERCURY. HAVE WOMEN A SUPERIOR FITNESS FOR TEACHING? FRANK LAYMAN, '04. IN discussing this question we shall not extend our conclu-sions to the higher grades of the teaching profession, but shall confine ourselves to the ranks where the great body of female teachers are found. It is true that women are at work behind the teacher's desk in many of our higher institutions of learning, but it is the ex-ceptional woman that is found there. The representative fe-male teacher (and this is the one that we must consider in this article), is found in the primary and intermediate grades in town and in the country schools. In these schools we venture to say that women have a superior fitness for teaching. The pupils in such schools are young and so the demand upon the teacher is not so much for scholarship and strong reasoning power as for the faculty of understanding child nature and consequently the ability to teach the most effectively and to discipline for the best interests of the pupil. That women are superior to men in these qualifications we shall now attempt to show. Woman stands in a much closer relation to children than man. She has been constituted the natural nurse of our race, and upon her rests the responsibility of bringing children into the world and of caring for them. For these duties she has been specially endowed with a better understanding of child nature and a readier sympathy for children than man possesses. This intuitive understanding and sympathy goes out not only toward her own offspring but to other children as well as occa-sion demands. The result is often seen in the way in which she adapts herself to the wants of children and wins their con-fidence at times when men in their clumsy ways utterly fail. The value of this better understanding of child nature is es-pecially manifest in the work of instruction. No workman, no artist, can successfully work upon material which he does not thoroughly understand. Perhaps the illustration is crude, but THE GETTYSBURG MERCURY. 23 I nevertheless it is just as true that a teacher cannot really teach without understanding child nature, and, as we have seen, wo-man is endowed with this gift. Woman's superior fitness for teaching is even more manifest in the sphere of discipline. If discipline were merely the work of overawing children, of securing good order by force, then perhaps male teachers would be better disciplinarians. But in the grades where women are found such discipline is positively injurious to the child. Here the demand is for such regulation of conduct as shall strengthen and develop character, such dis-cipline as shall induce right conduct because it is felt to be for the best, not because seemingly good behavior is compulsory. Woman's marked success in securing this kind of discipline is everywhere acknowledged. That indefinable and inimitable way in which she accomplishes her purposes we call tact. It results from her better understanding of child nature. One other fact may be mentioned. It seems to be the gen-eral experience of teachers that male teachers are more success-ful in dealing with girls in the school room, and female teachers with boys. The reason for this I shall not attempt to give. I only state what has been observed in a number of cases. The fact has this important bearing on the question. In every school the boys are the element most difficult to manage prop-erly, and, in her greater success in managing them, woman again demonstrates her superior fitness for teaching. 232 THE GETTYSBURG MERCURY. "S1 THE RIGHTS OF THE PEOPLE. JOSEPH E. ROWE, '04. HALL Rome stand under one man's awe? What, Rome?" These words are not only the utterance of a Roman conspir-ator but the voice of centuries. The cry has not been, "Shall Rome stand under one man's awe?" but, "Shall any nation stand in awe of one man or of a few ?" Every age that has wit-nessed revolutions has echoed with these identical words of challenge. The people in every case have issued the challenge and have struggled incessantly until their condition was im-proved. The Rights of the People are irrepressible. Revolutions have been agitated under widely different pre-texts. Tarquin was driven from the streets of the "Eternal City" because one dared to give him the hated name of king. Nobility was the crime which brought Louis XVI and his in-nocent wife Marie Antoinette to the guillotine. The principal reason for beheading Charles I was his insult to Parliament. But beneath all was the indomitable force of individual rights. Did the Romans exile Tarquin simply because they objected to the title of king ? No. To them the name king was a syn-onym for tyranny and oppression; king meant a suppression of individual rights. Noble birth or tyranny was not the real cause of the execu-tion of Louis XVI. He was the mildest and most untyrannical of all the Bourbons. But his predecessors in their oppression of the people were simply intolerable. Persons were thrust into prison, and even killed, not for any crime, but at the arbitrary command of the king. Taxes were beyond all reason. Fur-thermore, Louis XV had expended the public money—the hard-earned money of the people—in building for himself at Versailles a palace of the most fabulous magnificence, costing the enormous sum of a hundred million dollars. The extrava-gance of the Bourbons in general would almost have put a Nero to shame. Ah, these preceding kings were sowing the seed of the hellish harvest which Louis XVI was destined to reap. THE GETTYSBURG MERCURY. 233 Can we wonder that the rights of the people asserted them-selves even in such a wild bacchanalian revel as that of the French Revolution ? No king has ever kept down individual rights for any length of time. King John was compelled to respect the People's Rights as laid down in the "Magna Charta." Charles I tried to rule without Parliament and was beheaded. George III attempted to enforce upon the American Colonists "Taxation without Representation" and they became "The United States of America." Every nation of the past which has failed to respect these innate rights of man has been wiped from the face of the earth. The once-glorious empires of the East—Babylon and Persia— are known chiefly by the vestiges of their despotism ; Egypt, Greece, Macedonia, Rome and Carthage have played their part, and are no more, and splendid Spain of the Middle Ages has fallen, and is tottering slowly but surely to her grave. Fortunately there is one country which can truly be called "The Land of the Free." It has been founded not upon the sandy foundations of the nations of the past, but upon the rock of her achievements. She has fully realized that Caesar had his Brutus, Charles I his Cromwell, and that George III should have profited well by their example. Her principles are those which have stood the test of time unaffected, yea, more, they are those which time has proven unconquerable. It is only America that recognizes the rights of every man. May she not forget the lessons which may be drawn from the past, but let the secret of her greatness be the ruling principle of the future nations of the world and may her posterity be ever able to sing as she can to-day, The pilgrim spirit has not fled : It walks in noon's broad light. And it watches the bed of the glorious dead With the holy stars by night. It watches the bed of those who have bled, And shall guard this ice-bound shore Till the waves of the bay where the Mayflower lay Shall foam and freeze no more. 234 THE GETTYSBURG MERCURY. THE HERMIT'S HOME. W. W. BARKXEY, '04. AMILE or more southeast of Gettysburg, and a short dis-tance to the east of Spangler's Spring and Rock Creek, on an elevation known as Wolf's Hill, is the home of an old her-mit. On approaching this secluded spot in the woods without any previous knowledge of the existence of this peculiar and eccentric old man, one would scarcely expect to find any human being dwelling there. Every thing seems quiet and lonely and still. The hill is literally covered with pines and rocks. After having fully entered the growth of trees, one seems to be cut off completly from the outer world, and to be cast into a deep solitude. It is truly a desirable place for a man wishing to live entirely alone, free from the cares and anx-ieties of the world. We may well call it the ideal hermit home. A wagon road having been followed a part of the distance, after a while you turn off to the left on a path leading through a thick growth of small pines, the lower branches of which have been trimmed off carefully with an ax, thus unmistaking-ly marking the path. Suddenly the hermitage appears. At once it excites wonder and curiosity, and it is determined to examine every point of interest, which observations we shall at-tempt to offer in the shape of a short sketch. The miniature estate is a pentagon in shape and embraces about a quarter of an acre of cleared land; naturally it is sur-rounded on all sides by woods and artificially it is enclosed with a stone wall about four feet high and two feet thick, built by the hands of the hermit himself who gathered the stones one by one and fitted them carefully in their places. About a foot above the wall is stretched one strand of heavy fencing wire, making it difficult for both man and beast to molest the property. The whole wall, as it were, reminds one of the an-cient idea of a walled city designed to keep the enemy out. That part of the enclosure which has not been utilized as a foundation for buildings, seems to be cultivated yearly as a THE GETTYSBURG MERCURY. 235 garden and a potato and corn patch. The little field is not as smooth and even as gardens usually are. It is not yet free from all the stones, and the whole lot is interspersed with huge boulders immovable by one man's strength. Here and there stands a tree which has not been removed yet. One we ob-served in particular, a tall yellow pine with wide branches which the otd man calls his "Summer Resort." Around it is fixed a circular seat on which he spends many a hot summer afternoon, smoking his soothing pipe and musing. Almost in the center of the pentagon, stands the house which is the main part of the hermits home. Originally it was built in the shape of a cave, the roof extending to the ground on both sides. It is extremely rude in its structure and reminds us somewhat of a pioneer hut. Either end has the appearance of the gable end of a house. Since the erection of this meagre shanty, however, the hermit has built a more convenient end to it, which serves now as the main part of the house. This new addition is about fifteen feet square and ten feet high. It is built of logs rough-hewn, and well fitted together with mortar, thus making the room comfortable in time of cold. The roof has but one slope, and is made of boards and slabs covered with thick tar paper. Three small windows admit light into the single chamber in which the hermit cooks, eats, sleeps and spends the most of his time. Within, the walls are literally covered with pictures of all classes and descriptions. In one corner stands the bed, old fashioned and covered with bed cloth-ing, dirty, torn and tattered; in another a small dingy cooking stove, rusty and fire eaten; in a third, a roughly made desk and table in combination constructed by the hermit's own hand out of the crude material of the forest and resembling very much the table of the pioneer's shanty or the cowboy's shack. This table serves him in cooking and eating and is at the same time the depository of his few books and valuables. A few old chairs and stools help to fill the room. Hanging on the wall is an old rifle with its shot and bullet pouch and powder flask. The floor is carpeted with a few remnants of well-worn carpet with several home-made rugs. On a stand near one of the 236 THE GETTYSBURG MERCURY. windows are some papers, a few old letters, a pen and some ink. On the window sill is a mouth organ and near by hang-ing on the wall, an accordion. All this seems to indicate that the hermit is a man of some education and a lover of music. Standing not far away from the main dwelling house is a cave in which potatoes, apples, et cetera, are kept secure from heat and cold. Directly adjoining the cave is a wood house filled with small sticks of wood gathered round about the forest. On another side of the house proper is an unwalled well about seven feet deep which supplies the hermit with an abundance of pure soft water, agreeable to his physical constitution, as he says. So much now for his home, but let us inquire here, who is this strange old man who has chosen this lonely life in the woods ? He is a German, born in Germany. Listen and you shall hear the story of his life and the reasons for his being here. His name is Jacob Thomas. He sprang from poor but honest, hard-working parents living in the neighborhood of Mannheim in the valley of the Rhine. In 185 1, when the boy was ten years old, he with his parents emigrated to America and located near Germantown, Pennsylvania, where they lived and toiled on a little farm till their son had grown quite to manhood. He was their only child, and at once the comfort and joy of their heart. Every sacrifice was made, many pri-vations were endured in order that the boy Jacob might obtain a fairly good American education, and thereby be fitted to com-pete successfully with his fellow men in the busy life of our nation. But, alas, the scourge of smallpox visited the eastern part of the state, and of the hundreds it laid low in death, were the loving mother and faithful father of Jacob Thomas. The son also was attacked by the leveling epidemic but after a se-vere siege of suffering, he came out victorious over the disease, with its many marics and traces on his face. Poor young fel-low! he was now an orphan, left alone in the world, and scarcely eighteen. Henceforth the battle of life was placed entirely in his own hands. His education could not be finished ; his only support was gone. It seemed to him as if his whole future THE GETTYSBURG MERCURY. 237 would be blighted and full of sorrows and suffering. He dis-posed of the meagre personal property for a small amount of cash, wandered into Philadelphia and buried himself in the populous mass of that large city. He remained there almost a month, doing whatever he could find to do. At last fortune favored, and he obtained a permanent position on board the merchant vessel, Boswell, which was then engaged in the car-rying trade between Philadelphia and Liverpool, England. Ja-cob remained on the sea ten long years. It was a straining life, full of toils and hardships, as well as extreme wickedness and ungodliness. Though thinking often of his sainted mother and godly father who were now in Paradise, yet the temptations were so strong that he fell a victim to the snares and vices of the sailor's life and learned to curse and drink liquor. Twice he escaped death in shipwreck; once off the coast of Ireland and again, off the coast of Virginia. Both times he was saved on the wreckage floating about till rescued by the life-saving ser-vice. Shortly after the last wreck at sea, he quit the ocean, and wandered back into the land of his nativity where he joined the German ranks in the famous Franco-Prussian war in 1871. Here he fcught as a common soldier for Germany ten months, and came out with a severe wound in the left shoul-der, but a better man morally In spite of the worldly in-fluences of camp life, while in the military service he had a vivid consciousness of the sinful life he had been living for ten con-secutive years. He reflected on the innocence of his youth and the teachings of his mother; he thought on the goodness of divine providence in preserving and protecting his life in the storms and adversities experienced thus far in his life, and he was thankful to God for his care. He became penitent and sorry for the degenerate, sinful life he had been leading hitherto. Then and there he determined to change his course and return to the beautiful Christ-life which he had abandoned when he went to sea. He ceased cursing and drinking and many other evil habits he had been practicing, and surrendered himself wholly and completely to truth, sincerity and piety. It was a 238 THE GETTYSBURG MERCURY. remarkable change and marks the beginning of the life he has lived ever since. The Autumn of 1873 found him in the city of New York working on a ferry boat. Not long afterwards he married Jane Gorlity, the love of his youth, and immediately they came to Hanover, Pennsylvania, in order to get away from the crowded city life which he so much detested. Here they lived peace-ably and happily together many years. Their love and af-fection for each other was intense—only strengthened by time. No couple was ever better mated and none lived more agree-ably and found so much pleasure in each other's presence. All who knew them admired them for their simplicity and true-heartedness. But, alas for the separations of Death! He came with his keen sickle and cut the beautiful wife down in the very prime of life and left poor Jacob alone once more in the world. Wounded deep with grief and cast down in sadness, he no more found peace and pleasure among the men and women of his town. He longed for a retreat, a solitude where he could shut himself in from the outer world and spend the remainder of his days alone in quiet meditation in some spot unfrequented by noisy men and prattling children. He left Hanover in quest of such a place and finally located among the pines and rocks on Wolf's Hill, near the historic town of Gettysburg. THE GETTYSBURG MERCURY. 239 'PEACE ON EARTH." H. S. L., '03. ONE more week till Christmas, he thought, and the thought was followed with a sigh. The young man who had been so happy a few months ago when he led his bride to their new home sat melancholy and despondent before the open fire. "She thinks I am rich, but, oh, if she only new the truth. My debts are now greater than I can stand." He heard a soft step at the door which put an end to these thoughts. "One more week till Christmas, my dear, and you haven't told me a thing about our plans. You've forgotten it, no doubt." "O, no," he answered, "I have a surprise." She gave a short laugh and left him alone. He was more dejected than ever. "It's a shame to treat her so. O God, if I only had the heart to tell her!" The fire burned brighter, he grew more thoughtful and began to plan. "Ha! I've got it. What do I care. She doesn't like it, but she doesn't need to know where I get it, or how I get it." A moment later he had put on his overcoat and hat, and was walking rapidly away from the house. The air was frosty and the snow crunched under his feet, the city was brilliantly lighted and shop windows glittered with beautiful things for Christmas. He saw none of them but kept his eyes steadily fixed before him till he came to the club house. A few men were smoking and reading, others chatting and drinking. "Come, let's have a game," said he to one of them. "I need some money." "Ha! Ha! you do, well I guess so after your last game. I don't blame you; come on." This annoyed him somewhat but he took it all and laughed perfunctorily. He played a good game of cards but was rather nervous that night. "How's that," he said, when when he took in the first trick. The other kept silent. One game ended, he had good luck, made a little money, just enough*to put him in a reckless mood. Then was the other's chance, he played a fast and care-ful hand, not the slightest bit of success did Jean have. It 240 THE GETTYSBURG MERCURY. was going hard. The other had begun to speak, to tease, to annoy. "You cheat, you rascal, the devil take it. You, I mean." He grew more and more reckless. The other taking in his tricks and piling up his borrowed money, laughed heart-ily. Jean also pretended to make light of ill luck. He played harder, grew more reckless and flew into a higher temper. The other's jokes were too much, he was tired of jeering. "There, the devil take it," he said, as he slapped down the last cent of borrowed money. The other put the gain into his pocket, jeering and laughing. They were left alone. One word of in-sult and the other gave him a blow that brought him to the floor. He quickly regained himself and in an instant he flew at his opponent. For a few moments they dodged each other's . blows and then the fight grew harder and harder, the other had the advantage for a while, but in a sudden rage grabbed the throat of his opponent and both fell to the floor. He clutched tighter and tighter and with both feet kneeled on his breast. The other released his grip, his eyes turned to a glassy stare and gave a few short gasps. Jean rose and looked at him. The money lay all over the carpet amid bits of broken glass and overturned chairs. Jean gathered it up and walked to the door. He paused a moment and looked at the pros-trate form white and cold, then slammed the door and hast-ened away. Once out in the street he walked to the limits of the city. His heart still beat with the frenzy of the combat. He paused a moment and gazed wildly about him. He fancied that every one he saw walking near him was acquainted with the crime and had come to seize him. Alarmed at the thought he took to his heels and ran. Still the face of his victim haunted him, he heard the last gasps for breath, saw the hands wildly clutch-ing the air; every bush in the darkness seemed to take the form of one he had so cruelly murdered and filled him with terror. On he ran as if pursued by some demon untill breath-less he stopped. He was two miles into the country. The snow was falling and a high wind was blowing it into deep drifts. The gleam of a light from a cottage in the dis- THE GETTYSBURG MERCURY. 241 tance attracted him and almost sensless he dragged himself to-ward the spot. They heard him fall against the door and a man came out and carried him to the fire. When he awoke he found himself in strange quarters. Not knowing how he got there he fancied himself captured, and ut-tered a cry of alarm. The man and wife came to render assist-ance but he would not speak, the face of his victim haunted him, he gazed wildly about and then in a sudden impulse he thrust open the door and rushed out into the night. * * * * * * * $ The winter passed and Spring found him poverty stricken and in rags—a reclues, a self-condemned man far from home. Then followed a period of reflection. He thought of her whom he had wronged. Of his past life. How unfaithful he had been. Why did he not tell her all ? He would go back, con-fess his wrong, and if she could love him again would try to make her happy. By Fall he was again in the city. He passed the large club house where he had committed the deed. No one knew him now; he was in rags. For a few moments he paused and looked into the window. There sat the same old fellows that he had known so well, smoking and laughing. His heart fell and he pressed on towards the house. As he neared it his heart beat faster and faster. How could he approach her? Slowly he ascended the steps and rang the bell. A colored servant answered and demanded his card. He asked for her mistress but she refused him entrance. He persisted and was presently taken from the spot by a policeman. Still he de-manded entrance, insisting that it was his home. The police-man inquired and found that the lady who had inhabited the house a year ago had gone to her father's house. Jean sought her father. Her father met" him and recognized him. "You! how can you ask for her? You! you brought her to her grave. You were false, you betrayed her. Villian! be gone!" He walked slowly away and sobbed audibly. What was life to him now. He had better never have returned. Sad and 242 THE GETTYSBURG MERCURY. dejected he went into the slums. In a few weeks he was a hostler in one of the large city stables. Almost daily some of his club fellows came for horses but he never could look at them, much less speak. He suffered humility in silence. Once or twice some of his fellows thought they recognized him, but he pretended not to notice them. Life was misery, there was no good in the world, not even sleep brought him peace. At night when he lay on his couch in the stable loft the deeds of the past came upon him ; he could not banish them. He was guilty of two murders. ******* * It was early on Christmas morning. The sun was not yet up. Jean could not sleep, he had passed a wretched night. In order to get away from himself he walked down through the large street of the city. Even at this early hour the street was crowded with people; why this was he could not as yet determine. But he followed the crowd, eager for something to deaden the voice of conscience. While he was thus reflecting the "Notre Dame" appeared in the distance. This explained the cause of the crowd on the street at this early hour. But what was the church to him ? He hadn't been in it for years. He hated the church. Never would he darken its doors. He came nearer and heard the sound of the great organ softly playing. He saw the light gleaming through the stained glass windows. But he hated it all. The people were crowding into the Cathedral and Jean standing without was carried reluctantly by the great throng into the church. He took a scat in a dark corner behind a large marble col-umn. The church was not yet fully lighted and he did not care to be recognized. Presently the altar was a blaze of light. The music changed to more measured notes. The priests in gorgeous vestments came forth and bowed down before the high altar. A boy's clear soprano notes rang out over the vast congregation, "Ky- THE GETTYSBURG MERCURY. 243 rie Eleison, Kyrie Eleison." The high mass had begun. He listened for a few moments, enraptured by the scene, half repel-lant, half repentent. The whole choir joined in perfect harmony "Kyrie Eleison." The music changed to a minor strain and an alto sang in plain-tive tones "Christe Eleison." All about him were devoutly praying, but he sat still and stolid,-fighting his better nature. The celebrant from the high altar chanted forth in sonorous tones "Credo in unum patrem Deum." The choir answered in majestic movement and began the second chorus of the Mass. Jean sat there dazed, a feeling of wild unrest came over him, the lights danced before his eyes. The music grew grander and grander, ever rising in power till it reached a climax. A short pause followed, the organ modulating the while when the choir sang softly the words "Et Homofoetus est." The whole congregation fell upon its knees and Jean scarcely conscious of what he was doing knelt down with them. All through the Mass he knelt, absorbed in prayer, paying no attention to the seryice till he was interrupted in his meditation by depart-ure of the people with the notes of the "Dona Nobis" dying away in the distance. Jean did not join the crowd. The silent church was better. He meditated. A priest crossing the altar seeing him there alone came to to him, in the hope that he might assist him. They spoke for a few moments and then entered the confessional. He was silent for some time, he could not speak, words failed him. "Take heart my son, I am waiting," said the priest. I want to confess murder he said in stifled tones. "Murder," said the priest horrified. "You can't confess that to me; take that to the law." "But I can comfort,perhaps; let me hear." Jean related the past and the priest listened attentively- What! you ! exclaimed the priest, interrupting the confession- Jean paused and the priest came to him. He crouched back in the corner half afrighted. My son, said the priest I can for give murder; I am that man. Jean sprang to his feet and em- 244 THE GETTYSBURG MERCURY. braced him. Tears filled the eyes of both. "Rejoice, my son, your sins are forgiven." "Offer thanks to our common deliv-erer," he said, departing. Jean watched his form slowly disap-pearing in the distance and then fell upon his knees. The light burned steadily before the altar, the rays of the morning sun shone through the cathedral windows. And as he knelt there that beautiful Christmas morn Jean realized for the first time in his life the meaning of "Peace on earth, good will towards men. THE GETTYSBURG MERCURY Entered at the Postofficc at Gettysburg as second-class matter Vot, XI GETTYSBURG, PA., JANUARY, 1903 No. 7 Editor-in-chief II. S. LEWARS, 'O Assistant Editors Exchange Editor Miss MARY WILSON, '04 SAM. P. WEAVER, '04 LYMAN A. GUSS, '04 Business Manager . XT . "_. ' , Advisory Board NORMAN A. YEANY, '03 "».,/', -^ PROF. J. A. HIMES, LITT.D. Asst. Business Manager PROF. G. D. STAHXKY, M.D. FRED. MASTERS, '04 PROF. J. W. RICHARD, D.D. Published each month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance; single copies 15 cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Busi-ness Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. EDITORIALS. .■ . " , Most people think it a wise thing at the begin- A NFW YEAR'S V r & & RESOLUTION. n;ng 0f ^c new vear to reflect on past actions and to resolve to do better things in the future. So let us profit by the example of these people and resolve upon a few things at the beginning of the new term. Yet far be it from us to act as some are wont to do who make good resolutions and straightway forget not only that they have re-solved but what they have resolved to do. Or even as is the custom of certain learned bodies to draw up such documents in written form and consign them to such places of safe keep-ing where they will annoy no one. But let us first think upon some good thing and do it. Let us then as a student body resolve to take more interest in all the departments of college activity. 246 THE GETTYSBURG MERCURY. Why cannot Gettysburg College have a creditable track team ? Have we lost all interest in track athletics ? Let us lend a hand and strengthen some of these weak departments of athletics. But even of more importance than this is to resolve to support the college publications better than ever before. It is a crying need among editors that they cannot do what they should like to do. Not because the publication is not supported financially but for lack of good material. If it once entered the minds of students that these papers were theirs to uphold and therefore in a certain sense to man-age we might hope for better things. Now let us resolve that we will support the monthly better. When the number does not come up to our ideals then let us make it a point to improve it by our own efforts. Too often, alas, the editor must publish just what he can get. It then follows that literary standards must be low among us if our monthly is an expression of our ability in such work. Let us resolve to do better and the day will be near at hand when we shall see its good results. AN EXPLANATION. It has been the custom for years to omit the publication of a January number of this magazine. But owing to a delay in the issue of the December number through lack of force at the printer's, it seemed well to the managers to publish a January number instead of a De-cember number. We sincerely regret this delay and trust that it will meet with not too harsh censure from our readers. EXCHANGES. DURING the past few months the matter of criticising has been much discussed by several of our exchanges. Some of them claim that too many compliments are offered by the dif-ferent editors and that not enough real criticism is given, while others maintain that the average exchange editoris not capable of justly criticising the work of his fellow students. Both are THE GETTYSBURG MERCURY. 247 right to a certain degree. It is true that many journals are complimented that are not deserving of praise. On the other hand almost all who do offer critical reviews are either partial or not in a position to make such criticism. We agree with the Buff and Blue that it is often "wisest to report only on the meritorious article." Criticism may be offered in a general way to advantage, but when it descends to the level of mere fault finding the advice is not only not heeded by the one for whom it is given, but is often refuted thus causing an unfriend-ly feeling to arise between the different journals. This month two exchanges came to our table that were es-pecially prominent in this respect. The one took over two pages to criticise an article that was not as long as his crit-icism. If the article was so poor as the editor would make it, it was certainly not worthy of such a lengthy refutation. About the other there is no question. The writer is partial from the very beginning. During his elaborate argument he speaks of the heresy of Luther and makes many other state-ments that show the narrowness of his comment. The article closes with the haughty statement that "Doubtless he is a Freshman and before he finishes his course he will learn a lit-tle history and then he will make statements which startle the printers who set them in type." Shall we call that a just criti-cism? Does it show a spirit of impartiality or "down-right rottenness" on the part of the writer? Fellow editors, you may answer the questions for yourselves, and in the meantime per-mit us to reply in the author's own manner and say that the writer is not a Freshman, but, judging from the thought and construction of the above sentence, has as much ability and judgment as the editor who makes the inquiry. The Georgetown College Journal is one of our best exchanges. The November number contains two good contributions, "The Rise and Growth of the District of Columbia," and "In the Thrilling Days of '64." We wish to apologize to the Journal for making use of the poem, to which they called our attention, without giving them due credit. It was not done intentionally but was merely an oversight on our part. THE GETTYSBURG MERCURY. "There's a jubilee in Love-laud When the College widows wed, And young Cupid rests from labor, Slumbering on his rosy bed. All the powers of Olympus Laugh and wonder how 'twas done, Drinking healths to Cupid For the folly and the fun. "fisn't every year it happens That a victim's landed sure, And there's many an arrow blunted, Many a crafty well-planned lure, Ere the marriage vow is spoken That the wily students dread; But the patron saints of wooing Turned this foolish student's head — There's a jubilee in Love-land When the college widows wed."—Ex. The Ursinus Weekly seems at last to have assumed a defin-ite form. Whether the new departure has been for the best re-mains to be seen. The literary number for October, however, contains a very interesting and well written story "The Other Side." The poem, "The Corn Harvest," is also good. The Wittenberger is one of our new exchanges. It comes to us from Springfield, Ohio, and contains some good articles. It could be greatly improved, however, by keeping the material separate from the advertisements and by giving more attention to the development of its exchange department. The little brook with pleasing murmur glides Thro' meadows bright by woodlands shadowed o'er, Its waters clear o'er rounded pebbles pour, Kissing with gentle touch its teeming sides. Thus calmly on it goes with eddying tides, No foaming waves, no rising billows roar, But ever on as softly as before Mid golden sands, where'ere its channel guides. O would that thus life's rough and devious stream, With all its storms, its tempests and its care, Flowed as a babbling brook so peacefully; While I, like one in rapture and in dream, Might float upon its swelling bosom fair Into the haven of Eternity.—Ex. THESE FIRMS ARE O. K.—PATRONIZE THEM. The Intenollepfe Bureau or flcademis fiostnme. Chartered igoz. Cotrell 5* I^eonard^ makers of the Caps, Governs and Hoods To the University of Pennsylvania, Harvard, Princeton, Yale, Cornell, Columbia, University of Chicago, University of Min-nesota, Leland Stanford, Tulane, University of the South, Wel-lesley, Bryn Mawr, Wells, Mt. Holyoke and the others. Illustrated Bulletin, Samples, Etc., upon request. 4. (§. (Spalding & @ros., Largest Manufacturers in the World of Official Athletic Supplies. Base Ball Lawn Tennis Golf Field Hockey JitMetic Implements. Spalding's Catalogue of Athletic Sports Mailed Free to any Address. A. G. Spalding &c Bros. NEW YORK - . CHICAGO - - DENVER - - BUFFALO - - BALTIMORE HELP THOSE WHO HELP US. THE STEWART & STEEN CO. Oollege UlrigTCUveTs and (pTinte~rs 1034 Arch St., Philadelphia, Pa. MAKERS AND PUBLISHERS OF Commencement, Class Day Invitations and Programs, Class Pins and Buttons in Gold and Other Metals, "Wedding Itivitations and Announcements, At Home Cards, Reception Cards and Visiting Cards, . Visiting Cards—rlate and 50 cards, 75 cents. Dj {Special Discount to Students. N. A. YEANY, Gettysburg College Representative. A Market Square, HARRISBURG, PA. Eates $2.00 per day and up. Special Eates for Commercial Men. Large and convenient Sample Rooms. Passenger and Baggage Elevator. Electric Cars to and from Depot. Electric Light and Steam Heat. Rooms En-suite or Single with Bath. /. H. & M. S. BUTTBRWORTH, Props. FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. * Telephone No. 97. H. IB. Bendei I 37 Baltimore St., Gettysburg, Pa. FAVOR THOSE WHO FAVOR US. A J. A. TAWNEY Is ready to furnish Clubs and Boarding Houses with . Bread, Rolls, Etc., At short notice and reason-able rates. Washington & Middle Sts., Gettysburg. Shoes Impaired 115 Baltimore St. near Court House. Good Work Guaranteed. J. W. BUMBAUGH'S City Cafe and Dining Room Meals and lunches served at short notice. Fresh pies and sandwiches always on hand. Oysters furnished all year. 53 Chambersburg St. 1 =¥*= **=^=**= AA=AA= AAF AA= AA= AA: Jtv; S A^P AA= AA= AA= AAr AA= :**: **r **= AA= AA t U-PI-DEE. A new Co-ed has alighted in town, ll-pi-dce, U-pi-da! In an up-to-datest tailor-made gowr.,CJ-pI-de-i-da ! The boys are wild, and prex is, too, You never saw such a hulla-ba-loo. CHORUS. — U-pi-dee-i-dee-i-da I etc. Her voice is clear as a soaring lark's, And her wit is like those trolley-car sparks ! When "cross a muddy street she flits, The boys alt have conniption fitsl The turn of her head turns all ours, too. There's always a strife to sit in her pew; *Tis enough to make a parsun drunk, To hear her sing old co-ca-chc-lunk 1 The above, and three other NEW verses to U-PI-DEE, and NEW WORDS, catchy, up-to-date, to many others of the popular OLD FAMILIAR TUNES; be-iJWU sides OLD FAVORITES ; and also many NEW SONGS. TTff SONGS OF ALL THE COLLEGES. jibjj CopjriEht, Price, $1.50, postpaid. 1900, u HINDS & NOBLE, Publishers, New York City. ff Schoolbooks 0/ all publishers at o?te store. \ a AA~ A*: AV \\- At AA= -IV AA= A\- AX- AV- I mmm mmm m. p. mmmmmmmm m I 50 YEARS' EXPERIENCE TRADE MARKS DESIGNS COPYRIGHTS &C. Anyone sending a sketch and description may quickly ascertain our opinion free whether an invention is probably patentable. Communica-tions strictly confidential. Handbook on Patents sent free. Oldest agency for securing" patents. Patents taken through Munn & Co. receive special-notice, without charge, In the Scientific American. A handsomely illustrated weekly. Largest cir-culation of any scientific journal. T. erms, $3 a year; four months, $L Sold by all newsdealers. MUNN &Co.361Broadwav. New York Branch Office, 626 F St., Washington, D. C. GO TO. HARRY B. SEFTON'S (Barber §hop For a good shave or hair cut. Barbers' supplies a specialty. Razor Strops, Soaps, Brushes, Creams, Combs, Mugs and Coke Dandruff cure. No. 38 Baltimore St. GETTYSBURG. You will find a full line of Pure Drugs and Fine Stationery at the People's Drug Store Prescriptions a specialty. PATRONIZE OUR ADVERTIZERS. I I. MUMPER. 41 Baltimore St., Gettysburg, Pa. The improvements to our Studio have proven a perfect success and we are now better prepared than ever to give you satisfactory work. Manufacturers of high grade Fraternity Emblems Fraternity Jewelry Fraternity Novelties Fraternity Stationery Fraternity Invitations Fraternity Announcements Fraternity Programs Wright, %j \ Co. 140-144 Woodward Avenue, DETROIT, MICH. Send for Catalogue and Price List. Special Designs on Application. Partridge's Athletic Goods. For Base Ball, Basket Ball, Tennis, Hockey, Track and ■ Gymnasium use. Managers should write at once for Catalogues and confidential quo-tations We manufacture Sweaters, Jerseys, Tights, Caps, Pennants, etc. Illustrated Catalogues Free. ROBERT LENKER, Agent, Gettysburg College. Horace Partridge & Co., 84 FRANKLIN ST. BOSTON, MASS. EMIL ZOTHE COLLEGE EMBLEMS Engraver, Designer and Manufacturing Jeweler, 716 CHESTNUT ST., - PHILADELPHIA. SPECIALTIES : Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pius and Athletic Prizes. All goods ordered through PHILIP BIKLE, JR. SEFTON & FLEMMING'S LIVERY Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrangements by telegram or letter. Look Box 257. d

Threats To International Peace And Security. The Situation In The Middle East ; United Nations S/PV.8233 Security Council Seventy-third year 8233rd meeting Saturday, 14 April 2018, 11 a.m. New York Provisional President: Mr. Meza-Cuadra . (Peru) Members: Bolivia (Plurinational State of). . Mr. Llorentty Solíz China. . Mr. Ma Zhaoxu Côte d'Ivoire. . Mr. Tanoh-Boutchoue Equatorial Guinea. . Mr. Ndong Mba Ethiopia. . Mr. Alemu France. . Mr. Delattre Kazakhstan. . Mr. Umarov Kuwait. . Mr. Alotaibi Netherlands. . Mrs. Gregoire Van Haaren Poland. . Mr. Radomski Russian Federation. . Mr. Nebenzia Sweden . Mr. Skoog United Kingdom of Great Britain and Northern Ireland . Ms. Pierce United States of America. . Mrs. Haley Agenda Threats to international peace and security The situation in the Middle East This record contains the text of speeches delivered in English and of the translation of speeches delivered in other languages. The final text will be printed in the Official Records of the Security Council. Corrections should be submitted to the original languages only. They should be incorporated in a copy of the record and sent under the signature of a member of the delegation concerned to the Chief of the Verbatim Reporting Service, room U-0506 (verbatimrecords@un.org). Corrected records will be reissued electronically on the Official Document System of the United Nations (http://documents.un.org). 18-10891 (E) *1810891* S/PV.8233 Threats to international peace and security 14/04/2018 2/26 18-10891 The meeting was called to order at 11.10 a.m. Adoption of the agenda The agenda was adopted. Threats to international peace and security The situation in the Middle East The President (spoke in Spanish): In accordance with rule 37 of the Council's provisional rules of procedure, I invite the representative of the Syrian Arab Republic to participate in this meeting. The Security Council will now begin its consideration of the item on its agenda. I wish to warmly welcome His Excellency Secretary-General António Guterres, to whom I now give the floor. The Secretary-General: I have been following closely the reports of air strikes in Syria conducted by the United States, France and United Kingdom. Last night at 10 p.m. New York time, the United States President announced the beginning of air strikes with the participation of France and the United Kingdom, indicating they were targeting the chemical-weapons capabilities of the Syrian Government to deter their future use. The statement was followed by announcements from Prime Minister May and President Macron. The air strikes were reportedly limited to three military locations inside Syria. The first targets included the Syrian Scientific Studies and Research Centre at Al-Mazzah airport in Damascus, the second an alleged chemical-weapons storage facility west of Homs and the third an alleged chemical-weapons equipment storage site and command post, also near Homs. The Syrian Government announced surface-to-air missile responsive activity. Both United States and Russian sources indicated there were no civilian casualties. However, the United Nations is unable to independently verify the details of all those reports. As Secretary-General of the United Nations, it is my duty to remind Member States that there is an obligation, particularly when dealing with matters of peace and security, to act consistently with the Charter of the United Nations, and with international law in general. The Charter is very clear on these issues. The Security Council has the primary responsibility for the maintenance of international peace and security. I call on the members of the Security Council to unite and exercise that responsibility, and I urge all members to show restraint in these dangerous circumstances and to avoid any act that could escalate matters and worsen the suffering of the Syrian people. As I did yesterday (see S/PV.8231), I stress the importance of preventing the situation from spiralling out of control. Any use of chemical weapons is abhorrent, and the suffering it causes is horrendous. I have repeatedly expressed my deep disappointment that the Security Council has failed to agree on a dedicated mechanism for ensuring effective accountability for the use of chemical weapons in Syria. I urge the Security Council to assume its responsibilities and fill that gap, and I will continue to engage with Member States to help to achieve that objective. A lack of accountability emboldens those who use such weapons by providing them with the reassurance of impunity, and that in turn further weakens the norm proscribing the use of chemical weapons, as well as undermining the international disarmament and non-proliferation architecture as a whole. The seriousness of the recent allegations of the use of chemical weapons in Douma requires a thorough investigation using impartial, independent and professional expertise. I reaffirm my full support for the Organization for the Prohibition of Chemical Weapons and its Fact-finding Mission in the Syrian Arab Republic in undertaking the required investigation. The team is already in Syria. I am informed that its operations plan for visiting the site is complete and that the Mission is ready to go. I am confident it will have full access, without any restrictions or impediments to its performance of its activities. To repeat what I said yesterday, Syria represents the most serious threat to international peace and security in the world today. In Syria we see confrontations and proxy wars involving several national armies, a number of armed opposition groups, many national and international militias, foreign fighters from all over the world and various terrorist organizations. From the beginning, we have witnessed systematic violations of international humanitarian law, international human rights law and international law in general, in utter disregard of the letter and spirit of the Charter of the United Nations. For eight long years, the people of Syria have endured suffering upon suffering. They have lived 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 3/26 through a litany of horrors, atrocity crimes, sieges, starvation, indiscriminate attacks on civilians and civilian infrastructure, the use of chemical weapons, forced displacement, sexual violence, torture, detention and enforced disappearances. The list goes on. At this critical juncture, I call on all States Members to act consistently with the Charter of the United Nations and international law, including the norms against chemical weapons. If the law is ignored, it is undermined. There can be no military solution to the crisis. The solution must be political, and we must find ways to make real progress towards a genuine and credible political solution that meets the aspirations of the Syrian people to dignity and freedom, in accordance with resolution 2254 (2015) and the Geneva communiqué (S/2012/522, annex). I have asked my Special Envoy to come to New York as soon as possible to consult with me on the most effective way to accelerate the political process. The President (spoke in Spanish): I thank the Secretary-General for his valuable briefing. I shall now give the floor to those Council members who wish to make statements. Mr. Nebenzia (Russian Federation) (spoke in Russian): Russia has called this emergency meeting of the Security Council to discuss the aggressive actions of the United States and its allies against Syria. This is now our fifth meeting on the subject in a week. President Putin of the Russian Federation made a special statement today. "On 14 April, the United States, with the support of its allies, launched an air strike on military and civilian infrastructure targets in the Syrian Arab Republic. An act of aggression against a sovereign State on the front lines in the fight against terrorism was committed without permission from the Security Council and in violation of the Charter of the United Nations and the norms and principles of international law. Just as it did a year ago, when it attacked Syria's Al-Shayrat airbase in Syria, the United States took a staged use of toxic substances against civilians as a pretext, this time in Douma, outside Damascus. Having visited the site of the alleged incident, Russian military experts found no traces of chlorine or any other toxic agent. Not a single local resident could confirm that such an attack had occurred. "The Organization for the Prohibition of Chemical Weapons (OPCW) has sent experts to Syria to investigate all the circumstances. However, a group of Western countries cynically ignored this and took military action without waiting for the results of the investigation. "Russia vehemently condemns this attack on Syria, where Russian military personnel are helping the legitimate Government to combat terrorism. "The actions of the United States are making the already catastrophic humanitarian situation in Syria even worse, inflicting suffering on civilians, for all intents and purposes enabling the terrorists who have been tormenting the Syrian people for seven years, and producing yet another wave of refugees fleeing the country and the region in general. The current escalation of the Syrian situation is having a destructive effect on the entire system of international relations. History will have the last word, and it has already revealed the heavy responsibility that Washington bears for the carnage in Yugoslavia, Iraq and Libya." Russia has done everything it could to persuade the United States and its allies to abandon their militaristic plans threatening a new round of violence in Syria and destabilization in the Middle East. Today, and at the Council meeting we called yesterday (see S/PV.8231), the Secretary-General expressed his concern about how events are developing. Washington, London and Paris, however, preferred to let the calls for sanity go unheard. The United States and its allies continue to demonstrate a flagrant disregard for international law, although as permanent members of the Security Council they have a special duty to uphold the provisions of the Charter. It was a disgrace to hear an article of the United States Constitution cited as justification of this aggression. We respect the right of every State to honour its own fundamental law. But it is high time that Washington learned that it is the Charter of the United Nations that governs the international code of conduct on the use of force. It will be interesting to see how the peoples of Great Britain and France react to the fact that their leaders are participating in unlawful military ventures that invoke the United States Constitution. These three countries constantly lean towards neocolonialism. They scorn the Charter and the Security Council, which they attempt, shamelessly, to use for their own unscrupulous purposes. They do no serious S/PV.8233 Threats to international peace and security 14/04/2018 4/26 18-10891 work in the Council. They refuse to consult with us, while falsely assuring everyone of the opposite. They are undermining the Council's authority. The alleged use of chemical weapons in the Syrian city of Douma has been cited as the excuse for this aggression. After an inspection by our specialists, Russia's representatives stated unequivocally that no such incident took place. Moreover, people were found to have taken part in staging the incident, which was inspired and organized by foreign intelligence services. After the matter emerged, the Syrian authorities immediately invited experts from the Organization for the Prohibition of Chemical Weapons to try to establish all the circumstances through a field mission to Douma. The visa formalities were dealt with quickly and security guarantees given. As the air strikes began, the specialists were already in Syria and preparing to begin their work. I would like to remind Council members and everyone else that on 10 April (see S/PV.8228), when our draft resolution (S/2018/322) on ensuring the security of the work of the OPCW's special mission was blocked, we were assured that there was no need for such a document. They said that no additional effort on the part of the Security Council was necessary to ensure that the mission could reach Douma and conduct an investigation of the chemical incident. Now, however, we can see that we were absolutely right. Yesterday, some of our colleagues — some out of naivety and others out of cynicism — told us that this situation had allegedly arisen owing to the lack of an independent investigative mechanism. The aggression today has shown, as we said, that this had nothing whatever to do with it. The OPCW-United Nations Joint Investigative Mission (JIM) was in place during last year's attack on the Al-Shayrat airbase, but that did not stop the United States from launching a missile attack. After that, the JIM spent six months tailoring its conclusions to justify the strike. We have said over and over again that they do not need any investigations. They did not need them then and they do not need them now. The organizers of the aggression did not even wait for the international organization that is authorized to establish the basic facts to do so. Apparently they had established and instantly identified the perpetrators, after disseminating rumours about them through social networks with the help of the militias they sponsor and the non-governmental organizations that are their clients. This was backed up by mythical secret intelligence. Their masks — or rather the White Helmets — have come off once again. We have become accustomed to the fact that their efforts to achieve their dubious geopolitical aims, the aggressor countries deliberately blame the so-called Assad regime for every evil. There has been a trend recently to shift the blame onto Russia, which, as they tell it, has been unable to restrain Syria's so-called dictator. All of this goes according to a tried-and- true formula, whereby a provocation results in a false accusation, which results in a false verdict, which results in punishment. Is that how these people want to conduct international affairs? This is hooliganism in international relations, and not on a petty scale, given that we are talking about the actions of key nuclear Powers. Several missiles were aimed at the research centre facilities in Barzeh and Jamraya. There have been two recent OPCW inspections there with unrestricted access to their entire premises. The specialists found no trace of activities that would contravene the Chemical Weapons Convention. Syria's scientific research institutions are used for strictly peaceful activities aimed at improving the efficiency of the national economy. Do they want Syria to have no national economy left at all? Do they want to kick this country — only a few years ago one of the most developed in the Middle East — back into the Stone Age? Do they want to finish whatever their sanctions have not yet accomplished? And yet they still contrive false breast-beating about the sufferings of ordinary Syrians. But they have no interest in ordinary Syrians, who are sick of war and glad about the restoration of the legitimate authorities in the liberated territories. Their aggressive actions merely worsen the humanitarian situation that they claim to care about so deeply. They could end the conflict in Syria in the space of 24 hours. All that is needed is for Washington, London and Paris to give the order to their tame terrorists to stop fighting the legitimate authorities and their own people. The attacks were aimed at Syrian military airfields that are used for operations against terrorist organizations, a highly original contribution to the fight against international terrorism, which, as Washington never tires of saying, is the sole reason for its military presence in Syria, something that we are extremely doubtful about. Rather, it is becoming increasingly clear that those in the West who hide 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 5/26 behind humanitarian rhetoric and try to justify their military presence in Syria based on the need to defeat the jihadists are in fact acting in concert with them to dismember the country, a design confirmed by the categorical refusal of the United States and its allies to assist in the restoration of the areas of Syria that have been liberated by Government forces. Their aggression is a powerful blow and a threat to the prospects for continuing the political process under the auspices of the United Nations, which, despite the real difficulties, is moving forward, albeit at varying speed. Why do they bother endlessly pinning all their hopes on the Geneva process when they themselves are driving it straight towards yet another crisis? We urge the United States and its allies to immediately halt their acts of aggression against Syria and refrain from them going forward. We have proposed a brief draft resolution for the Council's attention on which we request that a vote be held at the end of this meeting. We appeal to the members of the Security Council. Now is not the time to evade responsibility. The world is watching. Stand up for our principles. Mrs. Haley (United States of America): I thank the Secretary-General for his briefing today. This is the fifth Security Council meeting in the past week in which we have addressed the situation in Syria. A week has gone by in which we have talked. We have talked about the victims in Douma. We have talked about the Al-Assad regime and its patrons, Russia and Iran. We have spent a week talking about the unique horror of chemical weapons. The time for talk ended last night. We are here today because three permanent members of the Security Council acted. The United Kingdom, France, and the United States acted not in revenge, not in punishment and not in a symbolic show of force. We acted to deter the future use of chemical weapons by holding the Syrian regime responsible for its crimes against humanity. We can all see that a Russian disinformation campaign is in full force this morning, but Russia's desperate attempts at deflection cannot change the facts. A large body of information indicates that the Syrian regime used chemical weapons in Douma on 7 April. There is clear information demonstrating Al-Assad's culpability. The pictures of dead children were not fake news; they were the result of the Syrian regime's barbaric inhumanity. And they were the result of the regime's and Russia's failure to live up to their international commitments to remove all chemical weapons from Syria. The United States, France and the United Kingdom acted after careful evaluation of those facts. The targets we selected were at the heart of the Syrian regime's illegal chemical-weapon programme. The strikes were carefully planned to minimize civilian casualties. The responses were justified, legitimate and proportionate. The United States and its allies did everything they could to use the tools of diplomacy to get rid of Al-Assad's arsenal of chemical weapons. We did not give diplomacy just one chance. We gave it chance after chance. Six times. That is how many times Russia vetoed Security Council resolutions to address chemical weapons in Syria. Our efforts go back even further. In 2013, the Security Council adopted resolution 2118 (2013), requiring the Al-Assad regime to destroy its stockpile of chemical weapons. Syria committed to abiding by the Chemical Weapons Convention, meaning that it could no longer have chemical weapons on its soil. President Putin said that Russia would guarantee that Syria complied. We hoped that this diplomacy would succeed in putting an end to the horror of chemical attacks in Syria, but as we have seen from the past year, that did not happen. While Russia was busy protecting the regime, Al-Assad took notice. The regime knew that it could act with impunity, and it did. In November, Russia used its veto to kill the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism, the main tool we had to figure out who used chemical weapons in Syria. Just as Russia was using its veto (see S/PV.8107), the Al-Assad regime used sarin, leading to dozens of injuries and deaths. Russia's veto was the green light for the Al-Assad regime to use these most barbaric weapons against the Syrian people, in complete violation of international law. The United States and our allies were not going to let that stand. Chemical weapons are a threat to us all. They are a unique threat — a type of weapon so evil that the international community agreed that they must be banned. We cannot stand by and let Russia trash every international norm that we stand for, and allow the use of chemical weapons to go unanswered. Just as the Syrian regime's use of chemical weapons last weekend was not an isolated incident, our response is part of a new course charted last year to deter future use of chemical weapons. Our Syrian strategy has not changed. S/PV.8233 Threats to international peace and security 14/04/2018 6/26 18-10891 However, the Syrian regime has forced us to take action based on its repeated use of chemical weapons. Since the April 2017 chemical attack at Khan Shaykhoun, the United States has imposed hundreds of sanctions on individuals and entities involved in chemical-weapons use in Syria and North Korea. We have designated entities in Asia, the Middle East and Africa that have facilitated chemical-weapons proliferation. We have revoked the visas of Russian intelligence officers in response to the chemical attack in Salisbury. We will continue to seek out and call out anyone who uses and anyone who aids in the use of chemical weapons. With yesterday's military action, our message was crystal clear. The United States of America will not allow the Al-Assad regime to continue to use chemical weapons. Last night, we obliterated the major research facility that it used to assemble weapons of mass murder. I spoke to the President this morning, and he said that if the Syrian regime should use this poison gas again, the United States is locked and loaded. When our President draws a red line, our President enforces the red line. The United States is deeply grateful to the United Kingdom and France for their part in the coalition to defend the prohibition of chemical weapons. We worked in lock step; we were in complete agreement. Last night, our great friends and indispensable allies shouldered a burden that benefits all of us. The civilized world owes them its thanks. In the weeks and months to come, the Security Council should take time to reflect on its role in defending the international rule of law. The Security Council has failed in its duty to hold those who use chemical weapons to account. That failure is largely due to Russian obstruction. We call on Russia to take a hard look at the company it keeps, live up to its responsibilities as a permanent member of the Council, and defend the actual principles the United Nations was meant to promote. Last night, we successfully hit the heart of Syria's chemical weapons enterprise, and because of these actions we are confident that we have crippled Syria's chemical weapons programme. We are prepared to sustain this pressure if the Syrian regime is foolish enough to test our will. Ms. Pierce (United Kingdom): These are uncertain times and today we deal with exceptional circumstance. Acting with our American and French allies, in the early hours of this morning the United Kingdom conducted coordinated, targeted and precise strikes to degrade Al-Assad's chemical weapons capability and deter their future use. The British Royal Air Force launched Storm Shadow missiles at a military facility some 15 miles west of Homs, where the regime is assessed to keep chemical weapons in breach of Syria's obligations under the Chemical Weapons Convention. A full assessment has not yet been completed, but we believe that the strikes to have been successful. Furthermore, none of the British, United States or French aircraft or missiles involved in this operation were successfully engaged by Syrian air defences, and there is also no indication that Russian air defence systems were employed. Our action was a limited, targeted and effective strike. There were clear boundaries that expressly sought to avoid escalation, and we did everything possible, including rigorous planning, before any action was undertaken to ensure that we mitigated and minimized the impact on civilians. Together, our action will significantly degrade the Syrian regime's ability to research, develop and deploy chemical weapons and deter their future use. The United Kingdom Prime Minister has said that we are clear about who is responsible for the atrocity of the use of chemical weapons. A significant body of information, including intelligence, indicates that the Syrian regime is responsible for the attack we saw last Saturday. Some of the evidence that leads us to this conclusion is as follows. There are open source accounts alleging that a barrel bomb was used to deliver the chemicals. Multiple open source reports claim that a regime helicopter was observed above the city of Douma on the evening of 7 April. The opposition does not operate helicopters or use barrel bombs. And reliable intelligence indicates that Syrian military officials coordinated what appears to be the use of chlorine in Douma on 7 April. No other group could have carried out this attack. Indeed, Da'esh, for example, does not even have a presence in Douma. The Syrian regime has been killing its own people for seven years. Its use of chemical weapons, which has exacerbated the human suffering, is a serious crime of international concern as a breach of the customary international law prohibition on the use of chemical weapons, and that amounts to a war crime and a crime against humanity. Any State is permitted under international law, on an exceptional basis, to 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 7/26 take measures in order to alleviate overwhelming humanitarian suffering. The legal basis for the use of force for the United Kingdom is humanitarian intervention, which requires that three conditions to be met. First, there must be convincing evidence, generally accepted by the international community as a whole, of extreme humanitarian distress on a large scale, requiring immediate and urgent relief. I think that the debates in the Council and the briefings we have had from the Office for the Coordination of Humanitarian Affairs and others have proved that. Secondly, it must be objectively clear that there is no practicable alternative to the use of force if lives are to be saved. I think that the vetoes have shown us that. Thirdly, the proposed use of force must be necessary and proportionate to the aim of relief of humanitarian suffering. It must be strictly limited in time and in scope to this aim. I think we have heard both in my intervention in Ambassador Haley's how that has also been met. The history of the Syrian conflict is a litany of threats to peace and violations of international law. The Security Council has met 113 times since the Syrian war started. It was therefore not for want of international diplomatic effort that we find ourselves in this position today. After a pattern of chemical-weapons use since the outbreak of the conflict, Al-Assad defied the international community in 2013 by launching a sarin gas attack on eastern Ghouta, which left more than 800 people dead. Despite the adoption of resolution 2118 (2013) and despite four years of patient engagement, Syria continues to use chemical weapons against its people and has failed to answer a long list of serious questions. The only conclusion we can reach is that Syria has not declared or destroyed all of its chemical weapons, despite its obligations under the Chemical Weapons Convention. This is not assertion on our part but a matter of record, and I draw the Russian Ambassador's attention to his points about Barazan and Jimrya. The Organization for the Prohibition of Chemical Weapons (OPCW) still has unanswered questions and discrepancies. He knows this. We all know this. The Council was briefed by the OPCW Director-General. Resolution 2118 (2013) decides in the event of non-compliance to impose measures under Chapter VII of the Charter. Yet on 28 February 2017, when the United Kingdom together with France, proposed a draft resolution (S/2017/172) taking measures under Chapter VII short of the use of force, Russia vetoed (see S/PV.7893). The very least the Security Council should have been able to do was to follow up on the findings of the report of the Joint Investigative Mechanism by extending its mandate. Yet four times Russia vetoed different proposals from different Council Members to do just that. The Syrian regime and it supporters are responsible for the gravest violations of international humanitarian law in modern history. They have used indiscriminate weapons, notably barrel bombs and cluster munitions, against civilians, and they have deliberately targeted medical facilities and schools, as well as humanitarian personnel and civilian objects. They have used sieges and starvation as methods of warfare, accompanied by attacks on opposition-held civilian areas. The regime has persistently obstructed humanitarian aid and medical evacuations. Tens of thousands of people have been illegally detained, tortured and executed by the regime. This is one of the most serious challenges to the international non-proliferation regime we have ever faced. A State party has violated the Chemical Weapons Convention, it has defied the Security Council, and it has broken international law. Repeated attempts over several years to hold them to account have been met with Russian obstruction and resistance. In the Security Council, we have repeatedly attempted to overcome this obstruction without success. We are faced with a litany of violations, no sense of guilt, no sense of regret, no sense of responsibility, a shameful record, wrapped in a mix of denial, deceit and disinformation. I would invite those like the Russian Ambassador who speak about the Charter to consider the following. It is hard to believe that it is in line with the principles and purposes of the Charter to use or condone the use of chemical weapons, and in the United Kingdom's view it cannot be illegal to use force to prevent the killing of such numbers of innocent people. I will take no lessons in international law from Russia. Despite all the foregoing, we would like to look forward. The United Kingdom, together with France and the United States, will continue to pursue a diplomatic resolution to the Syrian crisis. My French colleague will say more about our work in a few moments. We believe that it must comprise four elements. S/PV.8233 Threats to international peace and security 14/04/2018 8/26 18-10891 First, Syria's chemical weapons programme must be ended and the chemical weapons stockpiles destroyed once and for all. Secondly, there must be an immediate cessation of hostilities and compliance with all Security Council resolutions, including those that mandate humanitarian access. Thirdly, the regime must return to the Geneva talks and agree to engage on the substantial agenda put forward by the United Nations Special Envoy Staffan de Mistura. Fourthly and finally, there must be accountability for the use of chemical weapons and other war crimes in Syria. The Secretary-General rightly highlighted the political process. We propose that, as we members of the Security Council will all be together next weekend in the retreat with the Secretary-General very kindly hosted by Sweden, we use that opportunity to reflect on next steps and the way back to the political process. And with our allies, we stand ready to work with all members of the Security Council towards this end. Mr. Delattre (France) (spoke in French): A week after the chemical massacre in Douma and a day after last night's strikes, I want to say again straight away to those who pretend to wonder that France has no doubt whatsoever about the responsibility of the Al-Assad regime in this attack. This morning we made public a notice comprising information collected by our intelligence services. We dismiss those who try once again to challenge what is obvious and to disguise the facts before the world. For years now, Bashar Al-Assad, with the active support of his allies, has been devising a strategy of destruction designed to crush any opposition with contempt for the most basic principles of humanity and at the cost of the lives of hundreds of thousands of civilians in Syria. We saw it in Aleppo, in Homs, in eastern Ghouta. For years, the Syrian regime has used the most terrifying weapons of destruction — chemical weapons — to massacre and terrorize its civilian population. We had another demonstration of this in Douma, as we had seen before in Khan Shaykhun, Sarmin, Telemens and Qaminas, where its responsibility was clearly established by the Joint Investigative Mechanism of the United Nations and the Organization for the Prohibition of Chemical Weapons (OPCW). No one can say he or she did not know. For years, the Syrian regime has systematically and repeatedly violated all its international obligations. The list of such violations is long; it is overwhelming. We all know them: violations of all international chemical-weapons obligations under the Chemical Weapons Convention, to which Syria has been a party since 2013, and the 1925 Geneva Protocol, which prohibits the use of such weapons against civilians; violations of the very foundations of international humanitarian law, namely, the principles of distinction, precaution and proportionality; violations of successive Security Council resolutions 2118 (2013), 2209 (2015) and 2235 (2015) and, by the same token, of its obligations under the Charter of the United Nations; finally, the use of chemical weapons against civilian populations constitutes a war crime within the meaning of the Statute of the International Criminal Court. In August 2013, the Secretary-General even described the use of chemical weapons as a crime against humanity. In view of the repeated and proven violations by the Damascus regime of all the rules on which our security is based, France has consistently called for strong action by the international community. We have made every effort to ensure that these horrors do not remain without consequences at the United Nations and the OPCW and that they are stopped. The Security Council had undertaken by successive resolutions 2118 (2013), 2209 (2015) and 2235 (2015) to impose coercive measures within the meaning of Chapter VII of the Charter of the United Nations in the event of new violations. It has been prevented from acting in conformity with its commitments because of the vetoes systematically used by Russia. By making such systematic use of its veto in the Security Council, Russia has betrayed the commitment it made to the Council in 2013 to ensure the destruction of the Syrian chemical arsenal. The Security Council's blockade of the mass atrocities committed in Syria is a deadly and dangerous trap from which we must escape. When it ordered the 7 April chemical attack, the Syrian regime knew exactly to what it was exposing itself. It wanted to once again test the international community's threshold of tolerance and it found it. In the face of this attack on the principles, values and rights that are the basis of United Nations action, silence is no longer a solution. We cannot tolerate the downplaying of the use of chemical weapons, which is an immediate danger to the Syrian people and to our collective security. We cannot let the deadly genie of proliferation out of its bottle. We had clearly warned Al-Assad's regime and its supporters that such a transgression would not remain without reaction. We have acted in 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 9/26 accordance with our role and responsibility. We have done so in a controlled, transparent framework, taking care to avoid any escalation with the actors present on the ground. The President of the Republic and the Minister of Foreign Affairs of France have spoken on this subject. Some who for years have flouted the most elementary rules of international law now assert that our action is contrary to the Charter of the United Nations. I would remind them that the Charter was not designed to protect criminals. Our action is fully in line with the objectives and values proclaimed from the outset by the Charter of the United Nations. The Organization's mission is "to establish conditions under which justice and respect for the obligations arising from treaties and other sources of international law can be maintained". This action was indeed necessary in order to address the repeated violations by the Syrian regime of its obligations — obligations stemming from the law, treaties and its own commitments. Finally, our response was conceived within an proportionate framework, with precise objectives. The main research centre of the chemical weapons programme and two major production sites were hit. Through those objectives, Syria's capacity to develop, perfect and produce chemical weapons has been put out of commission. That was the only objective, and it has been achieved. My country, which knew at first hand the devastating effects of chemical weapons during the First World War, will never again allow impunity for their use. We will never stop identifying those responsible, who must be brought to justice. That is the purpose of the International Partnership against Impunity for the Use of Chemical Weapons, which we launched last January. Allow me to stress this point: last night's strikes are a necessary response to the chemical massacres in Syria. They are a response in the service of law and our political strategy to put an end to the Syrian tragedy. To be more specific, we have four imperatives on the Syrian issue that are in the immediate interest of Syrians, but also in the interest of the entire international community, as the Secretary-General reminded us, and I want to thank him for his briefing. Let me recall those four imperatives. First, the Syrian chemical-weapons programme must be dismantled in a verifiable and irreversible way. We must spare no effort to establish an international mechanism for establishing responsibility, to prevent impunity and to prevent any repeat attempts to the Syrian regime to use chemical. Secondly, terrorism must be eradicated by permanently defeating Da'esh. That is a long-standing commitment that still requires genuine effort to ensure a definitive victory. Thirdly, there must be a ceasefire throughout the Syrian territory and humanitarian access to the civilian populations, as required by Security Council resolutions. We need full and unhindered humanitarian access in order to help people in need, in accordance with resolution 2401 (2018). In particular, it is essential and urgent that humanitarian convoys safely reach eastern Ghouta on a daily basis. Fourthly, we need a crisis-exit strategy, with a lasting political solution. We can sustainably resolve the Syrian crisis only through an inclusive political solution on the basis of the full implementation of resolution 2254 (2015). We have been calling for that for seven years. It has never been so urgent to implement it and to relaunch genuine negotiations under the auspices of the United Nations with a view to achieving a political transition in Syria. Only that road map will allow us to finally emerge from the Syrian impasse. France is ready to tackle it, as of today, with all those who are ready to put all their efforts to that end. In that spirit, at the initiative of France and in line with President Emmanuel Macron's statement tonight, we will submit as soon as possible a draft resolution on those different aspects with our British and American partners. Today I ask Russia, first and foremost, to call on the Damascus regime to enter into a plan for a negotiated solution so that the long-lasting suffering of Syrian civilians can finally be brought to an end. Mr. Ma Zhaoxu (China) (spoke in Chinese): I would like to thank the Secretary-General for his briefing. Just yesterday we were gathered in this Chamber for a meeting on the situation in Syria, during which China made clear its position on the issue of Syria, expressed profound concern about the further escalation of the tensions in Syria and made a clarion call for a political solution to the issue of Syria (see S/PV.8231). I would like to restate the following. S/PV.8233 Threats to international peace and security 14/04/2018 10/26 18-10891 China has consistently stood for the peaceful settlement of disputes and against the use of force in international relations. We advocate respect for the sovereignty, independence, unity and territorial integrity of all countries. Any unilateral military actions that circumvent the Security Council contravene the purposes and principles of the Charter of the United Nations, violate the basic norms enshrined in international law and those governing international relations, and would hamper the settlement of the Syrian issue with new compounding factors. We urge all the parties concerned to refrain from any actions that may lead to a further escalation of the situation, to return to the framework of international law and to resolve the issue through dialogue and consultation. China believes a comprehensive, impartial and objective investigation of the suspected chemical-weapons attack in Syria is necessary in order to arrive at a reliable conclusion that can withstand the test of history. Until that happens, no party must prejudge the outcome. There is no alternative to a political settlement in resolving the Syrian issue. The parties concerned in the international community should continue to support the role of the United Nations as the main mediator and should work together unremittingly towards a political settlement of the Syrian issue. I would like to restate that China stands ready to continue its positive and constructive role in the efforts to achieve a political settlement of the Syrian issue in the interests of peace and stability in the Middle East and in the world at large. Mr. Umarov (Kazakhstan): Kazakhstan expresses its serious concern about the sharp escalation of the situation in Syria. We call on all parties to prevent further military escalation and take effective steps aimed at restoring confidence and establishing peace and ensuring security in the long-suffering land of Syria on the basis of the Charter of the United Nations and the relevant resolutions of the Security Council. We called yesterday and the day before yesterday, and every time when we have observed increasing tensions, in this Chamber for responsible action in accordance with the Charter of the United Nations and international law. Who else, if not Council members, should show the world an example of compliance with the principles and provisions of the Charter? We are telling others to strictly follow international law and order, but sadly, yesterday we witnessed a different example. Whatever action taken under whatever good pretext cannot and will not justify the military use of force. Violence carried out against violence will never bring about peace and stability. Kazakhstan's position has always been, and continues to be, that military action is the last resort, to be used only in cases approved by the Security Council. There was no approval by the Council of the military strikes that took place yesterday. "Humanity hoped that the twenty-first century would herald a new era of global cooperation. This, however, may turn out to be a mirage. Our world is once again in danger and the risks cannot be underestimated. The threat is a deadly war on a global scale. Our planet is now on the edge of a new cold war that could have devastating consequences for all humankind." (S/2016/317, annex, p.2) That is an exact quote from the manifesto of my President, entitled "The World. The Twenty-First Century", of 31 March 2016. Just yesterday Secretary- General António Guterres confirmed, to our regret, that the Cold War is back with a vengeance (see S/PV.8231). Kazakhstan appeals to the parties to adhere to both the Charter of the United Nations and international law. We think that the time has come for serious talks encouraging the United States and the Russian Federation, given their standing as the co-Chairs of the International Syria Support Group and their respective influence on the parties, to move actively in the direction of finding middle ground and a political settlement to the conflict in Syria. The United Nations has a vital role to play in convening those negotiations and helping the parties resolve their disputes. My delegation is also extremely concerned about recent developments and the lack of unity among Security Council members with regard to the chemical attack in Syria. From its early days of independence, through a series of practical steps, Kazakhstan has consistently promoted peace initiatives in the international arena to achieve disarmament, non-proliferation and the prohibition of weapons of mass destruction, including chemical weapons, and strongly condemns their development, testing and use. I repeat: Kazakhstan strongly condemns the use of chemical weapons. 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 11/26 It is important to conduct a thorough, objective and impartial investigation into all aspects of the alleged chemical attack in Douma so as to enable the international community to render a fair verdict against the perpetrators, in full compliance with international law. The Government and other parties must thoroughly execute their obligations to comply with the relevant recommendations made by the Organization for the Prohibition of Chemical Weapons and the United Nations by accepting designated personnel, while providing for and ensuring the security of the activities undertaken by such personnel. We would like to remind the members of the Council that Kazakhstan's principled position is not only to condemn in the strongest terms the use of weapons of mass destruction by anyone, in particular against the civilian population, but also to resolve conflicts exclusively by peaceful means. President Nazarbayev stressed in his manifesto that the main tools for resolving disputes among States should be peaceful dialogue and constructive negotiations on the basis of equal responsibility for peace and security, mutual respect and non-inference in the domestic affairs of other States. Preventing the escalation of conflict and ending wars are the most challenging tasks; there are no other reasonable options. World leaders must treat such tasks as the highest priority on the global agenda. We must also respect the sovereignty of States Members of the United Nations and the purposes and principles enshrined in the Charter. We urgently need a political solution. Only a political, diplomatic approach, dialogue and confidence-building measures in the spirit of the Charter and Security Council documents on preventive diplomacy and sustaining peace can bring about proper results. We therefore call upon the international community to show political will to overcome differences and resume negotiations, in the belief that only a United Nations-led political transition in accordance with resolution 2254 (2015) can end the Syrian conflict, which, in turn, can advance only if the Council is united. There is great need to continue to support the aims of the Astana talks and further the Geneva negotiations in order to see positive results. All parties at the international, regional and Syrian levels should support an immediate ceasefire and seriously and objectively move forward without any preconditions within the framework of the International Syria Support Group, under the auspices of the United Nations Office in Geneva. We believe that the Syrian people are capable of determining their own future. However, achieving their aspirations for democracy, reconstruction and stability is impossible without genuine international support to contain the negative impact of spoilers and to help Syrians combat terrorism and build their State on a firm and stable foundation. Kazakhstan has always stood for dialogue and the resolution of international conflicts. All parties must ensure that the situation does not further deteriorate. Military means will not work; only political solutions will succeed. My President warned that there will be no winners in any modern war, as everyone will be on the losing side. He proposed to work towards the total elimination of war and a world without conflict. Finally, we again call upon all relevant parties to persist in diplomatic efforts, seek political solutions, engage in dialogue and support the United Nations as the main mediation channel. Kazakhstan is ready to work with all colleagues to preserve peace and security on the basis of mutual understanding, goodwill and determination to make the world a safer place. Mr. Radomski (Poland): I would like to thank the Secretary-General for his briefing. Poland views the recent events in the context of repeated chemical-weapons attacks against Syria's civilian population as a consequence of the impunity enjoyed by the perpetrators so far. The lack of an appropriate response encourages a greater number of attacks with the use of weapons that are both banned under international law and blatantly inhumane. In such circumstances the international community cannot remain passive. It should take all the necessary measures to prevent such attacks from being repeated in the future, in particular against a defenceless civilian population. At the same time, the competent international bodies should take decisions that will enable the perpetrators to be identified and brought to justice. We fully understand the reasons behind the action taken last night by the United States, the United Kingdom and France against Syrian chemical-weapons capabilities. We support that action, as it is intended to deter chemical-weapons attacks against the people of Syria. Let me underline that it is the primary responsibility of the Security Council to set up an S/PV.8233 Threats to international peace and security 14/04/2018 12/26 18-10891 investigative mechanism to examine the use of chemical weapons in Syria. In that context, we reiterate our disappointment with the politically motivated Russian veto on the proposal for establishing an independent, impartial investigative mechanism on the use of chemical weapons in Syria. Poland will continue its international efforts aimed at the complete elimination of chemical weapons. The use of such weapons is unacceptable and should be prosecuted vigorously in every instance and location in which they are used. Poland calls for refraining from actions that could escalate the situation. Mr. Skoog (Sweden): I thank you, Sir, for convening today's important meeting. I also thank the Secretary- General for his briefing. The conflict in Syria is now in its eighth year. That is longer than the Second World War. President Al-Assad is responsible for one of the worst and most enduring humanitarian disasters of our time. From the beginning of the crisis, we have witnessed terrible violations and violence and a flagrant lack of respect for international law, in particular by Syrian Government forces. We must also never forget the atrocities committed by Da'esh. As the Secretary-General stated yesterday, we have witnessed "systematic violations of international humanitarian law, international human rights law and international law tout court — in utter disregard for the letter and the spirit of the United Nations Charter". Indeed, there are numerous and flagrant violations of Security Council resolutions, international protocols and conventions Chemical weapons have been used repeatedly in Syria. The Joint Investigative Mechanism concluded that the Syrian authorities were responsible for four chemical-weapons attacks, and Da'esh for two. The use of such weapons is abhorrent, intolerable, a war crime and a crime against humanity. That is why, as has been noted here before, the international community banned their use in the international armed conflict more than a century ago. Subsequent developments have confirmed the prohibition of the use of chemical weapons as a norm of customary international law. We will spare no effort to end the use and proliferation of chemical weapons by State or non-State actors anywhere in the world. Those responsible for such crimes must be held accountable; there can be no further impunity. The Security Council has the primary responsibility to act in response to threats to international peace and security. It is our joint responsibility to uphold the prohibition on the use of chemical weapons in armed conflict. It is our common legal and moral duty to defend the non-proliferation regimes that we have established and confirmed. That is best done through true multilateralism and broad international consensus. In that regard, we welcome the deployment of the Organization for the Prohibition of Chemical Weapon's Fact-finding Mission to Syria and we look forward to its findings. It is regrettable that the Council was unable to come together and agree on a timely, clear and unified response to the repeated use of chemical weapons in Syria. We regret that Russia, again this week, blocked the Council from setting up a truly impartial and independent attribution mechanism. That has contributed to the situation in which we find ourselves now. The use of chemical weapons is a serious violation of international law and it constitutes a threat to international peace and security. Deterrence and prevention of their use is the concern of the entire international community. We therefore share the rage and anger and are appalled by the repeated use of such weapons in Syria. It is necessary to rid Syria of chemical weapons once and for all, and hold those responsible accountable. At the same time, as the Secretary-General said in his statement yesterday, there is an obligation, particularly when dealing with matters of peace and security, to act consistently with the Charter of the United Nations, and international law in general. We are at a dangerous moment. We call for restraint and for avoiding any acts that could escalate, or further fuel, tensions. We need to avoid the situation spiralling out of control. Over the past few days, we have tried to ensure that all peaceful means to respond are exhausted. We worked tirelessly so that no stone was left unturned in efforts to find a way for the Council to shoulder its responsibility in accordance with the Charter. We have shared a proposal with Council members to achieve that objective by inviting the Secretary-General to come back to the Council with a proposal. In order to be successful, diplomacy needs to be backed by clear demands. The Secretary-General called on the Council to take action, but regrettably the Council could not unite. It was indeed a missed opportunity, but we stand ready to continue those efforts. 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 13/26 In the light of all that has now happened, it is more critical than ever to avoid an escalation and revert to the track of diplomacy for a political solution in line with resolution 2254 (2015). We reiterate our total support for the United Nations-led political process, which urgently needs to be reinvigorated, as well as the efforts of Special Envoy Staffan de Mistura and the full implementation of resolution 2401 (2018) for the cessation of hostilities. Humanitarian access can wait no longer. A sustainable political solution is the only way to end the suffering of the Syrian people. Let us all then rally around that objective. Let us redouble our efforts and put an end to the long, brutal and meaningless conflict once and for all. Mrs. Gregoire Van Haaren (Netherlands): I would like to begin by thanking the Secretary-General for his briefing today. Both yesterday and today, he spoke of the litany horrors that the Syrian population has experienced in the past seven years, of which the chemical-weapons attacks are among the most gruesome. The world hardly needs reminding of the unspeakable suffering that countless Syrian men, women and children have endured. It is a suffering that comes at the hands of Al-Assad and his allies. The Syrian regime has left the world no doubt as to its willingness to unleash terror on its own population. The repeated use of chemical weapons counts as the most cynical expression of that campaign. Just a week ago, the world was yet again confronted with reports of chemical-weapons use — that time in Douma. All the while, the Russian Federation has made clear to the world its readiness to stand by Al-Assad every step of the way. It has blocked draft resolutions in the Council that could have stopped the violence. I call upon all members of the Security Council to support a collective, meaningful response to the use of chemical weapons. But even if the Council fails to act, it should be clear to the world that the use of chemical weapons is never permissible. Against the background of past horrors and the unabated risk of recurrence, the response by France, the United Kingdom and the United States is understandable. The response was measured in targeting a limited number of military facilities that were used by the Syrian regime in the context of its illegal chemical-weapons arsenal. The action taken by those three countries made clear that the use of chemical weapons is unacceptable. Last night's response was aimed at reducing the capabilities to execute future chemical attacks. But do not let the Syrian regime and the Russian Federation think for a moment that we will waver in our pursuit of full accountability for the perpetrators of past chemical attacks. We will not settle for anything less than an independent, impartial attribution mechanism, so that the culprits of those heinous attacks can be identified and held accountable. We call on the Russian Federation to stop opposing that. The use of chemical weapons is a serious violation of international law and may constitute a war crime or crime against humanity. The Kingdom of the Netherlands strongly believes that the international community must fully uphold the standard that the use of chemical weapons is never permissible. Impunity cannot, and will not, prevail. However, should the Council continue to suffer from the paralysis inflicted by a single permanent member, we must not forget that the United Nations is bigger than the Council alone. We have strong leadership at the top of the United Nations Organization, and we have a powerful General Assembly. Both have to consider all instruments to advance accountability for the use of chemical weapons. The Kingdom of the Netherlands welcomes every option to establish an independent and impartial mechanism, whether within the framework of the United Nations framework or of other relevant international organizations, as long as it results in a mechanism that can establish who is responsible, so that the perpetrators can subsequently be held to account. Any new mechanism should build upon the important work of the Joint Investigative Mechanism and the ongoing Organization for the Prohibition of Chemical Weapons Fact-finding Mission. It is therefore crucial that the Mission have complete and unhindered access to all information and sites it deems necessary to conduct its investigations with regard to the attack with chemical weapons in Douma last weekend. The international norms against the use of chemical weapons must be respected, and the Syrian people must be relieved from the violence, hardship and injustice that has haunted them for so long. To that end, we call for a political solution and an immediate cessation of violence, as agreed upon earlier by the Council, as well as full, unhindered and immediate humanitarian access. We reiterate our determination to achieve justice for the victims. The need to collectively stand up for the fate of the Syrian people is now more apparent than ever. Mr. Llorentty Solíz (Plurinational State of Bolivia) (spoke in Spanish): My delegation would like to thank the Secretary-General for his presence and participation S/PV.8233 Threats to international peace and security 14/04/2018 14/26 18-10891 in this meeting. Bolivia would also like to thank the Russian Federation for its initiative in convening this emergency meeting of the Security Council. Today is a dark day in the history of the Council. Three permanent members have made the decision, in violation of the Charter of the United Nations, to take unilateral action against the sovereignty and territorial integrity of another State Member of the Organization. Bolivia would like to clearly and categorically express its condemnation of the use of chemical weapons or the use of chemical substances as weapons, as it is unjustifiable and criminal wherever and whenever it happens, by whomever, given it constitutes a serious crime against international law and international peace and security. Those responsible for committing such terrible and criminal acts must be identified, investigated, prosecuted and punished with the utmost rigour. Bolivia continues to demand a transparent and impartial investigation to determine who the culprits are. Aside from that topic, the purpose of this meeting is linked to the fact that, as I stated, three permanent members of the Council have used force in breach of the Charter. It is impossible to combat the alleged violation of international law by violating international law. Bolivia is surprised by the fact that, given that, they have a greater a greater responsibility for maintaining international peace and security, the permanent Council members bypass the United Nations when it suits them. They advocate for multilateralism as long as it serves their purposes and then simply discard it. When multilateralism is no longer in their interest, it no longer concerns them. This is not the only case in which, sadly, unilateral action has been used. We recall, and will not tire in recalling, such use in Iraq in 2003 and in Libya in 2011. Any such action must be authorized by the Security Council under the Charter of the United Nations. All unilateral actions run counter to international law, as well as to the values and principles of the Charter. Bolivia rejects the use and the threat of the use of force. Unilateral actions not only respond to the specific interests of those who carry them out, but are also measures that are — allow me to use the word — imperialist. It so happens that the empires that we mentioned earlier consider themselves morally superior to the rest of the world. They consider themselves exceptional and indispensable, and therefore believe that they are above the law and international law, but in reality the interest of those who unilaterally use force and violate the Charter is not to advance democracy or freedom or to combat the use of chemical weapons. Their goal is to expand their power and domination. What we have witnessed over the past few hours is an attack on the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism, which has not begun the work that was scheduled to begin today. A unilateral attack is an attack on multilateral organizations, such as the Organization for the Prohibition of Chemical Weapons. It is an attack on the Council and its primary responsibility of maintaining international peace and security. It is an attack on the Charter, and it is an attack on the entire international community. I wonder, with regard to the permanent members that used force just a few hours ago, how much money have they invested in arming and training the armed groups in Syria? What natural resources are they after? With what moral authority will they be able invoke the Charter in the future? Sadly, the history of violating the purposes and principles of the Charter is a long one. We mentioned Libya and Iraq, which were recent cases. The unilateral decision concerning Jerusalem also sent another absolutely clear signal of the lack of respect for international law. Who are the ones selling weapons to those who are bombing civilians in Yemen? Who are the ones who rejected the Paris Agreement on climate change? Who are the ones who stepped away from the global compact for safe, orderly and regular migration? Who are the ones who build walls? We nevertheless believe that it is also important to talk about history over the long term. Above all, we have been experiencing the consequences of the havoc wreaked by some of the colonialist Powers and of their disdain for international law in the Middle East that dates back over 100 years. We are currently reliving the same scenario in Syria, characterized by total disregard for international law. To a certain extent, we relived it, for example, when the United Kingdom refused to return the sovereignty of the Malvinas islands to Argentina or when the Chagos Archipelago issue was not resolved. I hope that the advisory opinion of the International Court of Justice concerning that matter will be respected. In other words, we are talking about a whole range of policies that are detrimental to international peace and security. 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 15/26 The Permanent Representative of the United States said that the United States, her country, has its finger on the trigger — "locked and loaded". Of course, we clearly heard her words with a great deal of concern and sadness. We know that the United States has aircraft carriers, satellites, smart bombs and an arsenal of nuclear weapons, and we also know that it has nothing but scorn for international law. But we have this — we have the purposes and principles of the Charter, and ultimately, as history has shown time and again, those principles will prevail. Mr. Alotaibi (Kuwait) (spoke in Arabic): At the outset, we thank Secretary-General António Guterres for his briefing at the beginning of this meeting. The State of Kuwait believes in and is committed to the Charter and principles of the United Nations, respect for the sovereignty of States, non-interference in the internal affairs of other States, and the peaceful settlement of disputes. Article 24 of the Charter of the United Nations confers upon the Security Council the responsibility for the maintenance of international peace and security, whereby it can act on behalf of Member States to carry out that mandate. Article 25 stipulates that the Members of the United Nations agree to accept and carry out the decisions of the Security Council. What we have witnessed in the Syrian crisis is an impasse concerning the international community's efforts and the flagrant violation of its resolutions. We have followed very closely and with great concern the dangerous developments in Syria relating to recent military operations in response to the use by the Syrian authorities of chemical weapons prohibited by international law. We underscore that those developments are the result of the impasse in the international community's efforts embodied by the Security Council to reach a political settlement to the bloody conflict in Syria, which has gone on for more than seven years. It has led to hundreds of thousands of casualties and millions of displaced Syrians and resulted in the major destruction of civilian infrastructure in several cities. The chemical weapons issue long enjoyed a unified approach in the Council, which condemned the use of all chemical weapons in Syria regardless of who uses such weapons. Moreover, the Security Council adopted resolution 2118 (2013) unanimously, imposing measures under Chapter VII of the Charter in case of the non-compliance of various parties with its provisions or the continued use in Syria of chemical weapons, which, as we have said, are internationally banned weapons. In order to ensure the implementation of that resolution, in August 2015 the Security Council adopted resolution 2235 (2015), established the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism to determine those responsible for any crime involving the use of chemical weapons in Syria. In fact, the Mechanism identified the perpetrators of such crimes on several incidents. The unfortunate divide in the positions of the Council encouraged the parties to the crisis to continue their violations of resolutions of international legitimacy, international human rights law and international humanitarian law, as well as relevant Security Council resolutions. The most recent resolution 2401 (2018), adopted unanimously, is another example of resolutions being violated. It calls for the immediate cessation of hostilities in order to allow for humanitarian access to the besieged areas. Unfortunately, that humanitarian resolution was not implemented, as we know. The State of Kuwait regrets this escalation and calls on members to overcome their differences within the Security Council and to restore the unity of the Council so that it can shoulder its responsibility for the maintenance of international peace and security, in accordance with the Charter of the United Nations. We also call on members to bridge the existing gap by establishing a new, independent, impartial and professional mechanism to investigate the use of any chemical weapons in Syria and to determine who is accountable for such crimes. We reiterate our full readiness to participate in any effort aimed at achieving a compromise among the positions of members of the Council so as to ensure that those who are responsible for these crimes will be held accountable and punished, and to preserve the non-proliferation regime. It is certain that there is no military solution to the Syrian crisis. Intensive efforts must be made to spare the Syrian people further suffering. We reiterate our principled and firm position regarding the Syrian crisis, which is in line with the position of the League of Arab States calling for the preservation of the unity, sovereignty and independence of Syria; putting an end to acts of violence and the killing; avoiding bloodshed; saving Syrian lives; and reaching a peaceful settlement under the auspices of the United Nations on the basis of the 2012 Geneva First Communique, and resolution 2254 (2015), through a process of political transition S/PV.8233 Threats to international peace and security 14/04/2018 16/26 18-10891 with the involvement of all Syrian parties so that the Syrian people can achieve their legitimate aspirations. Mr. Alemu (Ethiopia): I would like to thank the Peruvian presidency for responding quickly to the request for the holding of this meeting, and we would like to express our appreciation to Russia for making the request. It would have been a serious dereliction of duty on the part of the Council if it had failed to meet in the light of what transpired yesterday. We also thank the Secretary-General for his briefing and his presence today. For those of us who are elected members of the Security Council, the responsibility is indeed extremely heavy, to the point of being unbearable. Let us not forget that we are here representing 193 countries, to which, like permanent members, we have made solemn promises that are generally encapsulated in the Charter of the United Nations. For those of us who are members of the African Union, an organization that for obvious historical reasons attaches huge importance to scrupulous adherence to the principles of the Charter, the obligation that we have to tell the truth and to stand up and be counted for peace is also enormously heavy — all the more so when the parties involved, from our own national perspective, are friends. It was only yesterday that the Secretary-General urged Member States to act responsibility in these dangerous circumstances and stressed the need to avoid the serious situation from spiralling out of control (see S/PV.8231); indeed, he repeated the same sentiment today. We have also been repeatedly expressing our concern that the dynamic in Syria could lead to devastating consequences not only nationally, but regionally and internationally. No doubt, the strike undertaken by the three countries yesterday appears not to have led to the situation spiralling out of control. We do not take that lightly, even though it might be difficult to be consoled by that fact in the light of the potential danger we still face. That is why we call for maximum restraint, the exercise of wisdom and a quick return to dialogue among the major powers that have enormous influence on the current situation in Syria. As we stressed yesterday and previously, it is absolutely vital to resume the path of diplomacy. The alternative is without a doubt catastrophic beyond our imagination. We hope that no one wants to see that happen, but it could if we do not act together with a huge sense of urgency to defuse the current tension and reduce further military escalation. By no means do we overlook the genesis of this tragedy we are facing. It has to do with the alleged use of chemical weapons in Douma. At least, that is what ratcheted up the tension, leading to what took place yesterday, which is difficult to defend as being consistent with the principles of the Charter of the United Nations. But there is also one point that makes it difficult for us to understand what took place yesterday. The Fact-finding Mission of the Organization for the Prohibition of Chemical Weapons (OPCW) is arriving, or, as just said by the Secretary-General, has already arrived in Syria to investigate the alleged use of chemical weapons, which is the cause of all this tension. In the light of that, you must excuse us, Mr. President, if we were a little perplexed. While the priority of the time is clearly to avert the further escalation of the latest development, we are not underestimating the importance of ensuring accountability for any confirmed use of chemical weapons in Syria. In that regard, the OPCW Fact-finding Mission should be allowed to conduct a thorough investigation to establish the facts related to the alleged chemical weapons attack in Douma. The sustainable way to end impunity, which we believe is extremely important, to deter and stop the use of chemicals as weapons is through united and concerted action, including through an attribution mechanism that the Council could and must set up. That has become all the more critical now, when, as we all know, truth is becoming very difficult to establish. An opportunity has been created for parties and even individuals to claim the veracity of their own facts. We know that we are all disappointed by the current deadlock, but that should not justify overlooking the obligation to adhere to the principles of the Charter. Let me conclude by referring to what the Secretary-General said yesterday. I wanted to refer to it again because it reflects the truth and is, therefore, worth repeating: "[T]he Cold War is back with a vengeance — but with a difference. The mechanisms and the safeguards to manage the risks of escalation that existed in the past no longer seem to be present." (S/PV.8231, p. 2) That is why we must appeal to the members of the Security Council, especially the Permanent Five, to help create a situation where diplomacy would have the upper hand and the primacy of politics will be our guide for coming out of what is a troubled moment in our 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 17/26 recent history. The Geneva process and Special Envoy de Mistura need the unqualified support of the Council. Mr. Ndong Mba (Equatorial Guinea) (spoke in Spanish): I thank Secretary-General Guterres for his statement, which clearly illustrates the perspective of the United Nations on this issue. What took place last night was clearly not a surprise to any member of the Security Council. It remained to establish only the day and the time. In fact, as we said in our statement yesterday (see S/PV.8232), we are concerned about the rhetoric that we are hearing and where it will lead us. It has now led us to where we feared and did not want to go — military attacks against Syria. Yesterday in this Chamber, Secretary-General António Guterres spoke about the memory of the Cold War, which in fact returned with a vengeance in the early hours of the morning, reminding the peoples of the world of the conflict of interests that still exists between two blocs. The Republic of Equatorial Guinea has followed with great concern the reports on the attacks carried out by the United States, with the support of the armed forces of France and the United Kingdom. According to estimates, the coalition fired more than 100 cruise missiles and air-to-ground missiles from two United States naval ships stationed in the Red Sea, as well as from tactical warplanes that overflew the Mediterranean and B-1B bombers from another area. The coalition launched a coordinated attack on three targets, which included a scientific research centre in an area of Damascus, a facility to the west of Homs and a command post near that facility. While surgical and very selective, last night's strikes are a violation of Chapter V of the Charter of the United Nations and of the principles and norms of international law. It is important to recall that, according to Article 24 of the Charter, the Security Council has the primary responsibility for the maintenance of international peace and security. Members of the Council must therefore refrain from creating situations of insecurity and instability. The Security Council should not highlight or disregard the fact that those strikes may have unpredictable and potentially tragic consequences for the Middle East by encouraging or justifying the development of nuclear programmes in order to prevent any further aggression. Experts of the Organization for the Prohibition of Chemical Weapons (OPCW) are already in Douma to carry out investigations. Until we have reliable and irrefutable proof of the alleged chemical attack in Douma last week, the Republic of Equatorial Guinea is of the view that no aggression can be justified. Our delegation also reiterates that, in accordance with Article 33 of the Charter, in the case of any dispute that is likely to endanger the maintenance of international peace and security, it is imperative to seek a solution first and foremost through negotiation, mediation or other peaceful means. History continues to show us that military interventions never resolves conflicts but, instead, cause them to proliferate and to continue, causing devastation and destruction. We must ensure that that does not happen again in the case of the Syrian Arab Republic. We again point out that the military intervention in Libya in 2011 and its consequences today should be a clear lesson to the international community. The Republic of Equatorial Guinea opposes the use of force in international relations. We accept its use only when it is in line with the principles of international law and the provisions of the Charter of the United Nations. As we have already said, in the case of Syria, it would not bring about any substantial change in the overall situation in the country. We reiterate that political agreement is the only viable way to find a lasting solution to the Syrian problem. All the parties involved must resolve their differences through dialogue, agreement and consultation. That process requires the support of the international community. The failure of diplomacy only exacerbates the suffering of the Syrian people and is the highest expression of the Security Council's failure. Equatorial Guinea continues to believe that, in order to fully clarify the 7 April events in Douma, a thorough, impartial and objective investigation must be carried out in order to reach a reliable conclusion. We urge the OPCW Fact-finding Mission in the Syrian Arab Republic to promptly carry out an investigation and to report to the Security Council on its conclusions as soon as possible. We also again reiterate the urgent need to establish, under the auspices of the Secretary- General, a professional, independent and transparent investigative body to attribute responsibility for and identify the perpetrators of the use of chemical weapons so that those responsible, whoever they are, are brought to international justice. Only in that way can that thorny issue achieve consensus and unity among the members of the Security Council. S/PV.8233 Threats to international peace and security 14/04/2018 18/26 18-10891 I conclude my statement by reiterating the unequivocal position of the Republic of Equatorial Guinea, which is that we wholeheartedly condemned the use of chemical weapons by whomever. Mr. Tanoh-Boutchoue (Côte d'Ivoire) (spoke in French): The delegation of Cote d'Ivoire would like to thank the Secretary-General for his presence and for his briefing on the latest developments in Syria following the air strikes carried out by certain members of the Security Council during the night of Friday, 13 April. Côte d'Ivoire requests all the actors involved in the Syrian conflict at the various levels to show restraint and not to further complicate the disastrous situation in which the Syrian people find themselves. Weapons and bombs have struck Syria too often in disregard for our collective action towards peace. Is it necessary to recall that, by signing the Charter of the United Nations in 1945, the founding Members sought to establish a new world order based on multilateralism and its resolve to make peace a universal common good, the maintenance of which was entrusted to the United Nations and the Security Council as its primary responsibility? The Secretary- General has just reminded us of that. In every situation in which the Charter of the United Nations has guided the action of the international community, respect for its principles has always enabled us to overcome the most inextricable challenges, thereby preventing many disasters for humanity. Based on its strong conviction in the virtues of multilateralism, my country therefore believes that resorting to force in order to maintain international peace and security must be authorized by the Security Council in order to preserve its essential legal authority and to thereby prevent any deviation or abuse. Only a Security Council that is strong and representative of our time will be able to mobilize all Member States of the United Nations in support of its primary responsibility of maintaining international peace and security. Côte d'Ivoire would therefore like to express its deep concern over the inability of the Council to relaunch the dialogue in Syria and to sideline the supporters of a military solution. Côte d'Ivoire would like to take this opportunity to reiterate its unequivocal condemnation of the use of chemical weapons, no matter who is responsible, and we call for the establishment of a multilateral mechanism to attribute responsibility and to bring those responsible for the use of chemical weapons to justice in the appropriate international tribunals. In that context, my delegation reiterates its support for the investigation to be conducted by the Fact-finding Mission of the Organization for the Prohibition of Chemical Weapons in order to shed light on the allegations of the use of chemical weapons in Douma in eastern Ghouta. Côte d'Ivoire once again urges the members of the Security Council to unite with a view to putting an end to their differences and to effect the establishment of this mechanism to establish responsibility, which all the members of the Council would like to see set up. Côte d'Ivoire would like to reassert its conviction and its position of principle that the response to the crisis in Syria cannot be a military response. Quite to the contrary; it must be sought in the framework of dialogue and an inclusive political process, as envisioned in the road map set out in resolution 2254 (2015). The time has come to decisively give every opportunity for dialogue a chance and to make sure that the Council is in step with history. The President (spoke in Spanish): I shall now make a statement in my capacity as the representative of Peru. Peru notes with great concern the developments in Syria. In the face of military action, as a response to information on the use of chemical weapons against the civilian population in the country, we reiterate the need to keep the situation from spiralling out of control and causing a greater threat to stability in the region and to international peace and security. Peru condemns any use of chemical weapons as an atrocity crime. For that reason, we have supported the urgent deployment to Syria of an Organization for the Prohibition of Chemical Weapons Fact-finding Mission, as well as the establishment of a dedicated, independent, objective and impartial attribution mechanism. We regret the stalemate in the Security Council and our inability to take a decision on the issue. In that regard, Peru encourages the Secretary-General to redouble his efforts in accordance with the prerogatives entrusted to him in the Charter of the United Nations with a view to helping to resolve the stalemate in the Council and to establish the attribution mechanism. Peru believes that any response to the crimes committed in Syria, as well as a solution to the conflict in Syria overall, must be consistent with the Charter, with international law and with the Council's resolutions. 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 19/26 As the Secretary-General has reminded us, the Council is the organ with the primary responsibility for the maintenance of international peace and security, and it is up to its members to act in unity and to uphold that responsibility. Peru joins the Secretary-General's urgent appeal to all Member States to act with restraint in these dangerous circumstances and to avoid any act that could escalate the situation and worsen the suffering of the Syrian people. My delegation reaffirms its commitment to continue working in order to achieve sustainable peace in Syria, to guarantee protection for the civilian population, to ensure that there is no impunity for atrocious crimes, as well as to help defuse the situation. I now resume my functions as President of the Council. The representative of the United Kingdom has asked for the floor to make a further statement. Ms. Pierce (United Kingdom): I should like to respond to the remarks made by the Ambassador of Bolivia about the United Kingdom. We have no doubt about the sovereignty of the United Kingdom over the Falkland Islands, South Georgia, South Sandwich Islands and surrounding maritime areas. Successive British Governments have made clear that sovereignty will not be transferred against the wishes of the Falkland Islands. The Falkland Islanders voted overwhelmingly to maintain their current constitutional arrangements with the United Kingdom. Turning to the Chagos archipelago, the United Kingdom is participating in the proceedings before the International Court of Justice, even as we disagree with jurisdiction in that case. The President (spoke in Spanish): The representative of the Plurinational State of Bolivia has asked for the floor to make a further statement. Mr. Llorentty Solíz (Plurinational State of Bolivia) (spoke in Spanish): I will be very brief and limit myself to reading out what it says in the special declaration on the question of the Malvinas Islands, signed by all the Heads of State and Government of Latin America and the Caribbean. The Heads of State and Government: "Reiterate their strongest support for the legitimate rights of the Argentine Republic in the sovereignty dispute over the Malvinas, South Georgias and South Sandwich Islands and the surrounding maritime areas and the permanent interest of the countries of the region in the Governments of the Argentine Republic and of the United Kingdom of Great Britain and Northern Ireland resuming negotiations in order to find — as soon as possible — a peaceful and definitive solution to such dispute, pursuant to the relevant resolutions of the United Nations .". That would include in particular General Assembly resolution 2065 (XX). The President (spoke in Spanish): I now give the floor to the representative of the Syrian Arab Republic. Mr. Ja'afari (Syrian Arab Republic) (spoke in Arabic): I welcome the presence of the Secretary- General at this very important moment in the history and the work of the Security Council. In his important statement yesterday, the Secretary-General warned that the Cold War had returned (see S/PV.8231). That is exactly right. We all agree with the relevance of this remark. I take this opportunity to recall those who relaunched the logic of the Cold War. Of course, we all remember, following the collapse of the former Soviet Union, that a number of philosophical books were published here in this country, including The End of History and the Last Man, by Francis Fukuyama. Another author, American thinker Samuel Huntington, wrote an essay entitled The Clash of Civilizations. Those two works marked the return of the Cold War logic. Indeed, the message of those two books was as follows: To the people of the world, you must take the American approach and surrender to the American will or we will attack you. "My way or the highway", as the American saying goes. That marked the return of the Cold War philosophy. Lies serve no purpose. They serve the person who lies once and only once. Lies deceive only once. When a lie is repeated it becomes exposed and exposes the person who is lying. My colleague the Ambassador of France announced that the aggression of his country, along with the United States and the United Kingdom, was carried out on behalf of the international community. If that is the case, I wonder which international community my colleague the French Ambassador is speaking of. Is he speaking of a real international community that S/PV.8233 Threats to international peace and security 14/04/2018 20/26 18-10891 actually exists? Has the international community that he represents authorized this tripartite aggression against my country? Did their Governments obtain a mandate from this international community to attack my country? My American, French and British colleagues claimed that they have bombarded centres for the production of chemical weapons in Syria. If the Governments of these three countries knew the actual location of these production centres that they claim to have bombarded, why did they not share that information with the Organization for the Prohibition of Chemical Weapons (OPCW)? Why did they not share this information with the Fact-finding Mission in Damascus before attacking my country? It is just a question I am putting to the Security Council. Furthermore, I would like to assure Council members that the OPCW investigation team arrived today at noon. Obviously, the team was delayed for a full day getting from Beirut to Damascus before the attack, for reasons that we do not know, as though the team was asked not to go to Damascus until after the bombing took place. But the team did reach Damascus today at noon and will hold a meeting in two hours, at 7 p.m., Damascus time, with the local authorities. My Government will, of course, provide every support to the team so that it may carry out its mission successfully. The facility of the Barzah Research and Development Centre, the building that was targeted by the tripartite aggression, was visited twice last year by experts from the OPCW. They inspected it, after which they gave us an official document stating that Syria had complied with its obligations under the OPCW and that no chemical activities had taken place in the inspected building. If the OPCW experts gave us an official document confirming that the Barzah Centre was not used for any type of chemical activity in contravention to our obligations with respect to the OPCW, how do Council members reconcile that with what we have heard this morning? How do they reconcile that with all the accusations and claims that the aggression targeted a chemical-weapons production centre? My American colleague said that the time for discussion is over — that it was over yesterday (see S/PV.8231). If that is so, then what are we doing today as diplomats an ambassadors at the Security Council? Our mission here is to speak, to explain what happened, to shed light on all the issues. We are not here in the Security Council simply to justify an aggression. How can we state that the discussion is over? No, the discussion is continuing in this Chamber, if the idea is to put an end to aggressions or to implement the provisions of the Charter and international law. That is why we are here. My British and French colleagues spoke of a plan of action and have invited the Secretary-General to implement it before the Council and the Syrian Government have agreed to it. Their plan of action is in fact a very strange one. But I would like to present on behalf of my Government a counter plan of action, which, I assume, should have been presented today. First, we should read the provisions of the Charter of the United Nations and define and recall the responsibilities of the three States in maintaining international peace and security, rather than threatening it. I happen to have three versions of the Charter, two in English and one in French. Perhaps these three States should read what the Charter actually states. Secondly, these three States must immediately stop supporting the armed terrorist groups that are active in my country. Thirdly, they should put an end to the lies and fabrications being used to justify their aggression against my country. Fourthly, these three States should realize that, after seven years of a terrorist war that was imposed on my country, Syria, a war carried out by these three countries and their agents in the region, their missiles, airplanes and bombs will not weaken our determination to defeat and destroy their terrorists. This will not prevent the Syrian people from deciding their own political future without foreign intervention. I will repeat this for the thousandth time — the Syrian people will not allow any foreign intervention to define our future. I promised yesterday that we will not remain inactive in the face of any aggression, and we have kept our promise. I will explain how we have kept our promise. Allow me now to address those States that remain committed to international law. I would tell them that the Syrian Arab Republic and its many friends and allies are perfectly capable of dealing with the brutal aggression that my country has had to face. But what we are asking the diplomats and ambassadors today who are committed to international legitimacy and the Charter to call on the United States, Britain and France to read the provisions of the United Nations Charter, in particular those pertaining to respect for 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 21/26 the sovereignty of States and to the non-use of force in international relations. Perhaps the Governments of these three countries will realize, if only once, that their role in the Security Council is to maintain international peace and security rather than to undermine it. As I just said, I have three copies of the Charter, and I would ask the Council's secretariat to distribute them to the three delegations so that they might enlighten or awaken themselves from their ignorance and their tyranny. In flagrant violation of the principles of international law and the United Nations Charter, the United States, Britain and France, at 3:55 a.m. on Saturday, 14 April, Damascus time, attacked the Syrian Arab Republic by launching some 110 missiles against Damascus and other Syrian cities and areas. In response to this terrible aggression, the Syrian Arab Republic has exercised its legitimate right in line with Article 51 of the Charter to defend itself, and we have defended ourselves against this evil attack. Syrian air defences were able to intercept a number of rockets launched by the tripartite aggression, while some of them reached the Barzah Centre in — not outside — the capital Damascus. The Centre in that location that includes laboratories and classrooms. Fortunately, the damage was only material. Some of those modern, charming and smart rockets were intercepted, while others targeted a military site near Homs, wounding three civilians. The Governments of these three States prepared for this evil attack by issuing aggressive statements through their senior officials, saying that their only excuse for preventing the advance of the Syrian Arab Army against armed groups was these allegations of the use of chemical weapons. Indeed, in a race against time, the armed terrorist groups did receive instructions from those aggressors to fabricate this charade of the use of chemical weapons in Douma. They found false witnesses and manipulated the alleged crime scene as they did before, which served as the pretext for this scandalous aggression. This can only be explained by the fact that the original aggressors — the United States of America, Britain and France — decided to interfere directly in order to avenge the defeat of their proxies in Ghouta. In fact, those who fabricated the charade of the chemical attack in Ghouta were arrested and admitted on television that it was a fabricated attack. We have a video of that if the presidency wishes to see it. I would like to draw the attention of those who align themselves with the Charter of the United Nations and international legitimacy to the fact that this evil aggression sends another message from those three aggressors to the terrorist groups that they can continue using chemical weapons in the future and committing their terrorist crimes, not against Syrian civilians only but in other countries. There is no doubt about that. In 146 letters we have drawn the Council's attention to the plans of the terrorist groups to use chemical weapons in Syria. There are 146 letters that have been sent to the Council and the Secretariat. Today, some Council members are suddenly reinventing the wheel. The Council knows that this aggression took place just as a fact-finding team from the OPCW was supposed to arrive in Syria at the request of the Syrian Government to examine the allegations of a chemical attack in Douma. Obviously, the main message that these aggressors are sending to the Council and to the world is that they are not actually interested in the Council's mandate and that they do not want a transparent and independent investigation. They are trying to undermine the work of the investigative mission and anticipating the results. They are trying to put pressure on that mission to conceal their lies and fabrications, just as happened six years ago, in 2013, when Mr. Sellström went to Khan Al-Assal from Damascus, as I have explained in a previous statement to the Council. This morning's attack was not just an attack on Syria, as my dear friend, the representative of Bolivia said; rather, it was an attack against the Charter, the Council, international law and 193 members of this Organization. The attempt by Washington, D.C., London and Paris to ensure the failure of the United Nations working groups and fact-finding missions is systematic. While those three States boast of their support for these bodies, behind the closed doors of the Organization they pressure and blackmail them not to carry out the mandates for which they were established. We recall what took place with the investigative missions in Iraq, Libya, Yugoslavia and Africa. No investigative mission can be successful if it is subjected to political blackmailing. It cannot succeed. Of the three aggressors, I say they are liars. They are compulsive liars. They are hypocrites. They are attempting to ensure the failure of any action of the Organization that does not serve their interests. Ever since the Organization was established, they have tried to undermine the efforts of international investigative bodies. They have tried to exploit them. I need only mention Iraq, Yugoslavia, Libya, Syria, and Africa. The aggressors exhausted the Council agendas for decades S/PV.8233 Threats to international peace and security 14/04/2018 22/26 18-10891 with their attempts to divert its attention from its role in the maintenance of international peace and security. They used the Council to pursue their aggressive policy of interference and colonialism. Yesterday, in the press of the United States and of the West, the main theme was lying in the context of a campaign that was claiming success, but they know it was a lie. While these three Governments were launching their evil aggression against my country, Syria, and while my country's air defence system was countering the attacks with a great deal of bravery — one hundred missiles were destroyed and did not reach their target — the American Secretary of Defense and the Army Chief of Staff were before the American and international press in an outrageous surrealist scenario. They were not actually able to answer objective questions. Millions of television viewers must have pitied those two men because they were like dunces, repeating phrases without any meaning, and were unable to respond to the legitimate questions of a journalist about their attempts to target chemical weapons facilities and the danger that posed to civilians if the alleged chemical weapons were to spread. They did not respond. They were also unable to respond to a journalist who asked the Secretary of Defense, "You said yesterday that you had no proof that the Syrian Government was responsible for the attack in Douma. What happened in the past few hours? What made you change your mind?" His answer was that he received confirmation from intelligence services. The Syrian Arab Republic condemns in the strongest terms this tripartite attack, which once again shows undeniably that those three countries pay no heed to international legitimacy, even though they repeatedly say they do. Those countries have revealed their belief in the law of the jungle and the law of the most powerful even as they are permanent members of the Security Council, an organ entrusted with maintaining international peace and security and with stopping any aggression, in accordance with the principles and purposes of the Charter. The Syrian Arab Republic is disgusted by the scandalous position of the rulers in Sheikhdom of Qatar, who supported this Western colonial tripartite aggression by allowing planes to take off from the American Al Udeid air base in Qatar. It is not surprising that the little boys of the Sheikhdom of Qatar took that position. They have supported terrorist gangs, such as the Muslim Brotherhood and others, in a variety of ways in order to destabilize Arab countries, including Syria. The Syrian Arab Republic is asking the international community, if it exists — we have heard a new definition of the international community today — and the Security Council to firmly condemn this aggression, which will exacerbate the tensions in the region and which is a threat to international peace and security throughout the world. I call upon those who are committed to international legitimacy to imagine with me the meeting in which the United States National Security Council decided to carry out this attack. I cannot help wondering what was said. "We have no legal basis for attacking Syria. We have no proof that a toxic chemical weapons attack took place in Douma, but let us set that aside. We did not need international legitimacy or any legal argument to conduct military interventions in the past." I am just imagining the discussion that might have taken place among them yesterday. "This military action is necessary for us and for our allies in order to distract public attention in our countries from the scandals involving our own political elite and ensure that the corrupt system in some Gulf States pays the price of such aggression. Most important is how to protect the terrorism that we have sponsored in Syria for years." The President (spoke in Spanish): Members of the Council have before them document S/2018/355, which contains the text of a draft resolution submitted by the delegation of the Russian Federation. The Council is ready to proceed to the vote on the draft resolution before it. I shall put the draft resolution to the vote now. A vote was taken by show of hands. In favour: Bolivia (Plurinational State of), China, Russian Federation Against: Côte d'Ivoire, France, Kuwait, Netherlands, Poland, Sweden, United Kingdom of Great Britain and Northern Ireland, United States of America 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 23/26 Abstaining: Equatorial Guinea, Ethiopia, Kazakhstan, Peru The President (spoke in Spanish): The draft resolution received 3 votes in favour, 8 against and 4 abstentions. The draft resolution has not been adopted, having failed to obtain the required number of votes. I now give the floor to those Council members who wish to make statements after the voting. Mr. Skoog (Sweden): We voted against the draft resolution submitted by the Russian Federation (S/2018/355) because we believe that its language was unbalanced. It was not comprehensive and failed to address all of our concerns about the current situation. At the same time, we agree with the Secretary-General that actions must be consistent with the Charter of the United Nations and with international law in general. In our national statement delivered earlier today, we explained our view on the current situation in Syria and condemned the use of chemical weapons and the many other flagrant violations of international law in Syria. We also underscore the importance of a sustainable political solution. As members of the Security Council, we reiterate that we must unite and exercise our responsibility with regard to the situation in Syria. If there is any encouragement today, it is that it appears that everyone around the table insists on a sustainable political solution as the only way to end the suffering of the Syrian population. We therefore reiterate our full support for the United Nations political process, which must now be urgently reinvigorated, including through strong support for the efforts of Special Envoy Staffan de Mistura. Mr. Alemu (Ethiopia): We would like to explain why we abstained in the voting on the draft resolution proposed by Russia (S/2018/355). We abstained not because the text does not contain a great deal of truth — indeed it does — or because it does not adhere to principles to which we should all adhere; it does. We abstained on the grounds of pragmatism. We know that even if it had received nine votes, it would have been vetoed. Therefore it would have had only symbolic value. Nonetheless, that is not unimportant. However, for us, it is critical to defuse tensions and prevent the situation from spiralling out of control. We would like to play a constructive role in that regard. Mr. Umarov (Kazakhstan): Kazakhstan abstained in the voting today on draft resolution S/2018/355 because we believe that all disputes among States should be resolved through peaceful dialogue and constructive negotiations on the basis of equal responsibility for peace and security. As I mentioned in my statement earlier today, we call for all parties to refrain from actions that could aggravate tensions and cause the situation to spiral out of control. Mr. Ndong Mba (Equatorial Guinea) (spoke in Spanish): Our abstention reflects the frustration of the Republic of Equatorial Guinea with regard to the failure to adopt a resolution to establish an attribution and accountability mechanism to identify those responsible for the use of chemical weapons. We reiterate our call for a consensus-based resolution that would establish that mechanism and prevent a repeat of the action we witnessed yesterday. In that regard, we recall that the Swedish initiative was endorsed by the 10 elected members of the Council. We could introduce the required changes into the draft resolution to enable its adoption by consensus, which would allow the mechanism to be established under the auspices of the Secretary-General. Mr. Delattre (France) (spoke in French): The draft resolution submitted by Russia (S/2018/355) has just been categorically rejected. The result of the voting sends a clear message that the members of the Council understand the circumstances, reason for and objectives of the military action taken yesterday. The Council understands why such action, which has been acknowledged as proportional and targeted, was required. No one has refuted the fact that the use of chemical weapons cannot be tolerated and must be deterred. That is the key point. It is important that we now look towards the future. As I have just said, the air strikes were necessary and served to uphold international law and our political strategy to end the tragic situation in Syria. It is for that reason that, together with our American and British partners, France will work with all members of the Security Council to submit a draft resolution on the political, chemical and humanitarian aspects of the Syrian conflict with a view to devising a lasting political solution to the conflict. Mrs. Gregoire Van Haaren (Netherlands): The Kingdom of the Netherlands voted against the draft resolution proposed by the Russian Federation S/PV.8233 Threats to international peace and security 14/04/2018 24/26 18-10891 (S/2018/355) because the text does not provide for the urgent action that the Security Council must take in response to the use of chemical weapons in Syria. It ignores the very essence of the action that must be taken by the Council. It should condemn the use of chemical weapons in Syria, protect its people and hold accountable those responsible. Today's draft resolution does none of the above. Mr. Alotaibi (Kuwait) (spoke in Arabic): Kuwait voted against draft resolution S/2018/355. At the time when the State of Kuwait reiterates its adherence to the purposes and principles of the Charter of the United Nations, which prohibits the threat or use of force as a means to settle disputes and requires them to be settled by peaceful means, yesterday's use of force was the result of efforts to disrupt the will of the international community, specifically by hindering the Security Council in its determination to take measures at its disposal to end the ongoing use of internationally prohibited chemical weapons in Syria. That is a flagrant violation of resolution 2118 (2013), which unequivocally expresses the Security Council's intention to act under Chapter VII of the Charter when one party or several parties fail to comply with its provisions or in the case of the continued use of chemical weapons in Syria. The Council must once again show its unity and bear its responsibility for maintaining international peace and security, in accordance with the Charter. It must agree on a new independent, impartial and professional mechanism for investigating any use of chemical weapons, bring those responsible for such crimes to account, and ensure that they do not enjoy impunity. We call for intensified efforts and a return to the political track, under the auspices of the United Nations, with the aim of reaching a peaceful settlement to the crisis based on the first Geneva communiqué (S/2012/522, annex) and resolution 2254 (2015). Mr. Ma Zhaoxu (China) (spoke in Chinese): China has always opposed the use of force in the context of international relations. We advocate for respecting the sovereignty, independence, unity, and the territorial integrity of all countries. Any unilateral military action bypassing the Security Council runs counter to the purposes and principles of the Charter of the United Nations, violates the principles of international law and the basic norms governing international relations and, in the present case, will further complicate the Syrian issue. Based on that principled position, China voted in favour of draft resolution S/2018/355, proposed by the Russian Federation. I would like to emphasize here that a political settlement is the only viable pathway to solving the Syrian issue. China urges the parties involved to remain calm, exercise restraint, return to the framework of international law and resolve issues through dialogue and negotiations We support the role of the United Nations as the main channel for mediation, and we will spare no effort to reach a political settlement of the situation in Syria together with the international community. Mr. Nebenzia (Russian Federation) (spoke in Russian): Today is the day when the Security Council and the world community should raise their voices in the defence of peace, security, the Charter of the United Nations and international law. Every delegation in this Chamber is a sovereign country, and no one should attempt to pressure or dictate to any of us how to interpret international law and the Charter of the United Nations, or how to consult our own consciences. We have never hesitated to vote in accordance with the dictates of international law, the Charter, our conscience and truth. Today's meeting confirms that the United States, Britain and France, all permanent members of the Security Council, continue to plunge world politics and diplomacy into a realm of myths, myths that have been created in Washington, London and Paris. That is dangerous work, representing a kind of diplomacy that traffics in myths, hypocrisy, deceit and counterfeit ideas. Soon we will arrive at the diplomacy of the absurd. These three countries create these myths and try to force everyone to believe in them. We counter their myths with facts and a true picture of what is going on. But they do not want to see or hear. They simply ignore what they are told. They have come up with a legend about Russia as a constant wielder of the Security Council veto whom they purposely provoke into using the veto so as to then present themselves in a favourable light, especially right now. They are distorting international law and replacing its concepts with counterfeits. They are unabashedly hypocritical. They demand an investigation, and before the investigation has even started they name and punish the guilty parties. Why did they not wait for the result of the investigation that they themselves all called for? The Security Council is paralysed because of these countries' persistent deceptions both of us 14/04/2018 Threats to international peace and security S/PV.8233 18-10891 25/26 and the international community. They are not only putting themselves above international law, they are trying to rewrite it. They violate international law and try to convince everyone that their actions are legal. The representative of the United Kingdom gave three reasons justifying the missile strikes based on the concept of humanitarian intervention. They are trying to substitute them for the Charter. That is why we and other countries did not support it then and do not support it now, because we do not want it to become the justification for their crimes. We demand once again that that they halt this aggression immediately and refrain from the illegal use of force in the future. Today we once again showed the whole world how we play our underhanded games. In Soviet times there was a pamphlet entitled Where Does the Threat to Peace Come From? that described Washington and the NATO countries' military preparations. Nothing has changed. The threat to peace comes from exactly the same place. Look at what they say and listen to the war drums that they are beating in Washington today in the guise of hypocritical concern for democracy, human rights and people in general. The five-minute rule in the latest presidential note's rules of procedure (S/2017/507) will not allow me to list them, because the list is too long. I could cite other examples, as for example how the President of France showed interest in a conversation with President Putin in an investigation in Douma and was ready to send French experts there when that idea suddenly disappeared. Because a different algorithm was put forward. That is obvious. Today is a sad day. It is a sad day for the world, the United Nations and its Charter, which has been blatantly violated, and the Security Council, which has shirked its responsibilities. I should like to believe that will not see another day as bad as today. The President (spoke in Spanish): I shall now make another statement in my national capacity. Peru abstained in the voting because we believe that the draft resolution did not adequately reflect the need to guarantee due accountability for the use of chemical weapons throughout Syrian terrority and because its language is imbalanced and would not help to restore the Council's unity, which is critical to addressing the events in Syria in a comprehensive manner. I now resume my functions as President of the Security Council. The representative of the United Kingdom has asked to make another statement. Ms. Pierce (United Kingdom): I think it is obvious why we voted against the draft resolution. We support completely what the French representative laid out about next steps and we will work tirelessly to that objective, along with partners on the Council. The Russian Ambassador referred to myths. These are not our myths. The way forward in the Council has been blocked. The second of our own criteria for taking this action on an exceptional basis must be objectively clear. There is no practicable alternative to the use of force if lives are to be saved. In the 113 meetings of the Council on Syria, I think that has been demonstrated absolutely crystally clear. The United Kingdom believes that it cannot be illegal to prevent the use of force to save lives in such numbers as we have seen in Syria. The reason we took this action — our legal basis — was that of humanitarian intervention. We believe that that is wholly within the principles and purposes of the United Nations. The President (spoke in Spanish): The representative of the Syrian Arab Republic has ask for the floor to make a new statement. I now give him the floor. Mr. Ja'afari (Syrian Arab Republic) (spoke in Arabic): I apologize for requesting the floor once again. The scene that we have just witnessed is quite sad. There are those in the Council who prefer to overlook an enormous elephant that we have spoken of before. The elephant is the direct American military occupation of one-third of my country's territory — a direct American military occupation of one-third of the Syrian Arab Republic territory. However, there are those who speak of minor details which they believe to be pivotal. No, the political scene is far more dangerous than that. We are a State whose sovereignty has been facing a direct military violation by a permanent member of the Council. That is the true scene, and not the allegations and the film prepared by the terrorist organization known as the White Helmets established by British intelligence. We need to focus on the main scene here. Some would claim that they are fighting Da'esh in Syria and Iraq. However they have given air cover to Da'esh. Whenever the Syrian Arab Army makes advances against Da'esh, United States, British and French war planes bombard our military sites. Why? To prevent our decisive victory against that entity. However, they failed S/PV.8233 Threats to international peace and security 14/04/2018 26/26 18-10891 and we were able to achieve victory against Da'esh with our brothers in Iraq in three years and not in thirty, as former President Obama predicted. We understand that the capitals of the three countries that launched the aggression against my country are frustrated. Some colleagues who voted against the Russian draft resolution (S/2018/355) claim to support a political settlement. We tell them now, after their shameful vote against the draft resolution, that those who voted against it are no longer partners of the Syrian Government in any political process. The British Ambassador explained things about the Malvinas Islands. That testimony reveals the facts about the imperialistic policies of Britain. I am actually the Rapporteur of the Special Committee on Decolonization (C-24) and I work under the agenda of the United Nations and the Secretary-General. My task and that of my colleagues in the C-24 is to end colonialism throught the world. The Malvinas are on the list of territories that do not enjoy self-governance. We are working in accordance with the United Nations agenda to end the British occupation of the Malvinas. As for my colleague the Ambassador of Kuwait, I remind him — although he and his Government are well aware of it — that when my country participated in the liberation of Kuwait, we did not justify our principled position to the people of Kuwait. Our position was a principled one. We did not need draft resolutions, meetings or any tripartite aggression. We did not look into the provisions of the Charter of the United Nations or undermine our national obligations to our brothers in Kuwait, nor did we join any bloc that was hostile to Kuwait. We fulfilled our national duty towards our brothers in Kuwait. The Ambassador of Kuwait will also recall that my country could have played a different role at the time and could have negatively impacted the peace, safety and security of Kuwait, but we chose not to do so. We acted pursuant to a national principled position that was not subject to negotiation or discussion. The meeting rose at 1.50 p.m.

Dale Lewis Johnson ; The Weber and Davis County Communities Oral History Collection include interviews of citizens from several different walks of life. These interviews were conducted by Stewart Library personnel, WeberState University faculty and students, and other members of the community. The histories cover various topics and chronicle the personal everyday life experiences and other recollections regarding the history of the Weber and Davis County areas. ; 78p.; 29cm.; 2 bound transcripts; 4 file folders. 1 sound discs: digital; 4 3/4 in. ; Oral History Program Dale Lewis Johnson Interviewed by acquaintances, Matt and Kathy July 2010 Oral History Program Weber State University Stewart Library Ogden, Utah Dale Lewis Johnson Interviewed by acquaintances Matt and Kathy July 2010 Copyright © 2010 by Weber State University, Stewart Library Mission Statement The Oral History Program of the Stewart Library was created to preserve the institutional history of Weber State University and the Davis, Ogden and Weber County communities. By conducting carefully researched, recorded, and transcribed interviews, the Oral History Program creates archival oral histories intended for the widest possible use. Interviews are conducted with the goal of eliciting from each participant a full and accurate account of events. The interviews are transcribed, edited for accuracy and clarity, and reviewed by the interviewees (as available), who are encouraged to augment or correct their spoken words. The reviewed and corrected transcripts are indexed, printed, and bound with photographs and illustrative materials as available. Archival copies are placed in Special Collections. The Stewart Library also houses the original recording so researchers can gain a sense of the interviewee's voice and intonations. Project Description The Weber and Davis County Community Oral History Collection includes interviews conducted by Weber State University faculty, staff and students, and other members of the community. The interviews cover various topics including city government, diversity, personal everyday life experiences and other recollections regarding the history of the Weber and Davis County areas. ____________________________________ Oral history is a method of collecting historical information through recorded interviews between a narrator with firsthand knowledge of historically significant events and a well-informed interviewer, with the goal of preserving substantive additions to the historical record. Because it is primary material, oral history is not intended to present the final, verified, or complete narrative of events. It is a spoken account. It reflects personal opinion offered by the interviewee in response to questioning, and as such it is partisan, deeply involved, and irreplaceable. ____________________________________ Rights Management Special Collections All literary rights in the manuscript, including the right to publish, are reserved to the Stewart Library of Weber State University. No part of the manuscript may be published without the written permission of the University Librarian. Requests for permission to publish should be addressed to the Administration Office, Stewart Library, Weber State University, Ogden, Utah, 84408. The request should include identification of the specific item and identification of the user. It is recommended that this oral history be cited as follows: Dale Lewis Johnson, an oral history by acquaintances Matt and Kathy, July 2010, WSU Stewart Library Oral History Program, Special Collections, Stewart Library, Weber State University, Ogden, UT. iii Dale Lewis Johnson July 2010 1 Abstract: This is an interview between Dale Lewis Johnson, referred to as Lewis, and two of his acquaintances, Matt and Kathy. The interview took place in July of 2010, just prior to his passing, and includes stories from his personal life as well as his theories on relationships. M: So how did you end up in Los Angeles? Maybe we should start with your immaculate birth. L: I'd been in a two year relationship in Salt Lake. When it ended, I basically had a nervous breakdown. I destroyed this man's life: I reported him to the IRS even though he hadn't done anything, I outed him to his family and I got him fired from his job. I made his life so bad that he moved to Texas just to get out of here. I was very vengeful back then. I wanted to get out of Utah. I figured Utah was part of my problem as far as the guilt of being gay and stuff. My sister was going down to Phoenix to trucking school, and I went with her down there. It was at that time that I really started drinking heavy. My sister was drinking heavy, and they couldn't keep a job. They'd finally had enough and decided to come back to Utah, but I refused. I was never coming back to Utah. So they left and I found myself homeless. I found a halfway house where I could live. You either had to go door to door asking for money, or you had to have a job and pay. I happened to have a job. I worked as a cocktail waiter in a bar. The guy who ran the house was a mean guy. He dealt drugs, and had the guys that stayed in the house go out on his drug runs for him. If you didn't do what he said, he'd just kick you out. Well, 2 he made the mistake of giving me and one of the other guys in the house $900 to go pay the mortgage on the house. We had the good idea to take that money and get out of Phoenix. So we took that $900 and went to LA. We drank it all away and within two days, we didn't have any more money. We got in a fight. He thought I was hiding the money, and I thought he was hiding the money. We just spent it all, so we went our own ways. That's how I found myself homeless in LA. The only thing I had was the clothes on my back. At that point I tried prostitution. I was still kind of a naïve Mormon boy, so that really didn't work well. I ended up pawning the Movado watch I had for fifteen bucks, and that got me into a bath house, that also served a buffet dinner. So I had a place to sleep for the night and dinner. I met a guy who worked in there, and he offered me a place to stay. I ended up falling in love with him. He got me a job in the movie industry, which I worked at for the next eleven years. He is also the one who introduced me to drugs. When I was involved in drugs, I never felt safe in the house, so I spent a lot of time on the streets. Survival on the street has a lot to do with the image you portray. So that's when I really started to take on that gangster look – the shaved head, the whatever to fit in. I was known as Dale up until that point. My family still knows me today as Dale, not Lewis. But Dale was too "white" for Los Angeles, so I changed my name to my middle name, which is Lewis, and started going by that. I kept that name. M: That's really interesting. What did you do in the film industry? 3 L: I worked for a prop company that rented props to movie studios. I worked in the drapery department, and so I made drapery and bedspreads and stuff for movies and TV. I really enjoyed that time. M: That's really cool. Can you come make drapes for my house? L: I could. When I came to Utah, I set up shop, but I was spoiled working in the movie industry where you get paid sixty bucks an hour, and they bring you and tell you exactly what they need. Here, people don't know what they want, they want you to go shopping with them for fabric, even if you make it they don't like it… and they don't want to pay you anything, so I ended up selling most of my machines. M: What happened to the guy you fell in love with? L: We spent two years together. Then, in 1988 is when I was diagnosed with Acquired Immunodeficiency Syndrome. He was diagnosed at the same time. I knew, from reading a book that was given to me by Louise L. Hay, You Can Heal Your Life, that I needed to change my life if I wanted to live. That meant everything. I needed to quit doing the drugs, I needed to quit the drinking – all of that. He did not want to do that, and I could not stay living with him, with him doing it and me not, so I left him. Within six months, he died. I had a lot of guilt about that for a long time. I was not able to be there for him. I since then, though, have talked to him in spirit, and everything's okay. M: When did you realize that the book by Louise Hay was actually working and that Human Immunodeficiency Virus was manageable? 4 L: You know, when I was diagnosed, it was a death sentence. They didn't give you any hope. That's why I really started to follow my intuition. I really started becoming aware of it, and what I was getting was, do not take the drugs, do not listen to the doctors. And so I didn't. In my lifetime, I have been to a hundred doctors that I have fired, because they basically told me, if you don't do what we say, you're going to die. And I told them, I'm not coming back to you. I honestly believe today that early on, the drugs they gave, which was Azidothymidine, they gave in a high enough dose that it killed more people than the AIDS. I don't know if that's true or not, but I believe that. So I really learned, as far as being sick and that, the only time I had fear was when I went against what my intuition told me. I was always fine if I followed what I felt inside. M: That's interesting. That's always an interesting process, that kind of finding out, you know, how your intuition guides you and that type of stuff. Can you think of any very specific things that happened during that period of time, besides the doctors, where you realized the power of that intuition? L: Nothing I can really think of right off. That was really where my focus was at the time. To answer another part of your question though, it wasn't until I'd been HIV positive for ten years that I.I spent the first ten years of being HIV positive waiting to die. After ten years I kind of realized I just wasted ten years waiting to die. It was time to start living. M: It's something weird when you feel that, 'Oh really? There is life?' you know, kind of thing. L: Yeah it doesn't end. 5 M: I've noticed that with forgiveness, which you've talked about before, usually with that, in realizing that it is an illusion. Usually there's a point where you start to feel, not only intuition, but love flowing through you. When did you first start feeling that? L: You know, that really happened slowly over time. I'll tell you my biggest breakthroughs with that were when I'd come back to Utah. I'd gotten sober and I'd gotten really sick at the time. They'd actually come out to LA and brought me back to die. Never thought I'd live for a month because of the drugs and the alcohol. (I had got back into that.) I'd started going to Alcoholics Anonymous meetings and I watched people at these meetings and I saw people that seemed to genuinely care about other people and I didn't. I didn't care about anybody but myself, honestly. But I liked that and I wanted to be that way, so I started asking in my prayers to care more about other people. What happened was that I started to notice the newcomers in meetings come in. They'd be scared and they'd be hurting and then you'd only see them maybe once or twice and then you wouldn't see them again. It was actually Dawn, who came into a meeting as a newcomer and I still was so introverted and quiet I couldn't reach out to help even though it was really starting to pull on my heart. I tried to introduce myself to her and did the best I could. She came into a meeting one time and she really reached out for help and I couldn't do anything because I was so self-conscious about myself. She left and I didn't see her again for like three months. It was at that point that I just said to myself, I cannot, cannot allow my being unsure about myself get in the way anymore with helping 6 people. Almost instantly that being introverted and quiet, that I prayed to be taken away my entire life, was gone. My whole life opened up and changed because I first stopped worrying about me and my focus changed towards other people. That changed everything in my life. M: Wow. That's cool. Kind of brings me to the next one which was: what's the most beautiful thing you've experienced so far? What's the most beautiful experience you've had? L: I can't really think of one particular thing, but overall I would just simply have to say the love that I have for people is the most beautiful thing there is. It's the most important thing for me. M: That's the most important for everybody. L: What's that? M: I said it's the most important for everybody. L: Yeah. M: What do you experience, and I know you can't really put it into words. I know there's been several times when I've been with you and when other people have been with you where that experience of the body drops away. I know it can't be described, but can you try? What's it like? L: I've had a lot of that in almost two years, simply because again the body's not been put in place to be here. I don't know. I would describe it as a freedom of certainly not being tied down to the body or the restraints of the body or the pain of the body. In a way it's a relief. It's freedom. M: Do you go any place? 7 L: No, I know I do, but I don't really remember a lot of where I go. I've had a few instances. I had one instance, and this was a couple years ago, where I had gotten pneumonia and was in the hospital, really sick. I saw my mom and my sister who passed away and I also had the experience of people on the other side and the absolute joy and bliss of those who were there. The only way I can relate it is it's like little kids playing ring around the rosie, just happy and innocent and pure. Then I also got the feeling, that grand admiration they have for us who chose to come here and what we're doing. I really thought that, since not everyone had the courage to come here and so a great, just, admiration for what we do. At that same time I had the impression of standing in front of the Creator and Him asking me if I was ready to come home. M: But you decided to stick around for a little bit longer? L: I did. At the time I was not in a good place mentally and I didn't really give an answer. I didn't know. I guess I decided to stick around. M: I wanted to know your take on relationships, especially romantic and just what you learned from them--having relationships. I know you've been in love a couple of times, we've talked before. I kind of wanted to know since it's a thing that it seems like we're all concerned with all the time, at least some of us. What's your take on that kind of refrain from this other context? L: It's concerned me, not any different than anyone else. I long to be in a relationship, though I do understand, today, that is simply symbolic of my wanting to be home with my Creator. My relationship with Robert, when it ended, he basically came to me and told me he wanted out. It was a surprise to me. By that 8 point in my life I understood that it wasn't all about me, and I realized that even though he was the one that wanted out, after eighteen years, it was going to be just as hard for him as it was for me. So I put all of my effort into how I could help him transition out of this easily. I'll tell you, that made all the difference in the world. We are still best friends today. With me being sick, he calls me every day, he comes and sees me. We never had one single fight or argument in our breakup, not over anything. I mean the breakup was the truly beautiful thing. So, I guess what that taught me about relationships, and I believed this even before, is that relationships are the perfect place to work on our defects of character because they bring it right to the surface. The person we live with is the person that we're the most who we are, that we put up one of those fronts for. So that is the best place to fine tune who we want to be. M: I think I'll let Kathy ask you some of the other questions that are up on the board. I think she might be, she doesn't really look antsy, but she might be antsy to get to talk to you a little bit. K: Have I told you lately that I love you? L: Yes, you have. K: Okay. L: Have I told you, I love you? K: Yes, you have. A little bit louder. We're having a moment right now. Alright, there are a couple of things. When I ask you about this taping I'm sure there's some common statements that you could make to all four million people that want to come see you, and want to hear what you have to say, and they're hungry to 9 have that information and you know that that's true. So are there some common things that are coming up for you as you think about what you want to say today? L: Well, first, I want everyone to know that I am okay. I am perfectly at peace with what's going on for me today. You know I've already been telling some people some things to try to help them. One of them is, it's time to take responsibility for your own feelings and stop blaming other people for how you feel. One thing is, you guys are throwing this party for me, and as I'm thinking about people to invite, one problem I ran across is there are several people I'm going to invite who don't get along. So for a minute I had this conflict, do I invite both of them or not? I'm going to invite them and not worry about it, but the thing that is sad is that we carry those kinds of feelings about people and may not want to be in the same room with them. That's not what life is about, at all. I would just like to see everyone just love each other and get along. Take responsibility for yourself and then you won't hate anyone--you won't be angry at anyone. K: That's an interesting statement. Take responsibility for yourself. So you're suggesting then that I have some freedom of choice and some decision making about what it is I think I feel and the meaning I give to that. Is that what I hear you say? L: You have all of it. It is all up to you. K: So if I get my feelings hurt, it's because of a meaning I gave to somebody, is that what I'm hearing? L: Exactly. Exactly. 10 K: So in taking responsibility, what would that look like? Because you got a lot of folks here that are gonna hear that but they don't know how to do that. What would be the process that you found to be… L: You know, one thing is, I have worked with some people to help them through this process. One of them is first letting them understand perception, and usually I go to the internet, and I go to YouTube, and there's a piece that is on perception. You count people playing basketball, and with each team, how many times they pass the ball. In the middle of this they have a moon-walking bear that goes across the stage. Nobody sees that because they're counting the ball. And so as I point that out to them, it's that we see what we're looking for. It's our perception, and so with that in mind, we can never think that what we believe to be true is true. Our perception is very faulty. K: So, in a world this complex, people are confused. Some people are ornery, some people are selfish, some people are all of those things. We're all gonna run in to those things. What's your counsel? L: Again, what my experience is, what I find for me, as I approach that today in my life, is when I return it with love, it dissolves any conflict. I don't have conflicts with people and I even have been asked to come in as a mediator between two people who want to kill each other. I simply bring love into the situation and they end up giving each other a hug afterwards, because that's all it needs is love. I don't, it's funny, people purposely do not swear around me just because they, I don't know, they instinctively know that I don't swear. People don't gossip in front 11 of me and so simply by approaching my life with love that stuff disappears. Even if it is there, I don't see it. K: Yeah, because some of us actually do swear like sailors in front of you. L: I don't, I never, I don't even know. It's not my perception. K: Bringing it that way, when we're worried about…you know, in Christian Miracles, it says that fear of God is the most insane belief mankind ever created. And our Older Brother says that God does not see our weaknesses, our sins, or whatever. How would you relate that to your experience? L: Well, you know, I don't have to do as much anymore. For about a year, I practiced recognizing that when I come in contact with somebody the mind automatically starts to run down this list of judgments about that person. What I would do first is, I would watch how my mind worked when I was out in nature because it doesn't do that, it doesn't judge a tree, it doesn't judge a stream, other than seeing it as beautiful. I simply took the way I looked at nature and put that in the way I saw people. I cut out the judgment. Then you could see just the beauty that is there. K: So if I heard you right, what you're saying is, when I allow everything just to be what it is without my projecting on to it, then I get to see the beauty of what it can be or who they can be? Right? Is that what I'm hearing you say? L: Yep. K: That's kind of cool. One of the comments you made to me a long time ago, not too long after we first met, you talked about when we first met that there was a response in you that caused you to feel uncomfortable. We all have times where 12 we run into situations and people that we think are not where we are or living on a different level that we can't relate to, or all of those things, and so we tend to withdraw from that. What I heard you say earlier was talking about when I bring love to it. What happens when you bring love to it, no matter who you meet--who they are, where they are, what position in life they have, whatever. How do you experience that? L: I experience it--I think, the same thing back. Whatever I put out is what I get back. K: And it doesn't matter who it's with, right? So, what I thought I heard you say when you were talking to Matt was, it overcomes every objection, every block that I have about communing with someone else--regardless of whether they make me feel insecure or whether I wonder if I'm good enough or whether I wonder if they're good enough. L: Yep. K: So, just bring love to it? L: Yep. K: Thanks. L: See, I think the hardest part with that is we get so concerned with how we look, or how we appear, or people are going to judge us, that that's when we put up the walls. If I feel inferior to you then I'm going to find ways to make you look inferior. But if we let all that go, if we just approach it with love…I had to get to a point in my life where I just had to say, it doesn't matter how I look. It doesn't 13 matter how I appear in front of other people. That doesn't matter. What matters is how I treat other people and what I do to help other people. K: So it's kind of a new twist on the Popeye principle? L: What's the Popeye principle? K: "I am one of them." [quoting Popeye] L: "I am one of them." [quoting Popeye] K: And just bringing them up assuming that everyone else is Popeye too. L: Yep. K: Cool. I kind of like that. But we may call it the Lewis Popeye Principle. Okay, so, you have gone through almost all the kinds of experiences that most people would fear. I could never do that. That would be awful. How do you come back? There is a resiliency and an aspect of you that as you know, in the beginning, you undermined yourself and sabotaged yourself so you experienced some of those kinds of things. But then there was the comeback, and the comeback, and the comeback, and then dealing with having the courage to say goodbye to someone you really love, choosing to love yourself more. Those are some of the principles that I'd like you to talk about--where you found that courage, that resiliency to deal with things that most of us will never ever have to. L: Well, you know, at first I'd have to say, and I think this is true for all of us, that if we knew what we were going to experience ahead of time, we wouldn't be able to fathom being able to do it. But we simply take each day as it comes and one day at a time we can walk through it. It doesn't mean that we don't cry. It doesn't mean that we don't back away from life at times. I've certainly had times where I 14 just needed to isolate away because I just couldn't deal with what was going on. There have been times where I've been done with life. I've said this is enough. But overall, I think I love life. I'm grateful for every experience that I've had. Later on in life, going through hard times, I'm able to realize that early life, I'm grateful for those experiences, even though at the moment I may not see the positive in it. If I wait around long enough, I will. K: So taking it one day at a time, sometimes we don't see the big picture. There's always a big picture for us? L: Yes. That's the other thing--realizing that as bad as something may look, we're not seeing the whole picture. We're not getting it all. K: I like what you said but I still want to go back to this idea. When you were hitting those walls, being diagnosed with the death sentence at the time, and that's what everybody considered it at the time, having long term relationships end, those big, big things, what do you think the trigger was to go from being upset, or fearing or not wanting to do this anymore--those statements that go through your head. What was that trigger, do you think, for you? L: Part of it is the fact that I'm very, very stubborn. I'm never wrong. Those two things really play a huge part. It's like when I was homeless. I never saw being homeless as being a fault of mine. I was proud that I could take care of myself on the street. Today, I see how absurd that is, but with my ego and my stubbornness, I was able to block out any responsibility. I blamed my circumstances on the world and everyone in it and would be proud of myself for going through it. I don't know if that answers it. 15 K: Sure. Were there any moments in all of those experiences where you thought to yourself, there's got to be another way? L: Certainly. Yes. I think as a kid from as early as I can remember up to age twenty-two, I pleaded and cried, I literally cried, every night for God to change my world, for God to change me, to change who I was. It never happened. At twenty-two I gave up that my prayers were ever going to be answered. I always wanted something better, but it just didn't seem like anything better would be possible. Of course, it did all change. But again, it only changed when it became useful for me to help other people, like being introverted and quiet. That's when it made sense to plead with God to change, and it never did, but when I needed it to change so I could help other people, it happened almost automatically. K: Now would you say that part of that went from pleading and maybe you meant it and maybe you didn't, to in the moment with Dawn, when you were blowing it, to change? You were willing to deal with a better way to express yourself? L: Yes. K: So there's a little bit of willingness and I guess that happens when you're stubborn, willingness comes a little harder than when you're not. That willingness to accept what may be available to us. I spent some time…oh, I remember what I want to say. I want to ask you about your book. L: Okay. K: I want to ask you what made you decide to write a book? L: Well, I actually have three books I'm writing. One is a fiction, and one is a self-help book and then the autobiography. The autobiography is the last one that I 16 started, but probably is going to be the first one that I finish. The reason that I started writing that was, I wanted to give hope to people who maybe were in a place in their life where they think that things can't be better. I could say that this was what my life was like and this is how that changed. Basically it's a book about giving hope to other people. K: Nice. So tell me about your other two books. L: One is a fiction and it's a…the first part of it is based around a true thing that happened. It takes place up at the monastery in Huntsville. I was staying up there a couple days overnight. Just me, and I'd taken up two other guys with me. We were the only ones in the building except for this one man who was dressed all in black, very sunken in eyes, sunken in cheeks and not friendly at all. So we're sitting down in the library like eleven o'clock at night and we hear these footsteps. We stopped talking and the footsteps stopped. So we start talking again and the footsteps start. We stopped and the footsteps stopped. So that was kind of freaking us out. This guy dressed in black, we finally went in to the kitchen to get some coffee and he's standing in there, it's eleven o'clock at night, with the small kitchen light on, reading a book. So he was really freaking us out now. So that fiction book, that's kind of how it starts. It's about me being up at the monastery and running in to this man. It goes on to where this man ends up. What I do is I turn this book into a thing where the monks actually have more power. They're able to live five hundred years, six hundred years. They're able to walk on water, all that stuff. To keep away from persecution, that's how 17 monasteries were started, where they could be out and away. So it goes along those lines. K: Nice. I like it. L: Thanks. K: Will this be ready? L: I don't know. I have to finish the other one first, which I am working on, so. K: Alright, so tell me about the self-help book. I'm going to need that, you know. L: You know, it's funny, I started that long before I ever started going to the course. The chapters I have written go right along with the course. K: Interesting how that works, huh? L: It's really.one chapter is really about perception. It's really about, I've been blessed to be able to work with literally hundreds of people to overcome addiction and help them in their lives and that. So it's based on what I've learned in helping other people. It's about perception, how we see the world, taking responsibility for ourselves. I learned early on, first part of my life I was a victim, but as long as you're a victim, you give up all your rights and you give up all your power. You are a victim, but that's your choice. So it's a matter of simply choosing not to be a victim anymore. K: Now that victim word is a big word. L: Yes. K: What do you see in your life as the primary perpetrator of your victimizing. L: Me. K: Really? You think a lot of people would be surprised at that answer? 18 L: I'm sure they would. I used to say to, like with Dawn, I used to tell Dawn this when I was working with her. She's the one, the woman that I worked with. I would tell her that if you're angry, you're wrong and it would make her so mad. I met a lot of people that I would say that to, and they would just get very frustrated and mad. If you're angry, you're wrong. K: So, let's see. I get mad and that should tell me I'm wrong, because when I'm mad I'm really wrong. I could see that that was a problem. What did you do when they reacted to this? L: I just chuckle. I've certainly been there. I understand where they're coming from but it certainly left them thinking too, to try and figure out what I meant by that. K: You're an incredible example to so many. What simply is my job in this place? L: To forgive and love. K: Every day? L: Yes. The way I look at it is, we can learn as much as we want to learn. We can learn by studying the course. We can learn all of that. But if we can't forgive and love then it will never do us any good. We can have healing powers, all the intuition in the world, but if we can't forgive and love, it's meaningless. K: So, my job is to forgive. Who am I forgiving? L: Everything. K: Everything? L: Everything that you see as being wrong, or that upsets you, or that makes you angry. K: Okay, I can do that except for that one thing. 19 L: That's probably the most important thing you're working with. K: Okay, so there's no withholding, is there? L: No. K: When you started practicing that, see I find it pretty remarkable that an eighteen year relationship, a partner that I love and want to spend the rest of my life with, walks in the door and says I can't do this anymore. What triggered your paradigm, everything you expected to have happen, with that one change, changed everything. What was the trigger for you, the moment, the process that took you to a place of I am just going to love them? L: I think it started before that moment. Over the last eleven years, I had started to not just see my side of what's happening, but try to see the other person's side. To realize that in any story there's two sides. Two people are getting divorced, there's two very different sides. It's really a matter of okay, I know what my beliefs are, but what is the other person thinking? What is the other person going through? I started to learn that before the eighteen year relationship ended. That doesn't mean that I didn't have moments where I didn't feel some anger that you know, I was twenty-seven when I got into this relationship and now I'm forty-eight, and now because you want out, I'm alone, and I expected to be with someone the rest of my life. I did have some of that, but at the same time, I admired him for having the courage. Our relationship wasn't that good. We'd grown somewhat apart and I admired him for having the courage. I wouldn't, because I had made a commitment that I was in the relationship for life. I don't care how bad it would have gotten. I would have never 20 left it. So he did us both a favor. He had the courage to do that. I admire him because the first part of the relationship he never had that self-esteem. I walked all over him in that relationship and I hurt him really bad, and he would never have been able to say enough. For him to come to a place where he could say I don't want this anymore, good for him. Good for him, and that his self-esteem has grown that much. K: You hear me rail about nice people all the time. Part of nice people is that sometimes, what you're talking about, really is the most loving way to deal with that situation. A lot of people would have thought, just out of the blue, that's not nice. Nice would have been any variety of things that we go through in terms of inside out and over, to try to come up with a story to justify what we do. Tell me about your idea of what it is to be an authentic human being rather than a nice human being. L: I would tell you that I have been a nice human being, the kind you're talking about. I've done that. My nature is to be nice so that people will like me. I admit that. One of the things I learned a few years ago was, because I used to have such resentments against people and what I finally figured out was part of my resentment was simply because I felt like I was being forced to do things that I didn't want to. The fact was, I didn't have the courage to say no. Once I learned how to say no, then I didn't have resentments with people. If I don't want to do something, I just tell them 'no I don't want to.' That kind of helped me get away from being a nice person. I can be more honest with what I'm thinking. I've said no to people and they'd be like, "Well, why? Are you mad at me?" I'd say simply, 21 'no, I just don't want to. It doesn't have anything to do with whether I like you or not. I just don't want to do what you're asking me to do.' The other thing that I really tried to do later on in my life is to be as transparent as possible. I have no secrets. I would tell you anything at all that you want to know about me. I try to live that way so that what you see is what you get. If I do that, then again, it's not about getting people to like me. It's just the way I am. How can I help you? K: So Popeye had it right after all? Eat your vegetables and be honest. L: Yep. K: That's a good thing. Let's talk about this graduation thing. L: Okay. K: That's the ultimate fear for most people. Obviously a lot people do it with grace. There's a difference though in how I watched you. It's that you look it straight in the face. I find that courageous--to be able to look it straight in the face and ask your higher-self the truth about things. Would you tell us how that feels? I would like, you know me, I'm a big person about wanting to throw closet doors open and let's bring these subjects out into the light. Let's talk about that. L: You know, I have to tell you that early on, when I was diagnosed, I did have some periods of some real fear. I've had enough time to talk to my higher-self and the spirit, and to work all that out. I have such strong conviction that it doesn't end here, that there's more than just this. In some ways I'm actually excited to be experiencing what is coming up. The only downside to that is the people around me. I can see they're really struggling and hurting because of it. 22 K: I know you said what I want them to know is, "I'm okay." L: Yes. K: That's important. The honesty, if we're going to be genuine, the honesty about how we feel is, I'll speak for me because that's more true, 'what in the hell am I supposed to do without you?' L: I hear that. I hear that. My partner, Robert, just yesterday he was on the phone with me and he was crying. He still calls me for advice. He called me yesterday morning and he's been fighting with a mechanic who supposedly fixed his car for five hundred bucks and it didn't get fixed. He's been thinking of taking him to court and all this other stuff. He called me yesterday morning and said what should I do? I told him, I said you know, if it was me, I would let it go. I said it's just not worth the anxiety, the stress, and the anger that it brings you. And so he did. He agreed to do that. He had been holding on to a tool that they left in his truck as hostage or whatever. He said, "should I take that back?" I said yeah, that's what you should do is take that back. So he did all of that and yesterday he ended up, his four wheel drive that he needed to get fixed would have been six hundred dollars only cost eighty-five dollars, his truck passed inspection and a couple of other things. He called me up and he's like, "You can't leave. What am I going do without you? Who am I going to turn to for answers? Who's going help me? I'll be all alone if you leave." I hear that from my sister, and I hear that from Dawn and I hear that from other people. K: There's a whole bunch more around you thinking that, but they don't say it. What can you say to them? 23 L: I have a nephew and niece who were having a hard time also and I had my sister tell them to come over so that I could talk to them. Basically what I told them was why I'm okay. For them to experience this experience, be aware of it, and to find the joy in my life rather than the pain of me dying. I told them, 'I won't be gone. You just won't be able to see me. I'll still be around.' K: They may see you once they understand the end. L: Yes. That's true. My sister Lori, she says that she wanted a sign. What she wants is a triple rainbow. I said, 'couldn't you make it any easier?' K: Okay, that's fair enough. I may come up with one or two myself. I had a friend that we said when we get to the other side, call us and about six or eight hours after she passed, one of things we all discovered, at her service was, every single one of our cell phones went off from her number, all at about the same time. It's so true and she was so joyous about it. She came to see, before she'd actually absolutely left her body, she came in and plopped down on the couch and my granddaughter could see her and was looking at her. Her response to me was, "I am released. I am so happy." Then she said, "Don't be too long." You hook up with her. She is one party animal. L: What's her name? K: Jeannie. L: Jeannie. Okay, you've talked about her before. K: Yeah. I've already told her to meet you. L: Okay. 24 K: So, what are we supposed to do without you? I mean, let's deal with this. It's about me. L: Well, okay. What I would say is, I understand the loss and I understand the longing and the hurt, but that doesn't mean that everything in your life stops. It only stops if you decide it's going to stop. You still can go on. You still can…you know, Robert who goes, "What am I gonna do without you?" Well, you know what, you lived twenty-seven years before you ever met me and it was fine. It's been fine the last two years that we've been separated. K: So there will be some who use your moving on as an excuse to drink again, as an excuse to be depressed. What do you want them to know and how can they honor you? Because the truth is, sometimes we feel like our grief, and our pain, and our self-sabotage has to be, we measure it with how much we love you. Look in the camera and tell them how they can honor you. L: If you love me, you will remember me for who I am and you'll smile and you'll laugh and you'll have joy. You'll remember the funny times and the good times, if you love me. It's not about being sad. It's not about beating yourself up and thinking you have to live on daily with the pain. If you love me, you'll embrace life and joy. You'll take whatever lessons I may have been able to help you learn and you'll use them to be happy. K: When in doubt they can say "What would Lewis say?" Right? L: Yep. K: What would Lewis say and what does Lewis usually say when they're in doubt? L: I don't know. 25 K: You don't know? You don't say I love you if you do this? L: Oh yeah. K: Buck up. Take responsibility. L: Yeah. K: You know, that whole vato scene of yours, I find that can be a pretty good spiritual threat. The vato you will come kick their back sides. [vato is either a Mexican word for "dude" or "man" or Chicago slang for 'homie.' Vato is also the title of a song by Snoop Dogg] L: Yeah! Except that most of them know me and so that's not really a threat. That vato scene is only good on people who don't know me. I get that all the time. It's like, "When I first met you, I was really scared of you, but then I learned real fast that you were just a sweetheart." K: I think you can be a sweetheart and get very serious. L: Oh, if I'm serious, people usually cry. If I'm serious they know that something's wrong. K: You could say just because I'm not in the physical, doesn't mean that I won't know if you're lying to yourself? L: Yep. K: And it doesn't mean that I can't come and kick your proverbial, spiritual butt and you'll know it, if you don't remember who you are. L: Yeah. K: I think I just helped you create a threat. No, it's not a threat, it's a promise. L: Yeah. 26 K: Let's talk about…we talked a little bit about your niece and nephew and we've talked a little bit about your sister. Is there anything specific you want to say to other family members or to the people that have been family in the heart? L: As far as my family, the one thing that really sticks out is, in spite of the life I've had, I never ever felt judgment from them. All I ever felt was love. I never felt like they were shaking their head, judging me doing what I was doing, whether I was involved in drugs, or whatever. They were just always there to save me when I needed to be saved or help me. For a large part of my life I had no self-esteem. I think it was really their being able to see past whatever was going on and still love me that helped me to go through those things. K: I think it's natural to review and wonder, have regret that maybe I didn't do enough, I didn't love enough, I didn't help enough, whatever 'enoughs' I didn't do. What would you say to your loved ones who felt that? L: As far as for me, what I didn't do? K: No, no. When they're wondering. L: You know what, I cannot even express how blessed I am in my life for my family and all the other people that have been in my life. I truly believe that I have got to be one of the luckiest people in this world. K: I think you're right. L: I have it all. I truly am blessed. K: Yes, you are. I want to address your dad specifically because to a parent it feels unnatural to outlive your child. I don't care who you are as a parent or how old everybody is. There is this feeling that I should have protected or there's this 27 frustration that comes from what feels like an unnatural process. What do you want your dad to know? L: My father, he's already said to me, he's lost a daughter. I had a sister who committed suicide a few years back. He's already said to me several times, a parent is not supposed to outlast their kid, outlive their kids. When my sister passed away I remember looking at him. He went from being sixty-five years old to ninety-five years old, just how hard that was for him. I think even today there's a little bit of denial about what's going on. I can't know what he's going through. I'm not a parent. I don't know what that would be like. I do want him to know that I love him and the intent was that I was going to stay here in Utah to take care of him as he got older. It just hasn't worked that way. K: I have a feeling there may have been a contract between you. So let's talk a minute about how meaningful it's been to you to have your dad walk this process with you. L: Me and my dad, I've been back to Utah with my father for the last eleven years, and we have become best friends in that eleven years. We help each other. Neither one of us have a memory, but I can fill in his memory and he can fill in mine. So both of us together make up one person, kind of. We walk about the same speed. He's one of my best friends. I love him. I can't imagine him not being here for me at this time in my life. Even now he's always coming into the bedroom, "Do you need anything? Do you need anything?" All the time he's so concerned about can he do anything. Just knowing he's there is enough. K: There's something about having that kind of fatherly…you feel safer, don't you? 28 L: Yes. K: This process is about safer and free-er because he's been there. L: Yes. K: Well, I think I've about covered everything I wanted to ask. What about you? Is there anything more you want to add? Any messages you want to send? L: We've covered just about everything I can think of too. I'm getting ready to have a new experience. I don't want you guys to hurry to get there but I'll be excited when you do come. K: I'm excited for you. I'm jealous. Grand adventure. L: And again, for all the people that I love and care about, just love each other. There's nothing else that I would like to say. Just for the people that I love to love each other. K: And that would honor you? L: Yes. K: We'll do our best. But don't expect us to wait too long. L: To wait what? K: Here too long while you're off having a party without us. L: I'm sure you'll come when you're supposed to. K: Well, that's probably true. I love you. L: I love you too. I appreciate all the help that you've given me. K: Are you guys satisfied with that? Is there anything you wanted? Hey, I do want to ask you a couple of things. If when you're there, God says he needs a lift, tell me the funniest story that happened to you. 29 L: I'll tell you one of the funniest. Me and my family were in Puerto Vallarta and we were going to dinner at this restaurant in this old hotel. It was on the top floor. They just had one elevator that was really slow. I had to go to the bathroom really bad so by the time we get up to the restaurant I decided, well, I'm in front, but I decided that when the hostess takes us to the table, I'm just going to watch and vere off and go, because I needed to go. So that's what I did. I get up to the urinal, I turn around and the whole family is standing behind me. Lori is right behind me and she's like "What are we doing in the bathroom?" They all followed me! K: I think that's what everybody's worried about. We just kind of follow you wherever you go. L: I don't know what the hostess thought when she turned around and there's no one there! [laughter from everyone in the room] K: Oh, let's ask some other questions then. If you had to, they said, who was the most profound person you ever met or a meeting that you had with somebody that was maybe one of the most profound? Is there a situation that happened to you that was a total surprise that…? L: I don't know about a total surprise, but I did just recently in San Diego, I was able to meet Louise L. Hay who wrote that book, You Can Heal Your Life, and tell her personally what that book had meant to me. K: How did you feel about that? L: I felt good that I was able to let her know how her book impacted my life. It was that book that I really believe allowed me to live twenty-two years with AIDS. It 30 was that book that started to change the way I thought. I stopped seeing myself as a victim and realized that I was responsible for whatever was happening in my life. K: Which, then, you turned around and taught others. That book was like the rock on the pond that you slipped on the pond and fell over. L: Yep. K: Pretty remarkable. L: Yep. K: If there was one thing, and I know you've done a lot of work on this, and sometimes it's the silliest of things, but if there is one thing that you could go back in your life and change? L: I have the tendency to say that I wouldn't change anything but I guess the two things I would change are, the way I destroyed my first partner's life. The other, which he's totally aware of, but Robert, cheating on him and doing it so blatantly and openly right in front of him and hurting him. I would change that. K: So let's talk about that. Would you change it when you think about it because you regretted the impact that that had on them, or now does it expand into more than that? L: I'm not quite sure what you're asking, but let me tell you, my belief and what I've tried to do over that last eleven years. I spent the first thirty-eight years of my life going through this wreckage and damage. Eleven years ago I decided to try and clean up the damage that I'd done the best I could and start adding positive to it, so, in that sense, yeah. 31 K: I guess I was fishing. Let me try that again. I think there's a couple processes that we go through. I would have preferred not to have caused carnage for someone else and then it gets to that place where, I would have preferred to have projected myself better. L: Oh no, not the second one. It really was about, I wish I would not have hurt him. It's not important how that makes me look. The fact that I sit here and talk about it. I'm not ashamed of it. I certainly regret that I caused him hurt. K: There's going to be people who watch this that are not going to understand the difference between regret and shame. Right? L: Yes. K: Will you talk to me just a minute about how you distinguish the difference? L: Shame is seeing myself less than a person. Regret is simply not putting a judgment on who I am, but wishing the circumstances would have been better. K: How do you get to that place? For somebody who has all these things in their life that they're beating themselves up over? L: I absolutely hated who I was for the better part of my life. Absolutely hated and was ashamed of who I was and ashamed of these types of things. What I have learned is that guilt or shame serves no purpose. It has no positive aspect at all. It does nothing for the person to beat themselves up over something they've done. It only adds to. It's kind of like taking a bad situation and making it worse. K: So the whole idea of penance? L: I don't, for me or for anyone else, I believe that we do the best that we can with what we have. Good or bad. That's one of the reasons that it's easy to not judge 32 other people because we all are living our life the best we can with what we have. As far as that goes and everything that we do, I think our contracts are made ahead of time with people, even to hurt them. K: So the process then is when you realize that maybe I did the best I could and now I realize there was maybe a better way to do it. What's that process for you? L: It's a matter of being honest with yourself and not justifying it. To take responsibility for your life and your actions. Part of our life experience is to experience who we are, not to get to a place where we can know who we are or remember who we are. K: Well, we could go on forever but I think we'll end it there. The following is Dale Lewis Johnson's personal message about his party. I have been to a lot of funerals and memorial services in my life, and I always think how nice it would be to have had this when the person was still alive. It seems that the only time a person can get everybody that they care about all in one place at one time is after they have passed from this life. I know that most of that is to help them deal with their perceived loss, and that's okay. I feel truly blessed that I have had some notice that my time here in a physical body is drawing to a close, and what an honor it is for me to be able to participate in the mourning process of those that I love and that I know love me. The intent of my life, at least in the last eleven years, has been about helping others on their 33 journey through this life experience. It is a joy for me to know that I can do that up until the end. This party is not about saying goodbye as much as it is a celebration of the gift we have had of being a part of each others' lives. The time here is short for all of us, but has more meaning than we realize most of the time. It is about how our life affects every other life on the planet. I don't see death as an ending as much as I consider it to be a continuation of life without the limitations of this life. We become free of the limitations of the body. The body works great when it works, but when it doesn't, it can become one of our greatest limitations. The body is also one of the greatest contributors that helps us to see ourselves as separate from everyone else, and alone. It also takes almost all of our energy just to be okay in the way of needing money, a roof over our head, clothes, and friends, and we won't even go into how much time we spend trying to fulfill the body's need for intimacy. Laying down the physical body simply frees us from all of that. I do want you to understand though, that even with all of those limitations I have absolutely loved this life. It is because of this that I know that once we lay the body down, it will only continue to get better.

The Mercury February, 1894 ADVERTISEMENTS. Columbia f the World, graceful, light, and strong, this product of the oldest bicycle establishment in America still retains its place at the head. Always well up to the times or a little in advance, its well-deserved and ever increasing popularity is a source of , pride and gratification to its makers. To ride a bicycle and not to ride a Columbia is to fall short of the fullest enjoyment of a noble sport. Pope Mfg. Co,, Chicago, Hartford. A beautiful illustrated catalogue free at any Columbia agency, or mailed for two two-cent stamps. Barber Sfy°P> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK. yHUgrc at-jd ^rfc Corjs^VatoFy. Chartered 1850, offers Classic, Normal, Music and Art courses for Diploma and Degrees ; comprises three large brick buildings, situated on a beautiful eminence, a lovely campus, library, apparatus, hot and cold mountain water, steam heat, gas light, electric bells, a suite of rooms nicely furnished for every two or three students, music lessons on Pipe Organ, Reed Organ, Piano, Violin, Guitar, Mandolin, Banjo, and Cornet. Lessons in Drawing, Crayoning, Pastel, China and Oil Painting. German and French languages taught and spoken. Special attention paid to Elocution and Voice Culture. Normal course with Diploma for teaching. Strict attention given to Physical, Social, and Religious culture. Kee Mar College is located in a most attractive, refined, and healthful city of 14,000 people. SEND FOR CATALOGUE AND JOURNAL TO Rev. C. L. KEEDY, A. M., M. D., President, Hagerstown, Md. To thS St* Road Wagons.>« REPAIRING PROMPTLY DONE. ADVERTISEMENTS. Irving College, For LJoung Ladies. A Lutheran School for Lutheran girls. Chartered 1856. Confers degrees of A. B., and M. E. L. Experienced Fac-ulty. French and German spoken. Music—full conserva-tory course—piano, organ, pipe organ, violin, guitar, voice. Specialist in elocution and physical culture. Fine brick building, splendidly furnished, steam heat. Pupils carefully drilled sociably. Course high, thorough. Twenty minutes' ride from Harrisburg. Art a specialty. The only Lutheran school for girls in Pennsylvania. Synchronized time. Elec-tric bells. Send for catalogue. PROF. E. E. CAMPBELL, A. M., President, Mechanicsburg, Pa. F. WESEJR 3t eO. Drawing Materials and Drawing Instruments DRAWING PAPER, PENCILS, &C. A LARGE ASSORTMENT OF DRAWING MATERIALS OF ALL KINDS. J. WOODFIN MINIFIE, Manager, No. 5 NORTH CHARLES ST., BALTIMORE, MD. Special Attention to Orders toy Mail. Main Office, 1125 Chestnut St., Philadelphia. and fjferp'i, fapnii.hepi,, —•©©■— TRUNKS, LEATHER GOODS, AND VALTSES, 12 W. MARKET ST., YORK, PA. Special Attention to Mail Orders. H. S. Benner, Choice Family Groceries, Chambcrsburg St., Gettysburg, Pa. Coffees, Teas, Flour, Fish, and Canned Goods. Qucensware, Glassware, Etc. PITZES HOUSE. A temperance house. Pleasant and home-like. Teams and Guides to all points of interest on the battle-field. REASONABLE RATES. 127 Chambersbupg St., Gettysburg, Pa. JOHN E. PITZER, MEMBER POST 9, G. A. R. J. W, EIGHOLTZ & GO., DEALERS IN Pmflos, o^GATis, jvnJsic, JVLtiSICALi iriSTr^TjJVIEriTS, ST^I^GS, Ete. 12 BALTIMORE ST, GETTYSBURG, PA. SAflflUELt FABET3, -*§fine CigaPs & Smokers' Articles-^ CHAMBERSBURG ST., GETTYSBURG. J. H. MYERS, Fashionable Tailor1, Clothier —AND [{en^' Furni^hei1. You alcaays find the Liatest Styles for Gents' LUardrobes. No. ii BALTIMORE STREET, GETTYSBURG, PA- ADVERTISEMENTS. in College pti3e8 Society Babges lftrt3e flfeebals Stationery The most successful designers of College and University Badges in the Country Estimates Designs oft Hpplieatioft BAILEY BANKS BIDDLE Chestnut and Twelfth Streets "Philadelphia, Pa. /tlary had a Little Lamb, (Stamp jour Memory.) It's wool was all the go— W« make it up in BUSINESS SUITS for SI 5.00 you know. These Custom-Haiit Suits are pdptilar throughout America— because they represent the very Quintessence ol Nobby Dress, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, stating kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Balti more cheapest market. KEELER the largest custom producer. Full Dress Suits, ■ J25.00 Up. Trousers, . $4.00 Up. Frock Suits, ■ . 118.00 Up Overcoats, . $18.00 Up. JOriN M. KEELER, 5 N. Calvert St. Baltimore, Jld, "Suffer no longer the extortions of locM tailors.-' Correspondence Solicited With Responsible Parties Desiring to Act as Agents. THUTH WEflftS ]10 PSK Because it needs none. It bows at no human shrine, seeks neither place nor applause; it only asks a hearing, and so, too, do we. Our immense Fall and Winter stock is full of rare and choice bargains. Stylish Men's Suits and Overcoats at $IO, $12, $15, $20. We'll buy them back if you don't like them. Sole agents for Youman Silk and Derby Hats. Oehm's Acme Hall, CLOTHIERS, HATTERS, FURNISHERS, BALTO AND CHARLES STS., Baltimore, Md. WILLIAM SMALL, DIM DOOR IIMER AND DOOR Dinra, 6 WEST MARKET STREET, YORK, PENNA. IV ADVERTISEMENTS. • • F. D. SCH^IVER, Draper, Importer, • • A#D Merchant Tailor, 23 Baltimore Street, GETTYSBURG, PH. The College Mercury. Vol. I. Gettysburg, Pa., February, 1894. No. lO. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STARK. Editor : FRED H. BLOOMHARDT, '94. Associate Editors ; FRANK E. FICKINGER/94. HERBERT A. ALLISON, '94- HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL W. KOLLER, '94. ROSCOE C. WRIGHT, '95. WILMER A. HARTMAN, '95. Alumtii Association Editor : REV. D. FRANK GARLAND, A. M., Baltimore, Md. Business Manager: BENJAMIN R. LANTZ, '94. Assista?it Business Manager ; CHARLES F. KLOSS, '94. TERMS f One volume (ten months), . . . . $1.00 I Single copies, 15 Payable in Advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. eOTNTENTS. MERCURY'S VISIT, - 155 EDITORIALS, 156 SWEDISH BETROTHALS AND WEDDINGS, 158 THE LATIN HORSE AND HIS RIDER, 160 DISCONTENT, ' 161 "IN MEMORIAM"—REV. A. C. STUP, 162 COLLEGE LOCALS 163 ALUMNI, 167 FRATERNITY NOTES 169 ATHLETICS, ' 170 TOWN AND SEMINARY 171 LITERARY SOCIETIES, 172 MERCURY'S VISIT. He came in the month of St. Valentine, But surely one were stupid To dream that he of the sparkling eyne Was the little blind god, Cupid ! The pinion that Cupid's shoulder wore— On his jaunty cap he bound it; No quiver and bow, but a rod, he bore, With serpents twined around it. He came in the merry month of thaws, When all the world was muddy ; And the only spot that he found to pause Was the tower of our Hall of Study. Weary he paused, for his winged feet No farther his weight could carry; And the invitation sounded sweet That bade him come down and tarry. For Mercury loves the prank and jest Of the hour of recreation; He had left Olympus for change and rest— For he, too, likes vacation. Nor less does he, the herald of peace, Find joy in the time of quiet When the study-hour brings hushed surcease Of the day-time rush and riot. But " Phrena. " and " Philo." crown his glee, And he walks their floors elate; For dear to the heart of Mercury Is the Friday night debate! He joys in the clear, keen argument, Scorning excuse or evasion ; He whom the gods with their messages sent Is still the Lord of Persuasion. And his cheery presence with us here Has shortened so many an hour, That we cannot think it has been a year Since first he lit on our tower. He never talks of going away, For he knows how that would grieve us; And may it be many a long, long day Ere MERCURY wishes to leave us! .M. R. H.,'94. 156 THE COLLEGE MERCURY. EDITO-RIAL. ""THE first volume of THE COLLEGE MERCURY is completed. The book, as far as it lies in the power of the Editors to change it, is closed forever. Nor would we want to change it. True, it is not perfect; errors have been made, but childhood is not the period of per-fection. We would let the words live just as they were penned by those who have gone out from their Alma Mater, and to whose untiring energy and zeal, THE MERCURY owes its origin and much of its success. To say that THE MERCURY has surpassed even the most san-guine hopes of its founders is but a feeble ex-pression. Not many thought that it would live more than a few months; but here it stands, strong and invigorated by its year's growth. During the past year— " Up and down throughout the land Our MERCURY did go, College chat and college news To scatter high and low. " Up and down, 'twixt smile and sigh, Our MERCURY did go, College toil and college fun Faithfully to show." Difficulties and troubles have been encoun-tered and overcome, and the future lies just ahead, without a dark cloud to veil its out-look. So promising does this future appear; that it invites us to conjecture how THE MERCURY will appear at the end of the second volume. In the first place, we hope to see it enlarged. With this enlargement will come new departments and increased space to old ones. A department should be added which will be devoted entirely to reviewing books and pamphlets. In this way the Literary Societies would be greatly benefited, and those who do not have time to read all the articles, would know at once what is worthy of their attention. But what we want to see most of all is a semi-monthly publication. Colleges no larger than our own publish their journals every two weeks. Of course, it is not expedient to make this change at once, but if THE MERCURY receives the support it should have, it can be published bi-weekly before a great while. * * * TT was not with a feeling of triumph that we received the news that the Gettysburg Col-lege Monthly would be published no longer; but it rather awakened a hope that now our college could publish a journal such as she deserves to have. The Monthly has been published for seventeen years, and Dr. Bikle deserves the thanks of all for the labor which he has expended on it. But the time had come, we believe, when our Literary Societies should publish the college paper. They undertook this work, and THE MERCURY is the result of the undertaking. It should have the support of eveiy friend of the institution, and it is especially desired that those who have been taking the Monthly will transfer their names to our subscription list, and thus be kept in touch with the college news. What better time will there be to subscribe than now, at the beginning of the second volume ? Let us, Alumni, undergraduates, and friends, lay aside what little differences of opinion we may have held, join hands on this, THE MERCURY'S first birthday, forget the past, and in the future use all our influence to place THE MERCURY in its proper position among college papers. * * TT hardly seems possible that any one who *■ heard the concert given by our Musical Clubs could do anything which would detract from their success. Yet the Seminary Faculty has deemed it proper to prohibit their students from going on the trips. As a result the clubs lose four of their most valuable men, whose places cannot be filled at presejit. These clubs are one of the best advertise-ments for the college, and the college is the greatest feeder of the Seminary. While me THE COLLEGE MERCURY. iS7 Faculty have acted, doubtless, as they thought best, it is certainly a decision which is very difficult for young men to fathom. pvISPARAGING CRITICISMS.—The habit of making disparaging remarks about one's college and its efficiency is a habit that ought to be frowned down speedily. Strangers sometimes hear remarks which leave a totally wrong impression of the insti-tution under consideration. It is partially thoughtless—it is partially for appearance' sake, but whatever the cause, it is utterly wrong and hurtful. A child who would be guilty of holding his parents up to a critical survey is unworthy. And so a child of the college who indulges in such disparaging criticisms in the presence of outsiders who are not in a position to judge the matter, is like-wise untrue to his Alma Mater's best interests. He cannot hope to right wrongs by such a method—he should not forget that he may do great harm, and turn away from her classic halls sons who might have been an honor to her. Why not speak well of the college, as we are taught to do of persons, always pre-senting the strong side, and, if there are weak places, attempt by the use of proper means to strengthen these? Our college may make mistakes. Certainly. But it will not correct the wrong to advertise it among strangers and hold it up to the critical gaze of those who have no sympathy with the college. Our college is moving rapidly to the fro'nt rank— why not loyally and enthusiastically give it our support and " God-speed ?" G. A DVERTISE the College—and why not? ^ Printers' ink is seldom wasted in good, pointed advertisement. We have learned to appreciate its value in church work. And educational work is not so different but that continued and judicious advertisement will add. wonderfully to the, strength of the insti-tution. We think foot-ball and base-ball splendid media of advertisement, so long as the boys continue as they have been, gen-tlemanly in their deportment. Press notices, we think, might be utilized more frequently than they have been. Several times we have looked over the " Press " for our college, but have seen nothing of it, while other smaller colleges had a respectable list of " little nothings" concerning Jones, '95, and Smith, '96, and Brown, '97. Press notices are better than a set advertisement always. People read the news, always,—sometimes, if they want a new bonnet or suit of clothes they will glance over the advertisements. Boys, keep the college and your athletics before the people. You will be less likely to complain of lack of interest in that athletic field which is now the great desideratum. Let the people know, let all the people know that there is a splendid college at Gettysburg, a college that stands for something, that is doing something, that has a history, and that has a future. Adver-tise the college. G. * * * '"THE recent execution in Gettysburg has *■ again brought forward the question, Should capital punishment be abolished ? Laws inflicting a penalty of death have been almost universal. Of course, this is no argu-ment in its favor, although it throws the burden of proof on its opponents. If a government has no right to take a murderer's life, capital punishment is nothing else than murder by the state. So far as the Bible is taken into the argument, it is easily shown that government has this right, for capital punishment prevailed under often-repeated Divine sanction. Of all the rights which a government should have that one must be pre-eminent which gives to it, its right to do what is neces-sary for its own maintenance. The question, therefore, is whether there is a more effective way of preventing crime than by the execu-tion of those who have committed the deeds for which the laws inflict death. The ob-ject sought by punishment under human 158 THE COLLEGE MERCURY. government is to prevent the repetition of the crime. It is argued that the taking of human life, even by the hand of Justice, diminishes its sacredness, and thus leads indirectly to murder. This argument holds only against public executions, when the crowding of streets by men, women, and children give it a holiday appearance; when the words of the dying man and the awful experiences of his last moments on earth are printed in large type in every paper in the country. That the inflic-tion of capital punishment, with all the solemnity which is due to it, would diminish the sacredness of human life, seems but a groundless assertion. The alternative must be life imprisonment, for there has never been a milder penalty ad-vocated for murder in the first degree. Will life imprisonment act as a sufficient deterrent ? It carries with it the possibility of pardon or escape, and is something from which many of the criminal classes do not shrink. Again it may be an incentive to further murder. A man may be convicted and sentenced for life. He murders his keepers or fellow-convicts in an attempt to escape. He fails, but he is just where he was before, imprisoned for life. If capital punishment would be abolished and life imprisonment would be the severest pen-alty, what would hinder the hardened mur-derer from killing two or three more people in order to destroy witnesses of his crime ? On the other hand, few men die while serv-ing a life sentence. The memory of the mur-der is forgotten, and sympathy takes the place of judgment. Some one may become inter-ested in his case who has influence in politics, and pardon seldom fails to follow soon after. The most common objection to capital pun-ishment is the possibility of mistake. People say that the government takes what it cannot restore in case of an error. But this possibility did not abolish the death penalty under the Divine administration. False imprisonment, too, takes away what cannot be restored. The time spent in prison is lost. If capital punish-ment cannot be removed for any other reason, it ought not for this, for in our enlightened age, men will rarely be sentenced to death where the evidence does not convict him be-yond a doubt. The penalty for premeditated murder should be more certain, speedy, and private than at present, and it should be DEATH. SWEDISH BETROTHALS AND WEDDINGS. '"THE young ladies of Sweden are guarded much more closely than those of America, or of England. They never attend any party or place of amusement unless a chaperon accompanies them, and never receive a gentleman at home except in the presence of father or mother, or some older married relative or friend. The Swedish youth, on matrimony inclined, must often wait for months before an oppor-tunity occurs to whisper a word to his fair one alone. At last, at some watering place, or on the skating-rink, or in the stormy whirl of the waltz, the long-coveted moment arrives, and he asks the fateful question. Surely, if any one is brave enough to " pop the question " in the midst of the galloping waltz, he deserves the fair. And, if she be willing, and the parents as well, the young pair are at once betrothed in a much more public manner than with us. The youth gives the maid a plain gold ring, marked on the inside with his name and the date of the engagement. He places the ring on the third finger of the left hand; and, at the same moment, she slips a similar ring upon his finger. The engagement is then published in the newspapers, under its appro-priate heading, in the same column with births, marriages, and deaths; and cards, on which are simply engraved the two names, are sent to all the friends, who, in turn, send congratulations, frequently by telegram. Then the parents of the maid give a large THE COLLEGE MERCURY. 159 party in honor of the happy event, and the two young folks are fairly, squarely, and firmly engaged, so firmly that—to the honor of Sweden, let it be said—an engagement is rarely broken off among them. The engaged couple often appear out together ; if walking, always arm in arm, and, if strolling along with friends, the others often make haste to hurry by and walk in advance, saying with a smile: " The betrothed always come last." Acquaintances nod significantly to each other as the pair pass by, and whisper: " Nu aro de ute och profga "—" Now they are out on a trial trip." Before the wedding, the bans are proclaimed by the priest in the parish church for three Sundays. These lysning Sundays are regarded as in some measure preliminary wedding days. Should an engagement be broken after the bans have been published, it is regarded much the same as a divorce. Now the swain presents his sweetheart with some handsome ornament—the lysning's present—and on each of these three Sundays the young pair hold a reception for hours at the house of the bride. They stand up to-gether and receive their friends. Wedding presents are sent and displayed, and bouquets and telegrams of congratulations are show-ered upon them. When the wedding day comes around, if it should rain, so much the better; the young couple will be sure to be rich. " Det regnar guld i brud krnonan," cry all the guests. " It rains gold in the bride's crown." At a fashionable wedding in a city church, the altar and the choir are decorated with choice flowers and adorned with luxuriant tropical plants. The invited guests, frequently num-bering several hundred, appear in full evening toilet. The organ strikes up a wedding march, and the bridal procession enters through the main portal and passes up the nave. First comes the bride, led by her father, and followed by a long retinue of bridesmaids and groomsmen. The groom enters from the sacristy, accompanied by his best man. Meet-ing the bridal procession in the choir, the groom receives his bride from her father and passes on with her to the altar, while the bridesmaids and groomsmen form in a line behind them across the church. The bride is clad in white, with a long white veil; on her head, she wears a crown of myrtle and orange blossoms, and she carries a bouquet of the same in her hand. The bouquet is sur-rounded with lace and from it hang two broad, white ribbons on which are stamped, in letters of gold, the maiden's name and the date of her wedding. The marriage ceremony, according to the ritual of the Swedish Church, is an imposing one. The ring of plain gold plays an import-ant part in the ceremony. It is inscribed on the inside with the initials of both bride and groom, and between them figures giving the day, month, and year of the wedding. The minister, holding the ring aloft, invokes the blessing of God upon the union, of which it is the symbol, in an affecting prayer. Then the bride and groom hold up the golden circlet together—the groom with his right hand, and the bride with her left hand—and the groom says to his bride : " I take thee now to be my wedded wife, to love thee in need and joy, and, as a token, give I thee this ring." And the bride replies : " I take thee now to be my wedded man, to love thee in need and joy, and, as a token, receive I this ring." The groom now slips the ring on the same finger where before he had placed the ring of his betrothal. And these two plain gold bands, placed side by side, the Swedish wife wears as long as she lives, and no one will take them off her finger when she lies cold and stiff in death; they are buried with her. This is a modern wedding in the cities. If you wish to see a real old-fashioned Swedish wedding, you must leave the town and go out among the peasants. Sometimes, while driving along a country road in the i6o THE COLLEGE MERCURY. south of Sweden, you may come upon a bridal procession on its way home from the ceremony at the church. First comes an escort of young men, all mounted on richly caparisoned horses, like a squad of cavalry, and all with flowers in their hats and bosoms. Among them ride the spelman (the musicians) with ^hautboys, clarionets, and fiddles, vigor-ously playing a rustic wedding-march. The bride and groom, according to ancient cus-toms, are also mounted on horses smartly decorated with* leaves and flowers. They ride side by side, the bride with the crown upon her head. Then follows a long cortege of wedding guests on horses, or riding in car-riages or wagons. Many in the calvacade carry guns, and shots are frequently fired along the route. In fact, the whole pro-cession wears a military air, and easily recalls the old, unruly times when an armed force was often necessary to prevent the bride from being seized and carried off by some hostile clan. Arriving at the home of the bride, the pro-cession marches under a triumphal arch of green boughs, and the young men ride three times furiously around a May Pole raised in the middle of the doorway of the yard, amid the cracking of whips and firing of guns. Then come the feasting and dancing. These are much more than a wedding-breakfast and a city ball, I can assure you. " Brollopet star i dagar tre," is the old saying; and for three days and three nights, without inter-ruption, the happy company feast and sing and dance, and dance and feast and sing, till the old farm-house shakes with the lively steps of the revelers, and the welkin rings with their merry shouts. And the lusty Swedes are not always content with three days of dancing. A pretty custom, still observed in the country districts is "att dansa kronan af bruden " (dancing the crown off the bride). During the wedding festivities, the bride is blindfolded and placed in the middle of the room; the music strikes up, and the brides-maids, joining hands, dance in a ring around the bride until she takes off her crown and places it hap-hazard on the head of one of her maids. And this lucky girl will surely be the first of all the throng to wear a crown of her own at her own wedding. No Swedish maid will be married without wearing a crown. This is generally made of myrtle, but in some provinces it is of gold or silver-gilt. She wears the crown for a few short hours only, it is true, but, for that little space of time, the blue-eyed, sunny-haired daughter of the Northland is queen. Old Swedish chronicles speak of the bride waiting to receive her groom " with honor's crown upon her head and virtue's pearls about her neck." A peasant-girl among the emigrants who were traveling in the cars to the Swedish coast to take a steamer for America was met by a friend of W. Thomas, American Minister to Sweden at that time. As her dearest treas-ure, she carried a little myrtle plant in a flower-pot. "For, you know," said the girl naively, " I may meet some good man in the New World who will marry me, and then I must have some myrtle from my native land for my bridal crown." E. B. THE LATIN HORSE AND HIS RIDER. A COLLEGE INCIDENT. Of Sheridan's ride and of Paul Revere, If you haven't heard '.t, is something queer. Of this hero of mine, ne'er a line has been penned, But perhaps 'tis because of his tragical end. But stop, Mr. Reed! that hero of thine Couldn't ride half so well as this hero of mine. The name of my hero, you want me to tell ? Ask one of the boys: they know him quite well. 'Twas half past two by the college clock, When he mounted his steed of the finest stock. The time was summer, and warm the day And class time half an hour away. So he tightened the reins, gave the word to his horse, And started to ride through his troublesome course. And the thoughts of the class-room, the Prof., and a zip, Floated over his mind as he plied on the whip. m: THE COLLEGE MERCURY. 161 The lesson was Latin and hard and long; But skillful the rider, the horse fleet and strong, And, nostrils wide open and tail straight out, The horse galloped on in hollows and out. At a quarter till three, when the time-was half gone, He was riding so fast he could hardly keep on; For long was the lesson and short the time And some of the hills were hard to climb. At straight three o'clock to the class-room he dashed, The horse covered with foam and with mud besplashed. A few minutes after, when called to recite, He dashed through the reading with vigor and might, But now comes the strangest part of my story That robbed our hero of much of his glory; For the horse that thus far had o'ercome all obstruction, Threw off the brave rider when he came to construction. Ii. A. A., '94. DISCONTENT. OHAKESPEARE always represented men ^ and women as he had seen them. His men were real men, and his women, real women. He never ignored the old law of human nature. For these reasons we may-learn many profitable lessons from his charac-ters if we study them aright. Critics have often speculated as to the poet's moral purpose in writing this or that play. It is, however, difficult to tell whether he had a moral purpose in view or whether he wrote simply for dramatic effect. Be this as it may, the result is the same to us. His works are works of art and therefore natural, and as such they necessarily carry with them useful lessons for such as are willing to learn. Take the characters of Orlando and Melan-choly Jaques in "As You Like It." Both these persons possess restless and discon-tented natures; yet how different they are. Orlando is dissatisfied with the condition that prevents a full and manly development and does all in his power to throw off this re-straint. Jaques is dissatisfied with everything in general but has no higher ambition than to rail and find fault. Orlando possesses a noble discontent; Jaques, ignoble. Orlando seeks the source of his discontent and betters his condition. Jaques does no more than gratify his curious whim of continually grumb-ling- Orlando first shows his discontent by re-senting his brother's unjust oppression in these words: " My brother Jaques he keeps at school, and report speaks goldenly of his profit; for my part, he keeps me rustically at home, or, to speak more properly, stays me here at home unkept: . . . the spirit of my father, which I think is within me, begins to mutiny against this servitude; I will no longer endure it, . . ." He next manifests his ambition by accepting the challenge of Charles the wrest-ler, whom he soon throws, contrary to his brother Oliver's wishes. Orlando is greatly praised for this and also receives a chain from Rosalind. These successes so arouse Oliver's enmity that he determined to get him out of the way. Adam warns Orlando of his danger, and both seek their safety in the forest. Here his noble spirit is again manifested ; first by his kindness and devotion to aged Adam ; and next by saving his brother from a cruel death and promoting his happiness in other ways. Thus he repays his brother's cruelty with kindness. Melancholy Jaques manifests his surliness from the beginning to the end. It is especially seen in the manner in which he requests Ami to sing for him. After making sport of the song he closes with this expression : " I'll go to sleep if I can; if I cannot, I'll rail against all the first-born of Egypt." He next expresses his desire for the office of a Fool that he may rail unchecked at the world, as is shown by these words : ." Oh ! that I were a fool! I am ambitious for a motley coat. . I must have liberty Withal, as large a charter as the wind, To blow on whom I please ; for so fools have." Jaques next tells us what he thinks of life in the passage beginning, "All the world's a l62 THE COLLEGE MERCURY. stage." . . . This is, no doubt, the best evi-dence we have of the low estimate he put upon life and the deplorable state of his own mind. His conversation with Orlando in the second scene of the third act is another evidence of his feeling toward his fellow-man. His desire is to be alone. His fellow-beings are not good enough for him. The world seems all wrong to him, as we may infer from these lines: " Will you sit down with me ? and we two will rail against our mistress, the world, and all our misery." The difference in these two characters is thus very evident. Orlando turns his glance backward upon himself and seeing his own imperfections declares: " I will chide no heathen in the world but myself; against whom I know most faults." He at once does his best to correct these faults instead of com-plaining and making them known to the world. Jaques is entirely different in this respect. Instead of seeing his faults in himself and cor-recting them, he sees them reflected in the world about him, and his desire to cure the world of these faults is expressed in such words as these: . . . give me leave To speak my mind, and I will through and through Cleanse the foul body of the infected world, If they will patiently receive my medicine." The world is to him, as it were, a large mir-ror in which he sees his own character re-flected. It is not difficult to tell which one may be the happier and more useful. We can see examples of a similar nature almost every-where. Some persons are found doing all they can for themselves and not forgetting to aid their companions when possible. Others are all the time dissatisfied and finding fault in their fellows, when, if they would view things rightly, they might correct these faults, as they very often lie within the fault-finders them-selves, IN MEMORIAM. REV. A. C. STUP. \17HEN death lays his icy hand upon the hoary locks of age, we humbly bow our heads, realizing that the ripened fruit must fall. But when the young man, just standing upon the threshold of life, and full of ambition and enthusiasm for his chosen life-work falls, a withered blossom, then we fail to understand God's ways, and can only trustingly submit to the workings of His mysterious providence. Rev. A. C. Stup was in his final year of pre-paration for the work of the ministry. For more than six years he had been engaged in that preparation, and it was now nearly com-plete. He had just received his license to preach, and with all the hope of a young man was looking forward to a life of activity in the service of the Church, when God called him from his work to his reward. Adam Cornelius Stup was born in February, 1866, in Frederick County, Maryland. His father was a farmer, and Adam spent much of his earlier life upon the farm. This, however, was not the life that he desired, for he knew the need of active workers in the vineyard of the Master, and he was ready and anxious to give his life to that great work. So after spending several years at the Frederick Academy, he entered Pennsylvania College as a Freshman in the fall of 1887. There he worked faithfully and well. Diligently he devoted himself to study, improving every opportunity, and in June, 1891, graduated with first honors, delivering the Latin Saluta-tory of his class at Commencement. The following fall he entered the theological seminary, displaying there the same diligence that had characterized his work in college, and as a student, as well as a Christian gentleman, won the esteem and good-will of both his pro-fessors and fellow-students. In June of '93, he successfully completed the second year of his THE COLLEGE MERCURY. 163 seminary course, and having been appointed by the Board of Home Missions to take charge of the mission at that place, went to Riverside, California. There he spent the summer in hard mission work, and before returning East organized a church. In the autumn of '93 he applied for licensure at the hands of the Mary-land Synod, and on October 5th received the license he coveted. He was then in poor health, and preached but once afterward. On Tuesday, January 9th, word came to Gettys-burg that he had passed away. He was buried in Mount Olivet Cemetery, near Frederick, five of his classmates following the coffin to the grave, there to pay their last tribute of love and respect to their departed comrade. Mr. Stup was a young man of more than ordinary talents, and by diligent study he had improved the gifts which God had given him. As a friend, he was held in high esteem by those who knew him in that sacred relation. As a Christian, he was possessed of a deep piety and an earnest desire to serve the Saviour, whom he loved. Those who knew him pre-dicted for him a brilliant and useful career, but God, who doeth all things well, called him home. He will be missed by professors, class-mates, friends, and all who knew him. G. A. G. COLLEGE LOCALS. HERISERT A. ALLISON and HENRY E. CLARE, Editors. Winter term opened January 4th. Boys were slow about returning. The common motto, " Better late than never." True; but where is Fassold? "I have married a wife, and therefore cannot come. Pray have me excused." Two new men have been received this term—Mr. Bennett, from F. and M., who en-tered the Sophomore Class, and Mr. Yeiser, from Selin's Grove, who is taking a special course. It is quite probable that the Kee Mar Col-lege Musical Clubs will give an entertainment in Brua Chapel in the near future for the benefit of the foot-ball team. Mr. Orville L. Sigafoos, who entered our Senior Class last fall from Lafayette, and who was recently elected Associate Editor on THE MERCURY staff, has returned to that institution and will graduate with his class there in June. He has been elected Class Poet for their class-day exercises. Mr. Kump, '95, is doing a double business. In connection with his college work he is managing a drug store in Hanover for a few weeks. Mr. B., '94, inquires in Sanitary Science if dead dogs, cats, horses, etc., come under the list of infected articles ? Mr. M.,'95, our Hartwick man, says he thinks " Julius Shakespeare" would make a good subject for an essay. Stephenson, who entered the Sophomore Class last fall from Wittenberg, has returned to that institution and will complete his course there. Dr. Robert Homer wishes, through the columns of THE MERCURY, to thank the students who rendered assistance during the fire. The rendering of the Latin play "Terence's Andria " by the members of the Senior Class, who elected Latin, has been given up on ac-count of the necessary absence on the evening of February 22d, the time set for rendering it, of some of the members who belong to the musical clubs. Dr. McKnight, who was instructed by the Board of Trustees to continue his collecting for the payment of the interest on the college debt, says he is " greatly encouraged " by his success thus far. He has already collected over two-thirds of the amount necessary. He spent nearly a week in Philadelphia, leaving Gettysburg, Friday, January 12th, and return-ing Friday, January 19th. He preached for Dr. Baum, Sunday, January 14th. Rev. Main is continuing his instructions to his class in oratory. In the future, THE MERCURY will be printed by the Star and Sentinel Publishing Company, 164 THE COLLEGE MERCURY. of Gettysburg, and thus much of the time wasted in sending matter and proof to and from Philadelphia will be saved, and the latest news can always be given. Mr. Hess, of the Seminary, favored us with an exceptionally good entertainment in Brua Chapel January 13th. The programme was a well-selected one, and was carried out in an artistic manner by the performer. Mr. Hess as an impersonator is very good. Pro-fessor Neff, in speaking of the gentleman, said: " In some respects I have never seen his superior." He certainly made a favorable impression on the large audience that had gathered to hear him. Mr. Hess intends organizing a class in oratory in the near future. Dr. McKnight preached in St. Matthew's Lutheran Church, Baltimore, Sunday, Jan-uary 21 st. During the absence of Dr. McKnight, Dr. Richard of the Seminary has been taking his place in the class room. Mr. K., '94 (translating Greek)—" Read me, I pray you, these decrees—" (hesitating). Dr. B. (giving the literal)—" that escaped." Mr. K. (repeating)—" that were skipped." Dr. B. says that Socrates told his pupils to use their grammars and lexicons more, and not trust solely to divination in making their translations. Dr. McK.— "To understand more thor-oughly what thought is, we will turn from the abstract to a concrete and well-known ex-ample. I will call upon Mr. Apple to give it. Mr. Apple, tell us what you know about an apple." Mr. A.—" In the first place, an apple is something (?) as distinguished from nothing. Then there are red apples and—" Dr. McK.—"That's right, at least the lat-ter part." We have" learned from good (?) authority, since our last number went to press, that one of our number nearly met with a fatal catas-trophe. Twenty Pullman cars, going at the rate of sixty miles an hour, are said to have passed over him, without injuring him at all. We cannot account for this miraculous escape, unless it was for the same reason that the flames of the fiery furnace did not harm the Hebrew boys—because they wouldn't tell a lie. A lady describes Mr. W., '97, as "a young man with black hair and a black mustache." She is evidently a close observer. Wild West stories will no doubt be floating about in the course of a few days. Mr. E., '96, has lost his scalp, and this will, very likely, be accounted for in his own inimitable way. " Pearlie" says he is collecting a library. His collections thus far have been mainly works on etiquette and the classic series of Arthur Hinds & Co., complete. Who was " The wild boy discovered in the woods of Hanover," referred to by Dr. Paley? Dr. McK. says Dr. Paley did not know Mr. K.; '94. Six subjects have been assigned to mem-bers of the Senior Class for theses in Astron-omy, as follows: (1) What kind of reasoning do we use in Astronomy? Miss Himes. (2) To what degree of accuracy do we work in Astronomy ? Mr. Nicklas. (3) Has the study of Astronomy a broad-ening effect ? Mr. Ibach. (4) Have we enough data to justify us in our conclusions? Mr. Allison. (5) The practical benefits the world has received from Astronomy. Mr. Miller. (6) The educational value of Astronomy. Mr. Hopper. These theses are to be read before the class near the close of the term. Mr. M., '94—" Professor, is there such a thing as an interstate board of pardons ?" Prof. H.—" No ! Why ?" Mr. M.—"I was just thinking that it would be a good idea." Prof. H.—" Why, what would be the ob-ject ?" Mr. M.—" It would prevent favoritism." Quite an original idea. Mr. F., '95, says he is tired of the English elective studies. "They are too simple for Juniors, and belong to public schools." Well, well, who would have thought that they were simple for Mr. F. ? He says : " I wish I had elected mathematics." He got through re-quired mathematics with ease (E's), and rashly supposed he could do the same in the electives. THE COLLEGE MERCURY. 165 We have noticed that Mr. C, '96, has been sick the last few Monday mornings. Sunday evening prayer-meetings, etc., don't seem to agree with the gentleman's health. He is evidently a spiritual dyspeptic. Mr. S., '97, has been duly initiated into his new quarters on third floor, according to the ancient college rites. The participants in the ceremonials had the tables severely turned on themselves by being locked in the room, es-caping only after midnight. Several are said to have succumbed to the influence of smoke and lack of oxygen. Application for charter has been made by the " New Improved Order of Red Men." The charter members will be Messrs. H., '94; A., '95; H., '95 ; W., '95 ; H., '95 ; H., '95 ; A., '97, and T,'98. Mr. W., '95, was heard remarking the other day : " It is an outrage Dr. B. has given us an author this term for which a commentary can't be found." The following is a translation by Dr. B. from one of his favorite Greek authors: " Beauty is but skin deep, Ugly's to the bone. Beauty soon vanishes, But ugly holds its own." The absence of Mr. C, '95, from his club for several meals caused one of the members to inquire what he lived on. Mr. H., '95—" He is living on love at present." Mr. K. (Sem.)—" That's delicious food. Wouldn't mind trying it myself." Mr. E., '95—" Yes, but it's dear." Dr. N. (to Mr. M., '96)—" Mr. M., you may multiply these figures." Mr. M.—" Doctor, I have no paper." Dr. N.—" Well, you use your mouth too much in everything else, now use it here." Dr. R. to Mr. A., '95—" Now, Mr. A., in generalization, we note what ?" " Don't know?" "Similarity!" "For example: I take four animals, a horse, a cow, a sheep, and a dog, how do we generalize?" Mr. A. pauses. Dr. R.—" Well, what do we note that is common to all of them ? What do they stand on for instance ?" Mr. A.—" Why, on the table." Dr. B. says there are different kinds of parlor matches. For the one kind he can give the formula but the other has not yet been resolved into its elements. But, Dr. M. says, that from his latest experiments, he has found the latter to be composed of four parts of felicity and six of ecstasy. He has also learned, he says, that the latter is more dan-gerous to handle. Coming in contact with paternity it sometimes precipitates; the felicity and ecstasy being soluble in paternity, only the indissoluble wretchedness and despair is left of the original solution, desperation being formed. Reactions: No. 1. Felicity + Ecstasy= Bliss-|-Rapture. No. 2. Felicity + Ecstasy -\- Paternity = Wretchedness+Despair+Desperation. The Musical Clubs gave concerts at Hagers-town and Chambersburg January 25th and 26th. Large houses heard them at each place. Mr. D.,'96, after making up an " exam.," to Dr. B. (pleadingly)—" Doctor, don't you think you could give me an ' A ' once ?" Prof. H. to Mr. K., '95—" Who were some of the most noted preachers of early New England ?" Mr. K.—" Dorchester and "—(class roars). Prof. H.—" Well, then, what important building was always found in a New England settlement, besides the church ?" Mr. K—" The Commons !" Prof. H.—" That will do." Mr. B., of the Mid. Class " Sem.," is a man of much foresight. Undoubtedly thinking Latin, Greek, mathematics, and the various studies of a " co-ed's " course in college inade-quate for the training of a practical wife, has lent his lady friend a valuable and instructive book for her careful perusal, entitled, " Six Hundred Dollars a Year" or. "A Wife's Efforts At Low Living Under High Prices." Dr. R. to Mr. L, '95—" Is this book I hold in my hand ephemeral ?" Mr. L—" Yes, sir." Dr. R.—" I mean is it permanent or not ?" Mr. L. (guessing again)—" Yes, sir." Mr. C, of the Mid. Class " Sem.," rendered some valuable aid in saving property of the Eagle Hotel during the late fire; but he IHBKMKE 166 THE COLLEGE MERCURY. should never throw china-ware from a third-story window upon the pavement. Invariably it will not survive the shock. Prof. H. to Mr. M., '96—" What was the Randolph faction called?" Mr. M.—" Squibs." Mr. B., '95, translates " Da steh ich nun, ich armer Thor:" " Here I stand, a poor fool.'' Dr. M. reproves the class for laughing, but afterward explains that he can see why the class laughed, " because of the personal appli-cation which could easily be made." Y. M. C. A. NOTES. Reports of officers and some of the com-mittees of Y. M. C. A. were given at the busi-ness meeting held on January nth. These were encouraging in the main, and showed that work has been faithfully pursued in the various lines taken up. There still seems to be, however, a lack of interest and exertion in the cause of missions. We are expected to contribute our proportionate amount for the support of the Students' Missionary in India, with whom we are acquainted through his letters, and we should also keep promi-nently before us the objects and claims of the Student Volunteer movement. That our young men might become better informed and more interested in this work, arrangements were made for a visit from Mr. B. B. Ware, of Buck-nell, who is himself a volunteer to the foreign field, and who addressed us on Sunday morn-ing, January 21st, graphically showing forth the nature and extent of this movement, which is commended to the prayerful consideration of all Christian young men. • A mission band has been recently organized among the students, under the auspices of the Y. M. C. A. At their recent meeting, very interesting and well-written papers on mission work were presented and discussed by the members. All those interested in mission work are free to attend the meetings of the band. The last Sunday in January, appointed as a day of special prayer for colleges, will be ob-served by us, and it is hoped that all the stu-dents will be present at the, meeting in the chapel. The looked-for opening of the Y. M. C. A. course, by the New York Ideal Concert Company, took place Friday, January 19th, before one of the largest audiences ever as-sembled in Brua Chapel. The harp was always a favorite instrument here, but, under ■ Mr. Mecklen's delicate touch, it became more so than ever. His daughter, Miss Bessie Mecklen, played the saxophone to perfection. Miss Friderici's recitals won encore after encore, and were among the best ever given in Gettysburg. Miss Bowen has a sweet voice, and her whistling was greatly enjoyed by all. The next number will be a lecture by Rev. Russell H. Conwell, one of America's most brilliant orators. His subject will be, " Hero-ism of a Private Life; or, Romance of Real Life." On February 9th, Mr. J. Williams Macy will give an entertainment, the third of the Y. M. C. A. course. GENERAL COLLEGE NEWS. Of the 3,000 students enrolled at the Uni-versity of Berlin, 800 are American.— Yale Daily. Dartmouth has a new athletic field which cost $20,000.— The Miami Student. No college in all England publishes a col-lege paper. This is another illustration of the superior energy of America. About 200 col-leges publish periodical journals.—Ex. Sympathizing Subscribers Should Send Sub-stantial Succor.—Business Manager, Exchange. One-sixteenth of America's college stu-dents are studying for the ministry.—Buclmell Mirror. A new prize has been offered to the mem-bers of the Senior Class of Harvard, which is intended to be an encouragement for men to prepare themselves for journalism.—772^ Free Lance. Leland Stanford University has an endow-ment of $25,000,000, and the Ohio State Uni-versity an endowment of $21,665,000. Harvard has 3,150 students, the University of Michigan 2,800, the University of Pennsyl-vania 2,205, Yale 1,969, and Cornell 1,700. Twelve hours per week is all that is required at Harvard. Students are discouraged by the Faculty from taking more.—Ex. THE COLLEGE MERCURY. 167 At the University of Wisconsin a rank of 85 per cent, in daily or term work exempts a student from examinations.—The Bates Student. Student self-government will be tried at Cornell for a year. It is said that Governor Pattison will prob-ably succeed to the Presidency of Lehigh University. 1 Came to college, Joined the 'leven, Played in one game, Went to Heaven."- -Ex. In a dim and shadowy parlor I knelt last night at her feet. I asked her the old, old question, A question old, but sweet. But ah, alas, she refused me, But I asked her again once more, 'Twas still a negative answer, The same as she gave before. Then I said, " Oh! thank you, darling, Now please just name the day." She said : " I have twice refused you, Will you please to go away ?"' But I said, " Two negative answers To my question you now give, And, please, do not two negatives Make an affirmative ?" —The Lafayette. ALUM/SI. FRANK E. FICKINGER, Editor. '41. Seven weeks ago Rev. Dr. Henry Baker was stricken with paralysis. His con-dition is now regarded as critical, and his family is gathered at his bedside, in his home at Altoona, Pa. It is the opinion of his phy-sicians that he is gradually passing away. '51. Rev. H. M. Brewer, of Carthage, 111., has been elected president of the Eighth Dis-trict Illinois Sunday-School Association. He has been one of the officials of the American Bible Society for a number of years. '57. Dr. Baugher spent part of his Christ-mas holidays visiting friends in York. '57. Drs. H. L. Baugher, '57 ; E. J. Wolf, '63; P. M. Bikle, '67, and J. W. Richards, '68, are members of the Historical Academy of the Lutheran Church, recently founded in Balti-more by Dr. J. G. Morris. '63. The definitions of ecclesiastical terms referring to the Lutheran Church in the Standard Dictonary, published by Funk & Wagnalls, of New York, have all been pre-pared under the supervision of Rev. E. J. Wolf, D. D., of the Theological Seminary. '65. Rev. Dr. T. C. Billheimer preached in York, Sunday, January 14th. '65. Rev. J. A. Clutz, D. D., President of Midland College, of Atchison, Kansas, has been sick with the grippe. '65. Rev. Z. H. Gable, of Reading, Pa., represented the Lutherans at the recent dedi-cation of St. John's Union Church, Gibraltar, Pa. The congregation was organized in 1805. '65. Rev. M. J. Boyer, of Aitch, Pa., will dedicate his new church on Sunday, February 4th. The sermon on the occasion, as well as the soliciting of funds, will be in the hands of Rev. H. H. Weber, General Secretary of Church Extension. The church is a neat and pretty one. '67. Rev. Chas. S. Albert, D. D., of Phila-delphia, Pa., preaches occasionally for his old congregation in Baltimore, Md. On Sunday, January 14th, he administered the Commun-ion. '67. Rev. Dr. Parson, of Washington, D. C, has just recovered from a two weeks' attack of la grippe. Dr. Kuhns and Hamma sup-plied his pulpit. He is greatly interested in the establishment of the National Lutheran Home for the aged. '70. Rev. J. S. Moser is succeeding finely in building up the mission at Riverside, Cali-fornia. '72. Rev. F. W. E. Peschau, D. D., lectured recently at Irwin, Pa., for the Swedish Lu-therans on " Gustavus Adolphus." On Christ-mas a handsome and costly gold watch was presented to him, as a token of esteem, by his congregation at Greensburg, Pa. '73. Rev. E. H. Leisenring, pastor of the First Church, Chambersburg, Pa., has been quite ill with grippe. Rev. A. Essick oc-cupied his pulpit on Sunday, December 31st. The same day Mr. J. B. Markwood, '91, of Gettysburg Seminary, filled the pulpit of Trinity, the pastor being down with the same malady. 168 THE COLLEGE MERCURY. '73. Rev. Dr. Freas' congregation, of St. Paul's English Lutheran Church, York, Pa., recently gave substantial proof of their appre-ciation of his services by increasing his salary by ,$200, making it now $2,000 per annum. 'jTj. The Christian Endeavor of Johnstown, Pa., was addressed by Rev. J. F. Hartman on the 26th. '73. At a congregational meeting of St. John's Lutheran Church, held December 23d, suitable resolutions were passed upon the resignation of their pastor, Rev. T. J. Yost. For almost eight years this congregation has been faithfully served by Rev. Yost. He has accepted a call to Montoursville, Pa., whither he has gone. '74. Rev. Charles M. Stock, of Hanover, Pa., has been reappointed one of the Grand Chaplains of the Pennsylvania Grand Lodge of Masons. '75. Rev. M. L. Beard, of Middletown, Md., recently entertained the council of his church at a dinner in the parsonage. '76. Rev. J. C. Jacoby, of Newton, la., is preaching a series of sermons on " Prototypes of Christ in Bible History." These sermons are attracting large audiences and awakening a special interest. 'yy. Rev. Charles S. Trump has issued a 16-page edition of The Martinsburg Lutheran as a special Christmas number. '78. The mother of George J. Benner, Esq., died at her home in Gettysburg, on the morn-ing of January 16th. '78. Rev. Albert Bell preached his inaugu-ral sermons before full houses at St. Luke's, York, Pa., on Sunday, January 7th, 1894. '8o. Rev. J. B. Fox, of Newberry, S. C, has issued a parish paper called The Newberry Lutheran. It is a small neat four-page paper, and is to be conducted in the interests of the congregation. t '80. Rev. C. W. Heisler, of Denver, Col., is delivering, on alternate Sabbath evenings, a series of special sermons on the Holy Bible. '80. Rev. M. P. Hocker's church, at Steel-ton, Pa., is rapidly nearing completion, although the work was somewhat halted by the hard times prevailing in that usually busy city. When completed it will undoubtedly be one of the finest church edifices in central Penn-sylvania. '80. Rev. M. F. Troxell, of Springfield, 111., preached recently on "The Laborer and the Capitalist." '82. Prof. H. G. Buehler, of the Hotchkiss School, Lakeville, Conn., spent the holidays at Gettysburg. He is said to be delighted with his position, but would feel more at home if he could sometimes enjoy Lutheran services. '83. Rev. Andrew S. Fichthorne, who was unanimously elected pastor of the Fourth Lu-theran Church, Altoona, Pa., as successor of Rev. D. R. Barry, has declined the call. '83. The Baltimore Telegraph Company is-sued a large and beautiful Christmas number of their paper. Among the Christmas ser-mons, they published a full column of a sermon by Rev. L. M. Zimmerman, pastor of Christ's Lutheran Church, on " Christ in the Home." '84. Rev. H. J. Hapeman, of Dakota City, Neb., publishes a parish paper called The Cliarger. '84. Rev. A. F. Richardson, of .Grafton, W. Va., rejoices in having a church free from debt. '86. Prof. Franklin Menzes, Ph. D., of the college, recently addressed a convention of Adams County farmers, at Arendtsville, Pa., on the subject of'Agricultural Chemistry." '86. Rev. W. E. Main is meeting with much favor in his work of voice culture at the vari-ous colleges. A flattering offer has been made him by Wittenberg College, and we under-stand that he will soon begin classes among the students at Springfield and in neighboring cities of Ohio. '86. The Salisbury (Pa.) Star has high words of praise for Rev. W. W. Kribbs, the popular Lutheran minister, who has recently resigned his pastorate there. During his stay in Salis-bury, Rev. Kribbs greatly endeared himself to the people of the congregation and town, and it is with much regret that they see him leave. He will spend the winter at his home in Clar-ion County. '89. Rev. A. M. Heilman's Church at Freys-ville, Pa., struck by lightning lately, was dam-aged only to the extent of $50 and was fully insured. THE COLLEGE MERCURY. 169 '89. Rev. D. S. Hoover, of Lutherville, Md., has been on a month's vacation, granted him by his people, owing to bad health. '90. Rev. Wm. J. Bucher, of Kellersburg, Pa., was the recipient of a handsome revolving book-case, presented to him by his congrega-tion at the close of evening services January 14th. '90. Rev. M. F. Good, of Lyons, Pa., has a stretch of 24 miles between different points in his charge. '90. The work at Troy Hill, under the care of Rev. S. T. Nicholas, is growing with won-derful rapidity. '90. Rev. N. E. Yeiser, the Young People's Missionary to India, recently passed a credit-able examination in the Telugu studies pre-scribed for the first year, and from reports is doing a grand good work in that far-off land. '91. Rob't N. Hartman, of Baltimore, Md., was awarded, at the opening of the year, by the Board of Studies of Johns Hopkins Uni-versity, a scholarship in Chemistry—equiva-lent to $200. Mr. Hartman entered the Uni-versity immediately after his graduation here, and has been doing most excellent work there. Frank H. Clutz, a son of Dr. Clutz, '69, Pres-ident of Midland College, received a like scholarship in Astronomy. We congratulate the gentlemen. '93. At the recent session of the Somerset County Teachers' Institute, Mr. V. R. Sailor delivered an address on the subject, " What Constitutes Preparation for Teaching," and Mr. J. J. Brallier on "The Study of the Classics." Both the gentlemen are principals of schools in that county. '94. W. I. Redcay is at present a student in the Sophomore Class of Missionary Institute, Selinsgrove. During the past two years he has been teaching. F-RATEKNITy NOTES. PAUL W. KOLLER, Editor. PHI KAPPA PSI. Bro. Frank E. Beltzhoover, '97, was initiated into the fraternity Saturday evening, January 13th. Bro. Lewis W. Smith, '93, has recently en-tered the office of a prominent law firm in Peoria, 111., as a student. The fraternity has just published a book of purely Phi Psi songs. Bro. Robert Lowry is editor, and many of the. tunes are original compositions of this noted musical writer. The fraternity boarding club has been moved to Mrs. Tate's, on Carlisle Street. PHI GAMMA DELTA. Bros. D. Edgar Rice, '96, and H. R. Smith, '97, were initiated on the evening of January 6th. Bro. Wm. Aukerman, '97, visited Bro. Fite in Pittsburgh during Christmas vacation. Bro. Fickinger also spent a few days with Bro. Shaar, in Steelton. Bro. C. S. Albert, D. D., of Baltimore, at-tended the meeting of the Seminary Building Committee held in town recently. Bro. Al-bert's article, in the Augsburg Lessons, on "Why am I a Lutheran," and which was originally written for the Chautauquan, is a clear and concise statement of the beliefs of the Lutheran Church. We advise all to read it. The photographs which have been solicited from the Alumni brothers have not all been received. We request those who have over-looked this matter to let us hear from them as soon as convenient. Bros. Herr, '97, and Albert, of the Semi-nary, will participate in the gymnasium exhi-bition to be given in February. The chapter is in receipt of a handsome copy of the " History of the Third Division, Ninth Corps," Army of the Potomac, pre-sented by Col. Geo. W. Frederick, of Phila-delphia, an alumnus of the chapter, and of the college, Class of '63. Col. Fredericks first enlisted in the famous " Emergency Regi-ment " while at college, was afterward pro-moted for gallantry to the colonelcy of the 209th Pennsylvania Volunteers, and has a re-cord for bravery all through the war, to which we are proud to point. > SIGMA CHI. On the evening of January 1 ith, Theta Chapter was given a course-dinner at the 170 THE COLLEGE MERCURY. Eagle Hotel, through the kindness of Bro. Heindel, '96. Toasts were responded to by all the members, Bro. Hersh, '91, acting as toast-master. Bro. Allen Sangree, now in the Senior Class at Franklin and Marshall, has been elected first orator by one of the literary societies for the annual contest. He has also been chosen presentation orator for Class-day exercises in June. John Reed Scott, '89, has been elected counsel to the County Commissioners of Adams. A similar honor was bestowed upon Bro. Garnet Gehr, '91, by the Commissioners of Franklin County. Bro. Bixler, '98, will participate in the com-ing athletic exhibition. Bro. Monath, '97, accompanied the Musical Clubs on their tour to Hagerstown and Cham-bersburg, and entertained Bros. Hersh and Heindel at his home. ATHLETICS. WILMER A. HARTMAN, Editor. ""THE INVINCIBLES," an organization A of Gettysburg College athletes, will give an exhibition in the gymnasium on Fri-day evening, February 16th, at 8 o'clock. The admission fee will be 25 cents, and the pro-ceeds will be used to pay the debt of the Athletic Association. Every person is invited, and a good seat and a fine entertainment is guaranteed to all who come. The exhibition will be in charge of Physical Director Auker-man. The programme will be as follows: PART I. Music College Glee Club. Work on Horizontal Bar, Aukerman, Wiest, Bixler, Herr, and Bennett. Club Swinging, Albert and Billheimer. High and Broad Jumping, Bixler, Bennett,, Albert, Smyser, McCartney, and Rudisill. Fencing (Broad Swords), . . . Meisenhelder and Wiest. Work on Parallel Bars, Wiest, Rudisill, Bastain, Bennett, Billheimer, McCartney, and Aukerman. PART II. Music, College Orchestra. Rope Climbing, etc M. L. Smyser. Rings Bennett, Billheimer, Rudisill, and Herr. Boxing, Roller and Aukerman. High Kicking, Albert, Rudisill, Bixler, Carty, Bennett, and McCartney. Mat Work, Wiest, Carty, Meisenhelder, Herr, McCartney, Rudisill, Roller, Billheimer, Kicklas, Bastain, Albert, Bennett, Bixler, and Aukerman. Wrestling, Aukerman and Bennett. The attention of college men, in general, is turned toward base-ball. It is but two months until the season opens. Thus far the candi-dates for our team have done nothing in the way of training. It should be kept in mind that the winning team is not always the one that " springs a lot of phenoms " all at once, but it is the team which has trained hard and faithfully during the long winter months that carries the laurels from the field. The lack of a suitable place for practice may be a hindrance, but there is no reason whatever, why each man, who wants a place on the team, should not make daily use of the gymnasium. A new system of class drills will be in-augurated shortly by Dr. Stahley. The stu-dents will be divided into three classes. The first class will contain those who show the highest efficiency and the greatest degree of attention. The third class will be com-posed of those who are not able to stand the harder work, either on account of constitu-tional inability or the lack of previous proper training. But as the members of the second and third classes show development, they will be placed in the next higher grade. At a meeting of the Athletic Association January 13th, Mr. W. A. Kump/95, was elected foot-ball manager for next season. This is an excellent choice, and foot-ball interests will be properly attended to by him. He was half-back on the eleven, until injured at Emmittsburg, when his parents withdrew their consent to his playing. The Athletic Association has tendered a vote of thanks to Messrs. Buehler and Gerhart, for their efficient services in coaching our foot-ball team. Yale has re-elected Captain Hinkey, and Princeton has honored Trenchard in a similar THE COLLEGE MERCURY. 171 manner. The one will try " to retrieve his fallen fortune," while the other will endeavor to maintain the supremacy which his team gained during the past season. Harvard is certainly in a serious condition as regards- base-ball. None of last year's team are there, not even a man for captain, hence substitutes must form the nucleus for this year's team. It seems strange that intelligent men can compare foot-ball with prize fighting. Perhaps after the events of the past week these men, who seem to know a great deal about the latter, will hunt a more appropriate simile. TOWN AND SEMI/N7VRy. ROSCOE C. WRIGHT, Editor. SEMINARY. WILHELM SAUFT, of Stargardt, in Pom-meru, Prussia, has entered the Semi-nary. He will pursue a special course of study in order to become perfectly familiar with the English language. It is reported that J. C. Grimes, who mys-teriously disappeared from the Seminary several months ago, has enlisted in the U. S. Army for three years. He recently returned to his home, in New Cumberland, in uni-form. The foundation of the new building is rapidly nearing completion. As soon as the weather permits work on the building will be pushed forward as rapidly as possible. The Building Committee, consisting of Drs. Valentine and Charles Albert, and Messrs. Edward Scull, P. H. Glatfelter, and H. C. Picking, met recently in Gettysburg. It was decided to have the steam plant in a separate building, as the Seminary building can be heated more advantageously in this manner than with the plant connected with one of the other buildings. A tank is to be built in the old building for a water supply for the Sem-inary buildings. Rev. A. A. King has received a call to Glen Gardner, N. J. Mr. Shantz, of the middle class, organized a class in Botany. has Dr. T. C. Billheimer preached in York January 14th. Mr. W. S. Oberholtzer has not yet returned to the Seminary. On Sunday, January 21st, Rev. R. B. Wolf preached at New Oxford, and Rev. John M. Axe at McSherrystown. Robert Patterson, of China Grove, N. C, has returned and resumed work with the Senior Class. TOWN. Mrs. S. B. Wolf, wife of our missionary at Guntur, India, delivered an address, January 15th, in Bethlehem Tabernacle, Harrisburg, on " Woman's Work for Women in India." The Week of Prayer was observed by the different churches. Union services were held in the St. James Lutheran and Presbyterian churches. Rev. J. R. Hutchinson, pastor of the U. B. Church, recently assisted at the dedication of the new U. B. Church at Carlisle. Hon. David Wills gave a dinner to the members of the Bar, on Thursday evening, January 18th, in commemoration of the fortieth anniversary of his admission to the Bar. S. McSwope, Esq., was the toast-master of the occasion. J. A. Kitzmiller responded to the toast, "The Law Students of Mr. Wills;" Judge McClean, " The Judiciary;" " Our Bar," David McConaughy; " Reminiscences," by J. C. Neely; " Women as Attorneys," William McSherry, Jr.; " Our Bachelors," J. L. Hill; " The Ladies," C. S. Duncan. The Eagle Hotel and adjacent barns were burned Friday morning, January 12th. A strong wind was blowing at the time, and for some.time it looked as if the northern part of the town would be destroyed. Fire companies were brought on special train's from Hanover and Hagerstown. The origin of the fire is unknown. The loss is estimated at about $25,000; insurance about $17,000. Henry Heist was executed, Wednesday, January 17th. The crime for which he was hanged was the murder of Emanuel Moun, in February, 1893. He was tried at the August ■ 172 THE COLLEGE MERCURY. session of court, and found guilty September 2d. Governor Pattison fixed the 14th of December for the execution, but on De-cember 8th a reprieve was given until January 17th. The cadets of the State College have been trying to make arrangements with the National Guard to come here next summer. A branch of the Baltimore Building and Loan Association has been organized in this place, with Mr. C. S. Duncan, President. Several additional arc lights have been put up in town. General Snowden, Adjutant-General Green-land, and Colonel C. T. O'Neil, of the Harris-burg Arsenal, were here the 16th to select a suitable site for the National Guard Encamp-ment next summer. They decided upon the same place they occupied when here in 1884— the ground over which Pickett made his famous charge. General Wm. H. Forney, a member of the Gettysbury Battlefield Commission, died at his home in Alabama, January 16th. LITETtfVRy SOCIETIES. WALDO D. MAYNARD, Editor. THE societies have entered upon another 1 term's work. It, however, seems rather unfortunate that the literary societies should be made to suffer on account of various inter-ruptions. Last term there were compara-tively few regular meetings, and the prospects for this term are not much better. This term should be made one of great interest and profit, but not much advantage can be gained from four or five meetings during the term. These intermissions tend to develop indiffer-ence to society work. It is true that our reg-ular college duties require a great part of our time and energy, but still we ought to be able to find time to attend to the literary so-cieties. Many colleges throughout the West are busily engaged, preparing for their respective State oratorical contests, We again say to those who have not yet become members of the societies, join at once. We would call the attention of every mem-ber of Philo. and Phrena. to the fact that THE MERCURY needs your assistance; you can greatly aid it by presenting its claims to your friends and acquaintances, and also by con-tributing to its literary department. Remem-ber that the success of THE MERCURY depends upon your efforts as well as upon those of the editorial staff. Some of your contributions may be rejected, but nevertheless it will be an excellent training for you, as you will no doubt put forth your best efforts. Some of our exchanges complain of lack of interest in the college journal on the part of the student body, and are consequently forced to submit to many annoyances before they are able to get out each edition. This matter can only be remedied by the awakening of greater enthusiasm among the students. And as THE MERCURY is conducted by the two societies, there is a great re-sponsibility resting upon each individual member to perform his part, so as to make our journal as interesting and attractive as possible. PHILO. NOTES. Philo. has elected the following officers for the ensuing term: President, Seebach, '94; Vice-President, Newcomer, '95; Recording Secretary, Rice, '96; Corresponding Secre-tary, Erb, '95 ; Treasurer, Apple, '95 ; As-sistant Librarian, Mohn, '95; Critic, Van Camp, '94. Messrs. Buck, Friday, and Smith were in-itiated at the beginning of the term. Allison, '94, has been elected"to THE MER-CURY staff, to succeed Sigafoos, '94, resigned. PHENA. NOTES. The society has elected the following offi-cers : President, Stahl, '94; Vice-President, Maynard, '95 ; Recording Secretary, Duck, '97; Critics, Bell,'95; Brandt, '94, and Lantz, '94; Assistant Librarian, Ott, '97; Monitor, Bikle, '97; Chaplain, Bell, 95. The society expects to have the work of re-cataloguing the Library finished in a short time, ADVERTISEMENTS. Wanamaker's. What makes Wanamaker's so dis-tinctively Wanamaker's is the spirit that actuates the merchandising—all the time striving to serve our customers better and better, shortening the road from producer to consumer and saving to patrons every possible penny of cost. How well we have done it is a matter of history, how well we shall do is what concerns us. The look is always ahead. Every part of the store shows points of unusual interest. Sporting Goods. Things for wear. Things for home helping. And there are lower-than-ever prices on many of them. JOHN WANAMAKER. SEND FOR CATALOGUE OF - FOR - NEXA.^1 BALTIMORE, MD. This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Session, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M., Principal, LUTHERVILLE, MD. PROFESSIONAL CARDS. CHR^IiHS S. OU^Cflfi, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltimore Street, GETTYSBURG, PA. CHflS. E. STAJlkE, '87, 1 ATTORNEY-AT-LAW, Baltimore Street, GETTYSBURG, PA. DR. CHAS. B. STOUFFER, Hfcttti$tt OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. ft fiber's Drug Store, Baltimore Street, • GETTYSBURG, PA. Prescriptions Carefully Compounded. matest Styles ir\ Hats, Shoes, AND Gents' Furnishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes A. D. BUEHLER&CO., Headquarters for Stationery and Blank Books. LOWEST CASH PRICES. 1 f VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, flecu Vo^k. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jecaeli*y Stoi*e fop Souvenir * Spoons, x Sword * PTVins, &c. COLLEGE EMBLEMS EMIL ZOTHE, Engfavef, Designer and CQanufaetaPing tJeraeletf, 19 SOUTH NINTH STREET, Opp. Post Office, PHILADELPHIA. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, and Stick Pins. Athletic Prizes. ALL GOODS ORDERED THROUGH G. Z. STUP. Post Office Corner, Centre Square. ADVERTISEMENTS, Vll R. H. REININGER, Merchant * Tailor. )K 5K ^ 5K f THE BEST WORK AT THE LOWEST PRICES. Suits from $ 12.00 to $40.00. Pants from $4.00 to $12.00. NEXT DOOR TO POST OFFICE, UP-STAIRS. CENTRAL SQUARE. PETE THORNE, Shaving $ Hair Cutting Parlors. FIRST CLASS ARTISTS. CENTRAL SQUARE. FLEMMING & TROXEL, Billiard AND Pool 'Rooms. BALTIMORE STREET. flJVIOS EC^E^T, DEALER IN Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, Pocket Books, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. SPECIfll* TO STUPEflTS. Fine Tailoring. JOSEPH JACOBS, Merchant Tailor, Chambersburg Street, (Below Eagle Hotel) GETTYSBURG, PA. Red Front Cigar Store R. H. RUPP, Proprietor. Jio. 8 fialtimofe St., Gettysburg. The place for a fine Cigar or a good chew. Solid Havana filler,. 5 for 25c. An elegant article. './." A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES Vlll ADVERTISEMENTS. ESTABLISHED 1876. PE/N-ROSE MyEKS, JEWELER. Ltafge Stoek of matches, Cloeks, Jeuaelry, ete., on Hand. GETTYSBURG SOUVENIR SPOONS COLLEGE SOUVENIR 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R. STINE S. SON'S CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. MERCHANT TAILORING A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, PA. A. G. SPALDING & BROS. MANUFACTUKERS OP .Athletic ^ gporting Qoods OF EVERY DESCRIPTION THE NATIONAL LEAGUE BALL, BATS, CATCHERS' GLOVES AND MITTS, MASKS. BODY PROTECTORS, ETC., ETC. ^f*~ THE SPALDING TOURNAMENT TENNIS BALL, THE SIOCUM RACKETS. RACKET COVERS, PRESSES AND NETS, COURT MEASURES, MARKERS, POLES. FORKS. ETC., ETC. Uniforms and Clothing for all Sports, Outing and Gymnasium use. The finest imported Serges and flannels. Newest Styles and Patterns. SEND FOR OUR NEW CATALOGUE'S CHICAGO. 108 MadiLOn St. NEW YORK, PHILADELPHIA, Z43 Broadway. 1032 Chestnut St. DnTTLEriELD LlVEKT. Rear of Washington House, Opposite W. M. R. R. Depot. GETTYSBURG, PA. imz. All Kinds of Teams. Good Riding Horses. -:o: The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

Interview with Nunzio Roselli of Leominster, Massachusetts. Topics include: How he came to the U.S. with his family ten years prior, when he was seven years old. What he remembers about life in Sicily. His education in Sicily and then being put back two years, to first grade, when he came to the U.S. because he did not speak English. What his town was like in Sicily. What he remembers of when he first moved to the U.S. and how different things were from Europe. Stories he has heard from his family about World War II. His experiences in school. Italian traditions that his parents maintain. Cultural differences between life in the U.S. and life in Italy. How he started playing the drums. What school was like in Italy. How the food in the U.S. compares to the food in Italy. His plans to study music in college. ; 1 GREG CARCHIDI: Okay this is Greg Carchidi doing an interview, an oral history, with Nunzio Rosselli. NUNZIO ROSELLI: Buona sera, buona sera. GREG CARCHIDI: Okay, buona sera [laughter]. Okay. All right, this is Nunzio Rosselli [laughter]. We play in the same band [laughter]. All right. Nunz, how old are you? NUNZIO ROSELLI: Okay. I'm 17. GREG CARCHIDI: Seventeen years old, yeah. NUNZIO ROSELLI: Eighteen this January. GREG CARCHIDI: All right. Is that -- what's your full name? NUNZIO ROSELLI: My full name is Nunzio Roselli, exactly what you said. GREG CARCHIDI: Nunzio Rosselli. NUNZIO ROSELLI: That's it. No middle name, nothing. GREG CARCHIDI: All right. Could you tell us like where were you born? NUNZIO ROSELLI: Okay. I was born in Italy, first of all. Actually, in Sicily. Sicily. I came -- some 10 years ago, I came to this country, and I came with just my family. Actually, we came with my mother's sister, you know… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: And her family. But then they left after two years and we remained here because, you know, felt good here, felt comfortable, you know. GREG CARCHIDI: All right. NUNZIO ROSELLI: So, but like most of my relatives are in Italy. All I have here is an uncle in Boston, an uncle in Fitchburg. GREG CARCHIDI: Who else? NUNZIO ROSELLI: All alone, that's all. GREG CARCHIDI: So just you, and there's -- what is it, your mother and father? NUNZIO ROSELLI: Oh, we have a lot of friends. We have a lot of friends [unintelligible - 00:01:29].2 GREG CARCHIDI: Yeah. So how old were you when you came over here to America? NUNZIO ROSELLI: I was seven years old. GREG CARCHIDI: Seven years old, yeah? NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Well, what was the life like over there? Do you remember anything? NUNZIO ROSELLI: Oh, sure. You know, life -- well, it's a different type of things because people, they take it easier out there, you know what I mean? They worked less, okay? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: But they spend more of their time having a good time, you know what I mean? Like I'll give my uncle as an example, right? He's a constructor, okay. He works on houses and stuff like that, right? And he'll get work every now and then on his own, you know, to do something… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: And when he's not working, you know, well he's not making any money. But, still he sets money aside, goes out every night, you know, goes out with a few friends, go down to the local bar downtown or a café if you call it, go for a nice [speaking in Italian] or whatever you want to call it. And they'll have a few beers, right, have a few beers, you know. GREG CARCHIDI: They drink beer over there too? NUNZIO ROSELLI: Oh yeah, yeah, yeah. GREG CARCHIDI: Oh, that's good [laughter]. NUNZIO ROSELLI: Beers or whatever you like, you know, and go home late at night. They go to sleep late over there. Twelve o'clock is like same as 10 o'clock here, so you know, so… GREG CARCHIDI: They have a lot of churches over there. Do they have a lot of churches?3 NUNZIO ROSELLI: Yeah, yeah. Over there it's kind of -- the churches are all Catholic, you know. It's not, for instance, that you have your local Catholic church and your local Protestant church, you know. Everything is Catholic there. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Because the country itself is run by religion, [unintelligible - 00:03:09]. Not in that sense. You know I'm trying to say. GREG CARCHIDI: What town was it where you were…? NUNZIO ROSELLI: The name of the town is Santa Caterina, which means St. Catherine in Sicily [laughter]. GREG CARCHIDI: Santa Caterina. NUNZIO ROSELLI: Caterina. Hey you know how to spell that? Let's see… GREG CARCHIDI: Caterina? NUNZIO ROSELLI: Mm-hmm. GREG CARCHIDI: Did I spell it right [laughter]? NUNZIO ROSELLI: Wait a minute. You got an H there, right? GREG CARCHIDI: No H. NUNZIO ROSELLI: No H. GREG CARCHIDI: No H in Italian? NUNZIO ROSELLI: No, no. GREG CARCHIDI: Oh. NUNZIO ROSELLI: No H, just T. GREG CARCHIDI: Okay. NUNZIO ROSELLI: Yeah don't forget the T [laughter]. GREG CARCHIDI: Caterina. NUNZIO ROSELLI: St. Catherine. GREG CARCHIDI: I just want to remember here. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Okay. That's in Sicily, right? NUNZIO ROSELLI: That's in Sicily. GREG CARCHIDI: All the olive oil and the mafia?4 NUNZIO ROSELLI: That's right, that's right. GREG CARCHIDI: [Speaking in Italian] [laughter] Godfather, yeah. Let's see. You were seven when you came here, right? NUNZIO ROSELLI: Mm-hmm. GREG CARCHIDI: All right. You must have gone to school over there for a couple of years, right? NUNZIO ROSELLI: Yeah, two years I went to school there. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I went first and second grade, and then I never finished the second, and I finished it over here. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: And then I got put back here two years. GREG CARCHIDI: That caused the…? NUNZIO ROSELLI: Yeah, instead of going to the third, I got put back in the first. GREG CARCHIDI: Really? NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Did you feel like that you knew -- like when you finally did start school in America, did you feel like you were ahead of the kids in here, in America, or was it about the same, or was there a language problem or what? NUNZIO ROSELLI: The only thing there was, was a language problem, but I think as far as knowing stuff like math or stuff that didn't involve the language, I would know more because second grade over there is like fourth or fifth grade over here. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: They teach you with the same difficulty in all. But with just the language, that's what my teacher told my relatives, you know, my aunt and uncle, when I didn't pass and then they put me back in the first. She said, well, you can't speak, so he's going to stay back and learn, you know… GREG CARCHIDI: Yeah. 5 NUNZIO ROSELLI: Just for the sake of the language, not so much the other things. GREG CARCHIDI: Yeah, oh that's…[laughter] NUNZIO ROSELLI: Oh I don't care [laughter]. This is a recording. We must keep everything [laughter]. GREG CARCHIDI: Keep it clean. NUNZIO ROSELLI: It's kind of hard to, you know, when you're used to talking… GREG CARCHIDI: Yeah [laughter]. All right. How about the people in your town there in Santa Caterina… NUNZIO ROSELLI: Santa Caterina… GREG CARCHIDI: Was it a rich town, or are they farmers? Or what do they do over there? What was the main…? NUNZIO ROSELLI: By all means, it's not a rich town. All right, if you were to judge it like, okay, a town in the United States. In other words, what kind of town would it be if it was translated to the United States, you know what I'm trying to say? GREG CARCHIDI: Yeah, yeah. NUNZIO ROSELLI: You know, it would be the equivalent of let's say something place Shirley or a small town like Princeton, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: But in size, it's small. I'd say it would be the size of… yeah, probably Shirley, would be the size of Shirley, real small, small town, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know, most of the people that live there, the older people like my father's age maybe in the 50s or mid-40s, probably they worked on their land. They have a piece of land that the governments rents to them or gives to them or whatever, and they work on that, you know. And younger generations, you know, they're mostly involved with either going to school or something construction or something maybe mechanics, you know. GREG CARCHIDI: Yeah. 6 NUNZIO ROSELLI: Stuff like that, you know. But it's by no means… it's not a big town. It's a real small town. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Nice town though. A lot of good times there [laughter]. A lot of nice, young people, you know, girls [laughter], people. GREG CARCHIDI: Yeah, a lot of young woman, huh? All right [laughter]. Did you have any room, did you think your family had any real reason why they wanted to come to America, or did they just…? NUNZIO ROSELLI: Well, all right, we had relatives here. You know, at the time they were living Leominster, my aunt and uncle, you know. Now they live in Boston. So I guess what we did was we were going to come here for a couple of years, see what it was like, because my father was having a hard time with jobs over there, you know. They weren't easy to come by. And so we said we'd come over here and try, you know. If we liked it, we stay a couple of years. If not, we'd leave. So we came over, we stayed. You know we've just been here ever since, you know. I've gone back a few times, two times. My brothers have gone back few times too, you know. You know, we've all gone back a few times. GREG CARCHIDI: The refrigerator just went on, huh? NUNZIO ROSELLI: Oh, sorry about that [laughter]. GREG CARCHIDI: It's okay [laughter]. All right. When you first got here, right, did you come by boat or you fly? NUNZIO ROSELLI: Oh, we fly. GREG CARCHIDI: You flew Alitalia? NUNZIO ROSELLI: Alitalia, yeah. What else? GREG CARCHIDI: Alitalia Airlines. NUNZIO ROSELLI: We're Italian. We can't use Pan Airlines, you see. GREG CARCHIDI: Oh, nah. NUNZIO ROSELLI: Yeah, it's going to be Alitalia [laughter]. GREG CARCHIDI: That's right. And you landed in Boston, right? 7 NUNZIO ROSELLI: We landed in Boston, right. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: That must have been what? What year was that? NUNZIO ROSELLI: That was '68, sessantotto. That's when President Nixon… GREG CARCHIDI: Yeah, that was when Nix -- you came [unintelligible - 00:08:28] [laughter]. NUNZIO ROSELLI: Right yeah, right. GREG CARCHIDI: They got the crook [laughter], the birth of the [unintelligible - 00:08:33]. NUNZIO ROSELLI: What the heck is this? What are you doing here [laughter]? GREG CARCHIDI: If you have any, you know, you can remember at all, like what are your first experiences? One of the first things that happened to you when you got here? NUNZIO ROSELLI: That was unique? GREG CARCHIDI: Yeah. That was like, you know. NUNZIO ROSELLI: Oh I got a few, but no [laughter]. GREG CARCHIDI: Well, so you were seven. NUNZIO ROSELLI: That's right. GREG CARCHIDI: You didn't have the [combats] on, did you? NUNZIO ROSELLI: No, no [laughter]. Well, I might have, you know [laughter]. No, let me see. I'm trying to think, actually. As far as the whole way of life, you know, it's so different when I got over here, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Because I mean, we weren't used to seeing all this many cars and things at the time, you know. But yeah, that probably have to be -- just the whole idea of the way of life over here, which is so different, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: People were different. It wasn't as close, you know what I mean? It wasn't like you know your neighbor.8 GREG CARCHIDI: Yeah, like in Sicily, you knew all your…? NUNZIO ROSELLI: Yeah, you knew what was going on. GREG CARCHIDI: Paisans and. NUNZIO ROSELLI: Right. Yeah, paisans. GREG CARCHIDI: I mean, of course you come to Boston, right? You landed in Boston. You must have freaked out when you saw [laughter]. NUNZIO ROSELLI: You say, "What the heck is this?" Oh, you know, I've seen big cities like -- you know, there were a few big cities near my hometown, you know, but it was just a different type of an atmosphere too, you know. It was set up different, you know. The cars were big, you know, so what the heck is this one, bus? GREG CARCHIDI: And when you came to Boston, you saw… NUNZIO ROSELLI: I used the small cars in Europe, you know, and you see all these [laughter] tanks. GREG CARCHIDI: The food is same thing. The first thing, is the food any -- like you eat different here, or…? NUNZIO ROSELLI: Yeah, when we get over here, I remember the first thing I think I tasted that was really big was potato chips. I didn't like it. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I don't like potato chips at all. And I really didn't like it. But after a while, I developed at taste for it, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Well, I like potato chips, but you know, at that time, especially those Ruffles with the ridges, you know what I mean [laughter]? Funny flavor [unintelligible - 00:10:57] exactly what it was, you know. GREG CARCHIDI: Yeah [laughter]. NUNZIO ROSELLI: You know, any idea of hamburgers… GREG CARCHIDI: McDonalds and stuff… NUNZIO ROSELLI: McDonalds, you know. It was different, but I'd still rather eat Italian still.9 GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know, that's what we eat at home. We're not the gravy and potatoes type people, you know what I mean? GREG CARCHIDI: Oh yeah. NUNZIO ROSELLI: I mean potatoes… GREG CARCHIDI: Unless it's sausage and… NUNZIO ROSELLI: Yeah, unless it's sausage [laughter]… GREG CARCHIDI: Like the peppers and the onions and the garlic. They can keep McDonalds. NUNZIO ROSELLI: That's right [laughter]. GREG CARCHIDI: They can keep it, man. All right. When you first settled down, when you came to America, did you come right to Leominster? NUNZIO ROSELLI: Yeah, right. Like I said, we had a set of relatives here, and we lived with them for a couple of months until we found our own apartment. And we lived in an apartment for about eight months, then we found another apartment. We lived there about six years, then we moved here and we bought this house. GREG CARCHIDI: Yeah. Nice house. NUNZIO ROSELLI: Thank you. GREG CARCHIDI: You've got your drums on there, huh? NUNZIO ROSELLI: Yeah, I got all my stuff yeah [laughter]. We've been living here about four or five years, so. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: We enjoy it here. GREG CARCHIDI: Right, nice. NUNZIO ROSELLI: Yeah, nice part of town. GREG CARCHIDI: All right, I don't know maybe… when you were growing up, I mean, did your parents -- do you remember anything that your parents said to you about -- like they must have lived through the war in Italy.10 NUNZIO ROSELLI: Mm-hmm, yeah. They tell me a lot about their experiences, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Yeah, bad experiences. Good experiences too, you know. There were things that, you know, they remember about the war that they can relate too, but you know, I mean, what's there to say? It's just going to… GREG CARCHIDI: They made it through alive. NUNZIO ROSELLI: Yeah, they made it through, yeah. My mom always told me about her father. He joined the service. He had to join, you know. It was drafted for… GREG CARCHIDI: World War II or World War I? NUNZIO ROSELLI: World War II. GREG CARCHIDI: World War II. NUNZIO ROSELLI: Right, and he was there for about few months, then they send him back because he had too many kids, so many kids he couldn't really, you know, be involved with the war and take care of the family. Because, you know, in Italy, in other words, in Italy it's not like over here. I don't mean to get off the subject or anything… GREG CARCHIDI: No, that's okay. NUNZIO ROSELLI: In other words, there isn't as much… women's lib, you know what I'm trying to say? GREG CARCHIDI: Things like that? NUNZIO ROSELLI: Yeah. GREG CARCHIDI: You mean like white for the flag and the… NUNZIO ROSELLI: Well, no. What I'm saying is the woman's place is in the home, okay. In other words, my grandfather was out fighting, okay? GREG CARCHIDI: Yeah. 11 NUNZIO ROSELLI: And he wasn't home, and he had all these kids to take care of. Who's going to take care of them as far as supporting them, you understand? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: So they had to do things like that because of the way life is in Italy, you know. The woman really isn't as free as over here, not really free. I don't know if this is true with you. It's just… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Just a way of life, you know? I don't know. GREG CARCHIDI: It's definitely different, yeah? NUNZIO ROSELLI: Yeah, but you know, about the war, yeah. My parents told me stories about the soldiers used to come to town. Like all right, the soldiers used to come and used to give the kids candies and stuff like that, you know, and then they used to give food from some of the neighbors, you know, the Italian food, because [unintelligible - 00:14:26] or not. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Wow. NUNZIO ROSELLI: [Unintelligible - 00:14:33] experiences. GREG CARCHIDI: Yeah. So what school did you go to when you started school over here in Leominster? NUNZIO ROSELLI: That was at Priest Street. GREG CARCHIDI: Priest Street School? NUNZIO ROSELLI: Right, up on… GREG CARCHIDI: Your Doyle Field up there? NUNZIO ROSELLI: No, no, wait. Pierce, I'm sorry. GREG CARCHIDI: Pierce Street? NUNZIO ROSELLI: I got it mixed up. Pierce Street, yeah. GREG CARCHIDI: So you lived up in North Leominster?12 NUNZIO ROSELLI: Right, that's where we moved to, right, yeah. I always get the two schools mixed up. GREG CARCHIDI: It's funny. I interviewed my grandmother. When my grandmother first came to America, that's the school she started. NUNZIO ROSELLI: Is that right? GREG CARCHIDI: Pierce Street. This is back in 19 -- oh Jesus, 1910, 1911, 1909, right around… NUNZIO ROSELLI: Amazing, that's [unintelligible - 00:15:16] [laughter]. Those of you who don't know what wig is [laughter] don't ask. That's great [laughter]. GREG CARCHIDI: So you started school there, and then you went right to like sixth grade and stuff? NUNZIO ROSELLI: Well, I moved to… Fallbrook. GREG CARCHIDI: Fallbrook. NUNZIO ROSELLI: Yeah, I went to Fallbrook, then I went to Lancaster Street, then I went to, you know… GREG CARCHIDI: How long did it really take you to kind of get the language, the English language, down? NUNZIO ROSELLI: I'd say after about a year and a half, you know, pretty good, you know, to it, you know… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Because I could speak pretty good after about a year or so. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: But still, it's a lot of the vocabulary, it takes years to pick up on everything, you know. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Because you're never sure if some of the words they're saying, you know, what exactly are they saying, you know? I always said that to myself. GREG CARCHIDI: Did the kids in school act… how did they treat you in school, say like in fourth or fifth grade? Like if you spoke Italian in front of 13 them, did they look up to you like you were really something special, or…? NUNZIO ROSELLI: Well, yeah. In a way. GREG CARCHIDI: Celebrity like… NUNZIO ROSELLI: In a way, yeah. But I don't think there was that much of a difference, you know, between me. Once I got in the fourth grade, like when I was in second, I was different. But you know, like you say, you know, when I used to talk, I used to say well, what is this kid, you know? GREG CARCHIDI: Yeah [laughter]. Did they ever call you [guinea] or anything? NUNZIO ROSELLI: Oh yeah. GREG CARCHIDI: Did you ever get to any fights when you were little, you know? NUNZIO ROSELLI: Oh yeah. I got into a fight once, I remember. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: Yeah. I used to detest them. They'd call me wop or guinea or something. I used to be hurt for that. I don't like that. No, you know, if a friend says, you know, let's knock it off at school. But when I was little, I used to be really serious about it, you know. But now, you know, unless the guy's really serious about it to me… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: That's the only time I take it. It's weird, but yeah. That happens. GREG CARCHIDI: Yeah. Did you and your family belong to any social clubs? When you first came over, did you get in like -- what do they have? They used to have the Corifinio Club and the…? NUNZIO ROSELLI: Oh, you mean Italian social clubs? GREG CARCHIDI: Italian clubs, or like the church or whatever. NUNZIO ROSELLI: No, not really. My parents really aren't much of, you know, people, like go out and get involved and like that you know… GREG CARCHIDI: Yeah. 14 NUNZIO ROSELLI: In Italy they were, because they felt safe. They felt, you know, more at home. GREG CARCHIDI: Everything was closed there. NUNZIO ROSELLI: Yeah everything is closed, you know. You know, the language, you go out… GREG CARCHIDI: Right. NUNZIO ROSELLI: Social people there. But you come over here, it's a different thing, you know. They sort of lost their -- how do you say it? You know, they don't do it anymore. GREG CARCHIDI: Free spirit, or like… NUNZIO ROSELLI: Yeah, their willingness to go out as much or stuff like that, you know, because it's just a total different, different country, you know. They're still not fully used to it. GREG CARCHIDI: Really? NUNZIO ROSELLI: Yeah, they aren't, you know. They speak their language a little much better, you know. They can understand what you're saying. You know, it's still… but like I said, we get a lot of friends, you know. They're always over at somebody's house or somebody's over here or something's going on. GREG CARCHIDI: Yeah, that's good. NUNZIO ROSELLI: Yeah, you know. What are you going to do when you don't have many relatives, you know? GREG CARCHIDI: Yeah. Do you remember like your first part-time job or something? NUNZIO ROSELLI: Yeah, probably [laughter]. Well, the first… probably I was a baby boy for about five years. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: Yeah, I had two, three paper routes. I had one in Lancaster Street, and then I had one up here, five years [unintelligible - 00:19:19].15 GREG CARCHIDI: You're in a unique position. A lot of immigrants that -- you know, people that came over from Italy, the people that I know, it's usually like people my grandparents' age, you know? NUNZIO ROSELLI: Right, the older people. GREG CARCHIDI: Which makes my parents, you know, native-born Americans, you know what I mean? And you were born over there, and then you came here when you were, what, seven? Yeah? NUNZIO ROSELLI: Mm-hmm. GREG CARCHIDI: And so I guess, you know, it's safe to say that you've adjusted pretty well to America, you know, to the ways of life here. But still, I think -- would you say that you have preserved certain features about Italian lifestyle, the Italian culture? Have you preserved those at all? You know, not really specific, but I mean as far as relaxing like on Sunday? I know I do, my family. You know, nobody's going to catch me up raking leaves on Sunday afternoon, you know, at two o'clock. I'm gonna be in the house eating dinner. You know, I could give a sweet shit if World War III was coming, man. Sunday dinner is… NUNZIO ROSELLI: Is more important, right. GREG CARCHIDI: You know what I mean? NUNZIO ROSELLI: Well… GREG CARCHIDI: Do you still preserve certain things like that, or…? NUNZIO ROSELLI: Yeah. Well, my parents preserve a lot of things that are Italian. They have to, because I mean, you know most of their life was spent doing that, you know. It's only been 10 years that they've been here compared to 30 years in Italy or 40 years in Italy, you know? So they have a lot of things that -- I can't remember what, but [laughter]. Well, food's one thing, you know… GREG CARCHIDI: Food… NUNZIO ROSELLI: The way you celebrate certain holidays. GREG CARCHIDI: Right. 16 NUNZIO ROSELLI: Even the way you treat guests, you know? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know, like I said, my parents -- all right, in other words, as far as being hosts and stuff like that, they host more like an Italian host than somebody over here would host people, you know what I mean? It's a different type of… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I don't know how to describe it… GREG CARCHIDI: I don't know. It seems to me like I've been… most of my friends were Italian, but I don't know. You can tell right away when you go into an Italian household… NUNZIO ROSELLI: Right, right. GREG CARCHIDI: Well, especially when the people are from Italy. NUNZIO ROSELLI: Because the house is set a certain way, and in other words, you know… I know a certain openness about the people, to strangers… GREG CARCHIDI: Right. Or for meetings… NUNZIO ROSELLI: Yeah, "Sit down, have a drink," you know, all the stuff like that, you know? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Want a drink? Want something to drink? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Want a beer? GREG CARCHIDI: Yeah, all right. NUNZIO ROSELLI: Yeah. I'll get upstairs… GREG CARCHIDI: Okay, we'll have a timeout here. NUNZIO ROSELLI: All right. GREG CARCHIDI: Time off against it [laughter]. Okay. NUNZIO ROSELLI: Even if it's all for just a quick call. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: Oh yeah.17 GREG CARCHIDI: The hospitality is nice. Personally, yourself, have you ever had any bad experiences here or in America? Or is there anything that has ever affected you to the extent that you wish you were back in Italy? You wish you went, you know, you wish you still lived there? You wish you lived your life there, you know? NUNZIO ROSELLI: Yeah, when I first moved here, there were a lot of things that hit me. The biggest thing I'll tell you was the freedom, you know, like kids over there had a lot more freedom, okay? By that, what I mean is every night you go out [laughter]. I mean, a 7-year-old kid will be out downtown in a bar and with a few friends of his, seven, eight years old, nine, whatever. GREG CARCHIDI: Really? NUNZIO ROSELLI: They'd be out there, they'd order a beer, you know? GREG CARCHIDI: You can go order a beer or order a glass of wine? NUNZIO ROSELLI: You know what I'm trying to say? Or you know, even if you don't do that, you go out every night. You're out, and you're in a place where there are a lot of people, you can meet a lot of people, you know what I'm trying to say? But over here, you know, your nights would be spent home, you know? I've never seen winters in Sicily. The biggest winter I've seen is maybe 2 inches of snow, nothing really big, you know? GREG CARCHIDI: Really? NUNZIO ROSELLI: And then all of a sudden I come here, it's five feet, you know? [Laughter] You walk out the door and say, "What the hell is this?" you know? GREG CARCHIDI: With all the snow. NUNZIO ROSELLI: But I think it's mostly the freedom that I had over there as a kid that I never had here, that I'm starting to enjoy now that I'm, you know, 17, 18, that I can go out, you know, have a good time that way, you know. I couldn't do that when I was younger.18 GREG CARCHIDI: So you think over here, they kind of postponed everything? They make you wait? NUNZIO ROSELLI: Yeah, yeah. GREG CARCHIDI: They make you wait before they let you live. NUNZIO ROSELLI: Yeah, which in a way is good, in a way it's not. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know. GREG CARCHIDI: Yeah, you got to think. They got to have some rules. NUNZIO ROSELLI: How is it that a country like Italy manages and a white kid can't manage it here? I can't understand that. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know, I mean, see, in Italy, that whole attitude towards booze or something like that is different. You know, they don't think of it the way you think of a beer here. "Oh, kids having a beer! Oh! Hit him!" you know, do this… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Over there, the parents will get a kick out of giving the kid a beer, you know, "Drink it." Here, "Can you drink this?" [Laughter] No, no… GREG CARCHIDI: Yeah [laughter]. NUNZIO ROSELLI: Yeah, I had a little cousin, my uncle used to get a kick out of seeing him smoke. He was like two years old. GREG CARCHIDI: Really? NUNZIO ROSELLI: My uncle used to get a kick out of seeing the kid smoke and blow through his nose [laughter]. I couldn't believe it. I used to do it, yeah. It's the way Italians are, you know? We're, I don't know… different [laughter]. GREG CARCHIDI: Yeah. What the heck, I admit it. NUNZIO ROSELLI: I don't know [laughter]. GREG CARCHIDI: What the heck [laughter], I admit it… NUNZIO ROSELLI: I admit it about you too [laughter]. 19 GREG CARCHIDI: Yeah. Have you been able to form any opinion about the American political system? NUNZIO ROSELLI: I'm not much into that. I don't know about it because, you know… GREG CARCHIDI: Well, over here, you know, the politics kind of dictates how you live. I mean… NUNZIO ROSELLI: Yeah, well… GREG CARCHIDI: You pay tax, all kinds of taxes here. NUNZIO ROSELLI: All right, all right. As far as taxes, from what I see, it's too much over here, okay? It's good because the government is rich and all that and they can do a lot, and that's why the country's probably rich. But see, besides there being a lot of work and stuff like that -- but see, in Italy, you don't have the taxes that you got over here, okay? People make less money, okay? But they spend less on taxes, you know? And they don't work as hard. My parents always say how work over here is, you know, it's like hard compared to work in Italy. You work in Italy, you get a three-hour lunch break, you know? And if you work all year around, you get at least one month vacation, yeah, something like two weeks you get over here or one week, you know? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Plus the fact that every night, you go out having a good time, something like that, you know? It's more relaxed. People don't work as hard. They have more time to themselves. GREG CARCHIDI: Everything is competitive over here. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Have you noticed that? NUNZIO ROSELLI: Yeah that's right, that's right. GREG CARCHIDI: They compete for everything, I guess, [unintelligible - 00:27:01]. NUNZIO ROSELLI: Even for your job, even for your job. See, I don't know, it's just different. That's the only thing that I don't like. But I'm used to 20 it, you know? I mean, I can relate to other American, I could relate to it, you know, as far as work, you know. It doesn't bother me because I grew up here, you know, so. All right, good night. SPEAKER 2: Go out [laughter]. I'll go. NUNZIO ROSELLI: Bye. Yeah, they go out a lot, gonna have a good time [laughter]. GREG CARCHIDI: That's good [laughter], that's good. You've given me most of your opinions about the people who lived there. NUNZIO ROSELLI: [Unintelligible - 00:27:48]. GREG CARCHIDI: Yeah, yeah, [laughter], you know. What else? NUNZIO ROSELLI: Talk, talk. GREG CARCHIDI: I mean, like heck, you lived in Italy for seven years, you know? There must have been a few things that really… NUNZIO ROSELLI: Well, I like both countries, you know, as far as opinion and the way of life. I'm used to the way of life here. You know, I'm not against it. I like the way of life over here. I like staying at home at nights, or -- you know what I mean, as opposed to always going out, like in Italy. In other words, people over there relax by going out and talking to friends, you know? Well the people over here relax by staying at home, watching TV, you know? In Italy, you know, you don't have TVs like over here. You don't have the entertainment at home… GREG CARCHIDI: Yeah. NUNZIO ROSELLI: To do over here. Just stay home and just listen to the radio or TV. So people go out more, people go out to socialize with their friends, or there's a group of friends that comes over to somebody's house, you know. It's just a mock. GREG CARCHIDI: They play cards… NUNZIO ROSELLI: Yeah, play cards, have wine. People are just crazy over there. Just, you know. GREG CARCHIDI: Yeah, they make a big thing out of it over here. NUNZIO ROSELLI: That's right.21 GREG CARCHIDI: They got to go out. The woman gets ready for four hours, you know. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: That's the way. NUNZIO ROSELLI: Well, it's different. I'm not saying one is better than the other. I'm just saying. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: It's a big difference. GREG CARCHIDI: It's true. NUNZIO ROSELLI: You know, and I could deal with either one. GREG CARCHIDI: Okay, I know probably your favorite hobby is music, because we play in the same band. So, did you start playing the drums when you were in Italy or when you were that young? NUNZIO ROSELLI: No, I just started playing that thing when I was 11. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I was in the fifth grade over here. Matter of fact, I started playing because I was sort of forced into it by my fifth grade teacher. I studied with this real mean Italian lady. Her name was Ms. Holera… GREG CARCHIDI: Yeah [laughter]. NUNZIO ROSELLI: She was a nun at one time, you know. It was [unintelligible - 00:29:48] really mean [unintelligible - 00:29:50] you know [laughter]. Anyways, one day we got a call from the office, anybody wanted to try out for the band, you know, who could try out. And she goes I hope everybody in here is going to try out, because if you don't -- she made some remark or something. So I was afraid of her, you know. She said I'd better go down and try out, you know, or else she might get really mad at me, you know. I don't want that, so I went down. I was like -- hey, I thank her for it now, you know? GREG CARCHIDI: Really?22 NUNZIO ROSELLI: I wouldn't have gone down [laughter]. Hey, she was Italian, too. GREG CARCHIDI: But that's pretty good. But you never really had -- did you have any hobbies in Italy when you were, like, your first seven years of life over there? NUNZIO ROSELLI: Seven years? GREG CARCHIDI: You just did what the other kids did? NUNZIO ROSELLI: Well, what kind of a hobby does a kid have when he's seven? You know what I mean? GREG CARCHIDI: Yeah, they don't even start -- you know, over here, they don't even start with playing little league baseball until they're eight or nine, something. NUNZIO ROSELLI: You believe that I play any sports… GREG CARCHIDI: What did you do over there, you know, when you were little? NUNZIO ROSELLI: Oh, for fun? I played soccer… you know. What do kids do? They just hang out. GREG CARCHIDI: Hang out… NUNZIO ROSELLI: [Unintelligible - 00:31:05] when I was seven, you know. Yeah, that's mostly what I did. I had a few friends around the neighborhood. We used to always meet. We'd meet like at eight o'clock in the morning, you know, when there was no school. We'd be out till 12, go home eat 12, sleep a few hours, and then after… GREG CARCHIDI: Go back to school? NUNZIO ROSELLI: Well, go back on the afternoon, you know, and just play [laughter]. GREG CARCHIDI: How was the school over there in Italy? So you must have went '67, '66. You must have gone to school over there. Did you go like five days a week like here? NUNZIO ROSELLI: No. GREG CARCHIDI: Three or something or whatever? NUNZIO ROSELLI: Not at all. I went six days a week. It went longer as far as the weeks go, but you only went from 8 to 12. You don't have to go in 23 the afternoon, you know? You went Saturdays, but you don't have to go. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: That's good. NUNZIO ROSELLI: They ought to keep that up. I used to like school when I was in Italy. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: I had a teacher that really liked me. She knew my mother, and just really liked me [laughter]. GREG CARCHIDI: You were only 6, 7 years old. NUNZIO ROSELLI: You know, people in Italy mature fast. GREG CARCHIDI: Yeah [laughter]. NUNZIO ROSELLI: No, I know. GREG CARCHIDI: Yeah, I had sideburns when I was about 13, 14. NUNZIO ROSELLI: Right, right. Don't you find that a lot of…? GREG CARCHIDI: I had full sideburns. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: When I was 14, I could have grown, you know… NUNZIO ROSELLI: Right. GREG CARCHIDI: I had to shave my sideburns and my mustache. NUNZIO ROSELLI: Yeah, I started shaving when I was in the sixth grade. GREG CARCHIDI: Really? NUNZIO ROSELLI: Uh-huh. But as far as maturing, I don't know if it means much, but when I went over there a few years ago, I find that girls are like 13, 14, I mean… GREG CARCHIDI: Developed, yeah? NUNZIO ROSELLI: Developed. They looked like they were 18, 19. GREG CARCHIDI: Well developed, yeah. NUNZIO ROSELLI: It's not [unintelligible - 00:32:58] I couldn't believe it. GREG CARCHIDI: Yeah. Hey, you want to go? Let's go, okay [laughter]?24 NUNZIO ROSELLI: No, no, it will freak you out. GREG CARCHIDI: Well, yeah. It's like over here. One of my other friends goes back every year, you know, Sandro Vittorioso. He goes back every year for [unintelligible - 00:33:16]. He goes to Italy. She has relatives that are still over there, and he says it's amazing, it's amazing. Just like what you're saying, he says exactly the same, because he's from a small, small town or village, you know. He says the same thing. He says people over here, you know, you can't beat this country for its richness and all that, but people over there, you know, open a store when they get up [laughter], when they get out. But when they have to wake up or when they do get up and all those siesta. NUNZIO ROSELLI: Is that [unintelligible - 00:33:53]? GREG CARCHIDI: Jeez, I wished they had that [laughter]. If we were good at our band, then we'd become good, real good… NUNZIO ROSELLI: We could have the same thing… GREG CARCHIDI: Real good, we could get rich. We could have a siesta every day, a little espresso [laughter]. NUNZIO ROSELLI: A little espresso. Yeah, that will keep you up if you get a siesta, isn't that right? GREG CARCHIDI: Yeah [laughter]. Well, do you think you would ever go back there to live? NUNZIO ROSELLI: I might. But I really -- well, I used to think about it a lot more, you know, when I was younger. Because after I lived here for a year or two, I got homesick, okay? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I really got homesick. That happened, you know, all the way up to about five years, six years ago, you know, after -- I've lived for like seven years. Well, after I've lived here for about six, seven years, I started realizing, you know, I started growing up here, I started becoming, you know, more of an American, you know. I 25 grew up with kids that, you know, they were Americans. I talked to them in English. I did the same things they did, you know. I play football or whatever, you know? You know what I'm trying to say? So it's… GREG CARCHIDI: I don't know what you're saying. NUNZIO ROSELLI: So I sort of felt both ways… GREG CARCHIDI: You feel -- yeah… NUNZIO ROSELLI: You know, when I went over there for a vacation at summer, I stayed out there a month, and I'm just used to it over there. It was like I never came over here. And I came back here, and I have a hard time getting used to it. But once I get used to it, I could handle over here. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: You know. GREG CARCHIDI: All right. I got a couple of other questions. NUNZIO ROSELLI: You mean that hasn't run out yet? GREG CARCHIDI: All right. No, no, no [laughter]. About 10 minutes, Nunz. Hang in there. NUNZIO ROSELLI: No problem. GREG CARCHIDI: I want to ask you. Like I know that we all, like, all of us Italian Americans here, we like salami… NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Proscuitto, capicola, pepperoni with, you know, provolone cheese. I always wondered this. Now, the Italian cold cuts that we get over here, are they as good or close to what you get over there, the real thing? NUNZIO ROSELLI: No way. They're absolutely not, absolutely not. GREG CARCHIDI: You mean this is second-rate garbage? NUNZIO ROSELLI: This isn't even a second rate. I mean, this is… GREG CARCHIDI: This is real horse dung, man [laughter]? NUNZIO ROSELLI: If you want to compare it -- holy shit, you know, it is. 26 GREG CARCHIDI: So we're paying four, five dollars a pound for cured capicola over here? NUNZIO ROSELLI: Right. They have in a ball over there, you know, good stuff. It's a big difference. Even the stuff they import from Italy over here… GREG CARCHIDI: It's not as good? NUNZIO ROSELLI: Nothing compared to the real, you know… GREG CARCHIDI: It's nice over there. NUNZIO ROSELLI: Yeah, nothing compared to it. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Yeah. As a matter of fact, we just bought some capicola. GREG CARCHIDI: Yeah? NUNZIO ROSELLI: Gonna hang it up in the other room there. GREG CARCHIDI: Oh yeah? NUNZIO ROSELLI: Yeah. Hey, if you want a slice, you'll just slice it later on, man. GREG CARCHIDI: No, that's okay [laughter]. NUNZIO ROSELLI: You know, well… GREG CARCHIDI: What, you buy it from Italy? Somebody sent it over? NUNZIO ROSELLI: It's not from Italy, but it's from a store that's supposed to make it just like Italy. It's good. Don't get me wrong, it's good. GREG CARCHIDI: You know [unintelligible - 00:37:01] in Boston… NUNZIO ROSELLI: Yeah. GREG CARCHIDI: In the north end in Boston, that's pretty good. NUNZIO ROSELLI: They're from Italy? GREG CARCHIDI: Yeah, I think they make their own. Some they make their own, some they import. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: Very expensive, but… NUNZIO ROSELLI: Well, you know, it's the same. The only thing about it that's kind of hard, the flavor's still not as good as the Italian. Anything, you just can't beat it, the sauce…27 GREG CARCHIDI: See what I mean? That's what I do on Sundays. You know, it's not what you like to do on a -- you gotta take a day in the weekend, you eat a capicola, sit down [laughter], pasta, antipasto… NUNZIO ROSELLI: Uh-huh, that's great [laughter]. GREG CARCHIDI: It's like Thanksgiving. The Americans, they feature the turkey Thanksgiving. We feature lasagna, you know [laughter]? NUNZIO ROSELLI: Manicotti. GREG CARCHIDI: Manicotti. NUNZIO ROSELLI: We had Manicotti in Thanksgiving. We had the turkey, but hey, you give them… GREG CARCHIDI: The turkey's last. NUNZIO ROSELLI: That's right [laughter]. GREG CARCHIDI: The turkey's last. NUNZIO ROSELLI: Right. GREG CARCHIDI: Nothing against the Americans, but I mean hey, when they can make a turkey that tastes as good as lasagna or manicotti, then we'll eat it first, you know [laughter]? Well, all right. This is one of the things I want to ask you. Yeah, that's right. Okay, you're a senior now at high school, at Leominster High School. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: You're the head drum major for the band, the marching band. You've been in the all-state concert band your junior, and you look like you've got a real good chance to have a decent career in music, like -- I know you do very well in school. Do you have any plans to, you know, go to college for your education, or -- what do you think you might like to do? NUNZIO ROSELLI: Sure, yeah I'd go for a [mortician's] job, no [laughter]. It's like a friend of mine who goes to college for philosophy and gets out and becomes a [mortician]. I'm going for music, yeah. Definitely. I've thought about it for four years now, you know? I kind of decided against for three or four years, but this year I realized that, 28 you know, I can't go for [unintelligible - 00:39:12] engineering. I'm going to go there, you know, I'm just going to flunk out, you know, just -- because I can't do it. You know, I got to do something I like. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: I just couldn't go for four years, four other years in school. I'll take some courses like calculus again, yeah. GREG CARCHIDI: Well, do what you like. NUNZIO ROSELLI: That's right. GREG CARCHIDI: That's good. NUNZIO ROSELLI: That's the way I feel about it. You know, my parents, they say, "Hey," you know, "what are you doing? You got to go for something that's," you know -- I think they kind of realized now that that's what I got to do. They have to respect me for it. GREG CARCHIDI: It's the same thing. A lot -- that's an American thing over here, [unintelligible - 00:39:48] parents. You're going to become a doctor, you're going to be a lawyer, you're going to be -- you know, my parents not as much as I know other parents… NUNZIO ROSELLI: Right. GREG CARCHIDI: But you know, over here, you got the freedom to do what you want, when you want, and why. You know, why you want to do what you're going to do. You might as well take advantage of it. NUNZIO ROSELLI: That's right. Well my parents, you know, "Why don't you go for something like lawyer stuff?" I said, "I just can't do that. I see no reason why I --" you know, I can't do something like that. GREG CARCHIDI: Yeah. NUNZIO ROSELLI: See, all right, my parents grew up in a time when work was scarce, the war was going on. So they're more inclined to feel that [unintelligible - 00:40:29]. GREG CARCHIDI: Yeah. Well go ahead, go ahead. It's all right. NUNZIO ROSELLI: Can I stop over there?29 GREG CARCHIDI: No, no, okay [laughter]. No, it's okay [laughter]. Hurry up, the tape's running out. NUNZIO ROSELLI: All right, all right [laughter]. Well see, my parents feel, my parents feel -- they're more inclined to feel that work is something that you go to work, okay? That's not something that you have to enjoy as long as you make money out of it, you know what I mean? GREG CARCHIDI: Yeah. NUNZIO ROSELLI: Because they grew up in a time in Italy when work was scarce, you know, and you have to make a living and stuff, you know. But I think they understand that, you know… they're not giving me a hard time about it, you know. I told them once, like I'd decided, I've made up my mind a few months ago and I told them, you know, they opposed it, but they haven't said anything ever since, you know. They're not going to bug me about it. GREG CARCHIDI: Hold it against you, yeah. NUNZIO ROSELLI: They can't do that. GREG CARCHIDI: That's okay. This about wraps it up here. NUNZIO ROSELLI: Oh, finally. GREG CARCHIDI: But that's good. All right [laughter]. But it's interesting, Nunz, because… NUNZIO ROSELLI: Oh, nice talking to you. GREG CARCHIDI: Really, there's not many Italian immigrants that are, you know, your age around that can have and really express their opinion like you did. NUNZIO ROSELLI: Yeah. GREG CARCHIDI: So this has been an interview, an oral history, [laughter] with Nunzio Roselli. You're 18, right? NUNZIO ROSELLI: I'm going to be 18. I'm sorry, I didn't tell it. January first. GREG CARCHIDI: And you skipped a grade, right? NUNZIO ROSELLI: Yeah.30 GREG CARCHIDI: They kept you back then you skipped a grade in school. NUNZIO ROSELLI: Right. GREG CARCHIDI: You must have, because you're 17. NUNZIO ROSELLI: Well, [unintelligible - 00:42:03] should be out. I should have been out last year. GREG CARCHIDI: Oh yeah? NUNZIO ROSELLI: Yeah. GREG CARCHIDI: But you did skip a grade? NUNZIO ROSELLI: Yeah, I did skip a grade because… GREG CARCHIDI: After you learned a lot? NUNZIO ROSELLI: Hey, they screwed me once, you know? They can't screw me all the time. GREG CARCHIDI: Hey, that's right [laughter]. Okay. So thank you very much, Nunz. Why don't you say goodbye to the people in your native tongue? NUNZIO ROSELLI: Arrivederci. [Speaking in Italian] and as long as you pay me an extra 10 bucks this week, you know [laughter]… GREG CARCHIDI: Say merry… NUNZIO ROSELLI: Buon Natale, Buon Natale. It means Merry Christmas. GREG CARCHIDI: Buon Natale. NUNZIO ROSELLI: Buon Natale. GREG CARCHIDI: All right gracias, gracias. NUNZIO ROSELLI: [Speaking in Italian]. GREG CARCHIDI: [Speaking in Italian], okay. This about wraps it up. NUNZIO ROSELLI: [Speaking in Italian]. GREG CARCHIDI: Now that's the way it is./AT/jf/cl/es

Issue 29.3 of the Review for Religious, 1970. ; EDITOR R. F. Smith, S.J. ASSOCIATE EDITOR Everett A. Diederich, S.J. ASSISTANT EDITOR John L. Treloar, S.J. QUESTIONS AND ANSWERS EDITOR Joseph F. Gallen, S.J. Correspondence with the editor, the associate editors, and the assistant editor, as well as books for review, should be sent to REVIEW FOR RELIGIOUS; 612 Humboldt Building; 539 North Grand Boulevard; Saint louis, Missouri 63~ o3. Questions for answering should be sent to Joseph F. Gailen, S.J.; St. Joseph's Church; 32~ Willings Alley; Philadelphia, Pennsylvania tgto6. + + +. REVIEW FOR RELIGIOUS Edited with ecclesiastical approval by faculty members of the School of Divinity of Saint Louis University, the editorial offices being located at 612 Humboldt Building; .539 North Grand Boulevard; Saint Louis, Missouri 63103. Owned by the Missouri Province Edu-cational Institute. Published bimonthly/ and copyright ~) 1970 by at 428 East Preston Street; Baltimore, Mary-land 21202. Printed in U,S.A. Second cla~ ~stage paid at ~ltimo~, Mawland and at additional mailing offices. S~gle capita: $1.~. Su~cfiption U,S.A. and Canada: $5.~ a year, $9.~ for two yea~; oth~ coun~: $5,~ a year, $10.~ for two yea~. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money orderpaya-hie to REVtEW FOR RI:LIGIOL'S in U.S.A. currency only. Pay no money to persons claiming to represent R.EVIEW FOR RELIGIOUS. Change of address requests should include former address. Renewals and new subscriptions, where accom* paaied by a remittance, should be sent to Fan R~m~m.s; P. O. ~x 671; Baltimore, Maryland 21203. Changes of address, busin~ correspondence, and orders not accompanid by RELIGIOUS; 4~8 East Preston Street; Balfimo~, Ma~land 21202. Manuscripts, editorial cor-respondence, and ~oks for review should be Building; 539 North Grand ~ulevard; Saint Louis, Mi~ouri 63103. Qu~tions for answering should be sent to the addr¢~ of the Qu~fions and ~swe~ ~itor. MAY 1970 VOLUME 29 NUMBER 3 HERBERT FRANCIS SMITH, S.J. A Method for Eliminatin Method in Prayer Mental prayer is, .or should be, one of the most per-sonal of all activities. It is an interpersonal event in-volving mutual love and self-communication, and noth-ing is more personal than loving. -Still, beginners in mental prayer usually need helpful hints drawn from-the lives of the saints and others pro-ficient in prayer. These helpful hints come down, in practice, to a method of prayer. Here is a genuine dilemma. A method is an invasion of prayer; a lack of method means inability to pray. How do we solve the dilemma? By giving, beginners a method o[ prayer together with insistence that they jettison the method as soon as they can proceed without it. Among another class of meditators an even more serious dilemma arises. These are the people who have made progress in prayer and withdrawn from method for a while, only to find now that their spontaneous prayer has grown sterile. They seem to need method once again, only now the happy remembrances of per-sonalized prayer induces such a revulsion for method that they are tempted simply to drift rather than submit to codified guidelines anymore. It is above all to the people in the second dilemma that I propose a method for eliminating method in prayer. What these people really need is a method of preparing themselves for prayer. They need a method outside oI prayer Ior eliminating method in prayer. This method for eliminating method is, therefore, not for beginners. It presupposes one experienced in prayer. The method for eliminating method contains, 4- 4- 4- Herbert F. Smith, $.J., r~ides at Joseph s College in Philadelphia, Penn-sylvania 19131. VOLUME 29, ].970 345 4- ÷ REVIEW FOR RELIGIOUS incidentally and subordinately, a method to be used in prayer in emergencies. This contingency use will be ex-plained later. It is my con~,ictioh that virtually all who .pray men-tally, need some method of preparing for prayer if they. want optimal prayer and progress in prayer. For this reason I recbmmend the method of eliminating method even to those who are not conscious of either of the ~t~lemmas presented above. The preparation for prayer to be proposed here.can be used as a method ~or elimi-nating method above all by those who have reached the prayer of faith or even gone byond it.1 As a preparation for prayer which can be taken into prayer, what I am going to say here will be as salutary for beginners in prayer as for anyone. For clarity's sake, I will divide this article into three parts: the preparation for prayer; the prayer itself; and the post-prayer activity. Preparation [or Prayer The'best time to make preparation for the next day's mental prayer is in ttie evening before retiring. This is true even if the mental prayer is not to' take place in the morning. The reason for this insistence on the night l~reparation is the nature of the human psyche. Human "thought needs an incubation period in which to germi-nate and gestate. We are inclined" to theidea that all of our thinking is done. consciously; but the fact is, as Freud noted, that conscious psychic activi~ is only the latest arrival 'on the scene of psychic life. The soul never sleeps, and the night can be used to, good purpose if one collects himself to God before he retires. God "gives .to His beloved in sleep" (Ps 127:2). Evening recollection is important even in the shape it gives our dreams. Fur-thermore, preparation for prayer gives our thoughts a definite focus that ~eeds both our conscious aiad sub-liminal psychic processes dui:ing the day. Many great breakthroughs in human .thought have flashed into consciousness at moments when the subject of the in-sight was ~ving all his conscious attention to some other affair. This is proof enough that the inner life of man goes about the concerns of his heart even when he is least aware of it. These gifts from the inner life, how-ever, are not altogether gratuitous. We must plant our questions and our hopes consciously if we want our sub-conscious to give the increase. We do just tha~ by making evening preparation for" the next day's mental prayer. Once we become proficient at ma~ng this preparation for mental prayer, it need take no more than three or ~. ,1 To review the stages of prayer, see a book like Dom Godefroid Belorgey's The Practice of Mental Prayer. four minutes. Initially, tho~gh, ten or fifteen minutes are required. An ideal way to begin tlte preparation is to read a passage from the Gospels; il only for a minute or two. Then lay the Gospels aside and ask oneself the critical question: What do I want to meditate about? At stake here is the insistent fact thatI prayer ought to begin with oneself. A brief reading from the Gospels can establish the climate of prayer, but ~nly the person himself can specify the optimal start"ing point. To automatically meditate on the passage jus~t read can be a fatal error for the next day's meditation. Of course, if a person yearns to take up the Gospels and make them the sub-ject of his meditation, he shbuld do it, but because it is his desire, that is, because i~a reality he is starting with his desire, that is, himself. In prayer, I must begin with myself. I am the only apt launching platform for my prayer. The reason is that prayer, z's has already been said, is one of the most per-sonal of all activities. To ~start with something other than self is to make of medi'tation a study rather than a prayer. No one who wrote a book of meditation points months ago or years ago can tell me here and now what I want to meditate about. Here and now the points probably would not be apt for the authorl Those who use point books ought to us them as I suggest they use the Gospels. Read a set of points, lay the book aside, and ask: Now what do I want to meditate about? If the answer is: The points I hav~ ~ust read, do not use them ¯ exactly as they are, but personahze them according to the method I will introduce shortly. If it can be said as a general truth that failure to ad-dress God in prayer signals failure to love Him, it can also be said that failure to pray personally enough is failure to love rxghtly. Accordingly, we must discover apt and personal prayer eacliI single day. Apt and personal prayer can only start with myself, as I am here and now, thins day, this evening, with its whole train of circumstance.s, concerns, and desires. If simply ignore the whole existential situation, and let a book impose a prayer subject upon me according to such a random determinantt as the page I happen to be on, my prayer cannot possibly emanate from .that per-sonal psychic center where my in-depth living is going on. The result is that neithe~r my heart nor my attention will be captured by my pr~ayer. I will remain divided between my concerns and my prayer. Approaching the same point from another avenue, we can say that there is no really deep prayer without rec-ollecuon, and there xs no recollectxon wxthout presence to the self. I must be collect~d to myself and my deepest ÷ ÷ ÷ VOLUME 2% 1970 34? + ÷ H. F. Smith, S.]. REVIEW FOR RELIGIOUS 348 concerns before I can communicate myself to God or to any other. Only if a man enters those inner depths of the self where what he really is, unknown to others and often even to himself, is operative, can he enter into profound relationship with He-who-is. Profound rela-tionships depend on self-communication. The man who does not possess himself cannot communicate himself. We have all had dinner with someone so distracted by every trivial occurrence in the room that he was no com-pamon at all. His hollow presence was an insult. The Lord Himself likens prayer to an intimate evening meal together: "Look, I am standing at the door, knocking. If one of you hears me calling and opens the door, I will come in to share his meal, side by side with him" (Rev 3:20). I must, then, choose my own topic and make my own points out of my own reality to release my own love. That is, I must do this unless lack of prayer experience, exhaustion, or utter dryness compels me to go for help to another. When that happens I must return as soon as possible to my own initiative. My own points may not sound as sublime as the ones in the book. They may not be as sublime, but they may be much more power-ful in moving my emotions, my insights, my convictions, and my actions. A man must bring his current hopes, expectations, frustrations, concerns, and desires into his preparation. Please note: I am not saying: "Make your problems your prayer; bring your problems into your prayer." Such ad-vice would in no way constitute a method for eliminat-ing method in prayer. I am saying: do bring your prob- .lems into your preparation for prayer so that you will not have to drag them into your prayer. In your prep-aration begin with your current concerns; and within the few minutes it takes to prepare points, you will often see that they are really trivial matters yapping at your heels and demanding of you an outsize amount of concern and worry. By giving them your sharp attention for a moment, you can "spank them and put them to bed," and then go far beyond them to give your freed attention to the realest, deepest concerns of your inner self. Only in this way are you likely to have the undi-vided attention absolutely necessary to pursue your real desire, which, in advanced prayer, is to find your Be-loved. There are times when a person's preparation will be-gin with a current problem and end with a current problem. Finel If that is as far as he can get, he has dis-covered that the concern is grave enough to require his prayer time. He can now make his concern his prayer instead of letting it be a distraction--which it certainly would have been if even his full attention cannot put it to rest. I believe many of our worries and concerns continue to plague us only because we never dearly and definitively bring them to our own attention, resolve to do what we can about them, and then commit them to God. We neither focus our minds on the problems nor free ourselves of the problems, and so they continue to wear away both us and our prayer. This approach will gradually eliminate our parasitic worries and cause our other concerns to fall into per-spective and subside. When the surface calms, we will begin to be able to look into our depths and to see clearly once again our realest longings and desires and concerns. Then and only then can we make them the part of our prayer and our lives that they deserve to be. We have triumphed over the distractions, decoys, and red herrings. We are on the way to finding our true selves. It is difficult for a man to find himself, especially in the beginning. It takes courage to seek out what we are. It takes industry to reject the laziness of rote. It takes energy to think and probe. None of us want to use method, but some are really too lazy or too insecure to do anything else. Yet it is only by entering deeply, per-sonally, subjectively into prayer, and engaging in a genuine personal relationship with Jesus that we can avoid reducing prayer to a mere surface phenomenon incapable of producing fire in mind and heart, and so incapable of catalyzing that inner renewal of mind and heart which the Gospels call raetanoia. Let me quote what the great psychiatrist Karl Jung has to say about the failure to adopt an in-depth approach to Christian-ity: The demand made by lmitatio Christi, i.e., to follow the ideal and seek to become like it, should have the resuIt of developing and exalting the inner man. In actual fact, however, the ideal has been turned by superficial and mechanical-minded believers into an object of worship external to them, an out-ward show which, precisely because of the veneration accorded it, cannot reach down into the depths of the psyche and trans-form it into a wholeness harmonising with that ideal. Accord-ingly the .divine mediator stands outside as an image, while man remains fragmentary and untouched in the deepest part of him. Christ can indeed be imitated to the point of stigmati-zation without the imitator's even remotely approaching the ideal or heeding its meaning; the point here is not a mere imitation that leaves a man unchanged and makes him into an artifact--it is rather a matter of realizing the ideal on one's own account (Deo concedente) in the sphere of one's individual life? The cowards who fear entering into themselves or into ~C. G. Jung, Psychological Reflections, ed. by Jolande Jacobi (New York: 1961), p. 279. 4- Method in Prayer VOLUME 29, 1970 349 4. 4. 4. H. F. Smith, $.]. REVIEW FOR RELIGIOUS 350 Christ will never make real progress in prayer or salva-tion: "But the legacy for cowards., is the second death in the lake of sulphur" (Rev 21:8). It is much easier to fall into some one else's thought pattern than to plough my own way into the future through the use of my own personality, my own initia-tive, my own efforts to think. It is much easier to use someone else's points for meditation than to generate my own. The sad thing is that unless I choose my own sub-ject for meditation and formulate my own points, I will journey in some one else's direction, not my own. I will enter into his thoughts, not mine. I will enter into his self-discovery, and not necessarily discover myself. When we want objective truth, we must go the Church and to all wise men. But when it is a matter of legitimate per-sonal concerns and paths to happiness, there is no sub-stitute for one's own inner voice. The Book of Sirach has some telling words on the point: Finally, stick to the advice your own hear~gives you, no one can be truer to you than that; since a man's own soul often forewarns him better than seven watckmen perched on a watchtower. And besides all this beg the Most High to guide your steps in the truth (37:13, 17, 14, 18). Unlike extrinsic assistance, self-made points hold real promise of self-transformation. The man who makes his own points is most likely to find the way. down into his inner depths and unleash the white hot magma of love and desire that will then break forth into the conscious world of affection and action for Christ. Each of us is best able himself to find and tap his own potential en-ergies. The thoughts that go into making points constitute not only a discovery but a personal experience, and there is no substitute for personal experience. I must begin with what are really my questions and my yearn-ings if the answers experienced are to move me deeply enough to change me into the likeness of Christ. No one else can experience for me, and no one can fully com-municate to me his experience. Let Karl Jung address himself to this felt need for one's own experience of profound realities: The best cannot be told., and the second best does not strike home. One must be able to let things happen. I have learned from the East what is ,,meant by the phrase Wu wei: namely, "not doing, letting be,' which is quite different from doing nothing. Some Occidentals, also, have known what this not-doing means; for instance, Meister Eckhart, who speaks of sich lassen, "to let oneself be." The region of darkness into which one falls is not empty; it is the "lavishing mother': of Lao-tzu, the "images" and the "seed." When the surface has been cleared, things can grow out of the depths. People always suppose they have lost their way when they come up against the depths of experience. But if they do not know how to go on, the only answer, the only advice, that makes any sense is "Wait for what the unconscious has to say about the situation." A way is only the way when one finds it and follows it oneself. There is no general prescription for "how one should do it." 8 There is still another compelling reason for each of us to make his own points. Unless we do we not only may fail to open a fissure through which the flaming energies of our inner life can emerge to become the vital force of our prayer, but we also refuse to open our inner life deliberately and consciously to God, and to ourselves in His presence, so that we can deal with the contingencies which this self-knowledge will certainly give rise to and so that we. can expose the paleness and sickness we will find there to His healing light and care. We are afraid and ashamed to expose burselves even to God, though He alone can heal us. We are also afraid to discover God in our own depths, for fear of the claims He will make on us and the changes He will demand. Jung has clearly discerned the widespread fear of these inner realities. He has found it in high places where it ought not exist: If "the theologian really believes in the almighty power of God on the one hand and in the validity of dogma on the other, why then does he not trust God to speak in the soul? Why this fear of psychology? Or is, in complete contradiction to dogma, the soul itself a hell from which only demons gibber? Even if this were really so it would not be any the less con-vincing; for as we all know, the horrified perception of the reality of evil has led to at least as many conversions as the ex-perience of good.' How can we make any progress in prayer unless we expose Our inner life naked to both God and ourselves? How can we be fully human unless we admit to our-selves that the furnace of our psychic life is full of the raw energies that can be fashioned into" every human desire and every exalted and perverted action that has ever come out of a human being? How can w~ be-fully human without knowing what we can become, or with-out asking God to help us avoid what we might become and to become what we ought? Until we know ourselves rather fully, how can we be deep, or fully unified, or recollected, or ourselves, or facing reality, or communi-cating ourselves whole and entire to God and to man? It is clear to a student of comparative religions like Professor Mircea Eliade that man both loves God and fears Him. Man wants to run to God and run away from Him. Man's psychic life is an amorphous thing. Subcon-scious currents run in contrary directions. A man can both love God and hate Him, cherish Him and resent 8 Jung, Psychological Reflections, p. 28~. ' Jung, Psychological Reflections, p. 522. Method ~ Pr~r VOLUME 2% 1970 ÷ ÷ ÷ H. F. Smith, $.]. REVIEW FOR RELIGIOUS Him. Leonard Bernstein's symphony Kaddish vividly portrays this malestrom of emotions which we hide in the subconscious because we think it would be blasphemous to let this raw magma break through and rush up into the open daylight of consciousness. Yet where else can it be tamed and channeled? Where else but in daylight and the open air of exposure to God's grace can it cool and harden and thereafter remain, like the granite and the basalt of the earth, as the memory of the ancient volcano of our revolt, and of God's understanding for-giveness and loving conquest over the self-destructive contradictions rending our own inner selves? There are nuns who need a psychiatrist to tell them they would like to have children; there are nuns and priests who leave the religious life when they discover they have desires for marriage. These people have lived a life divorced from their own souls. Every healthy nun knows she would like a husband and children, and every normal priest knows he would like to marry. That is, they know they share with every human nature these intense longings and powerful drives. No priest or nun is called to suppress these longings by trying to pretend they do not exist. They are rather called to control these drives and consciously forego the joy of their fulfillment for the sake of pursuing their higher, virginal love and service of Christ and the Church.~ The practice of daily communing with our own deep-est selves to make our own points for meditation will help us to keep posted on all these powerful and dan-gerous currents within us. Suppression of awareness permits dangerous psychic pressures to mount, but these vents into consciousness will have the opposite effect. The foul gases of cold or hateful or resentful feelings toward God, can escape, giving us opportunity to feel ashamed, and apologize, and be cleansed and healed. Experienced meditators should be able to make their own points without difficulty, after practicing for two or three weeks. Once they have discovered what it can do for them, nothing will prevent them from continuing except neglect or laziness. These confident statements presuppose that the persons addressed are doing daily spiritual reading, especially of the Scriptures. They pre-suppose a broad knowledge of Scripture and the memory of hundreds of favorite passages which come to mind spontaneously when they are germane to the thoughts of the meditation. I do not believe those who lack a broad knowledge of Scripture can use this method. Healthy Christian prayer hardly seems possible without the knowledge of Scripture wherein God teaches us to pray. Only two people know what I ought to pray about here and now: God and myself. In fact, I reduce that to one. God knows, and I have to find out. That is what I ought to do each night. That is the project of making points. By starting with myself I am most likely to be able to find out. It is also there, in my deepest recesses, that ! am most likely to find God. And only if I find Him will I be truly at prayer, which is not thinking, but communication and communion. Prayer is a work of two. We come now to consider the actual making of the points. As I set about making points, I should be con-sciously guided by two master facts. The first is the stage of prayer I have reached, and the second is my frame of ~nind at the moment. Often these two concerns are in conflict, and one of the purposes the points serve is to resolve this conflict. Master fact one. In slightly advanced states of prayer the meditator is often ruled by the desire to find God in prayer. He no longer wants to reflect on spiritual truths or current events in his life. He wants God's company. Furthermore, he is plagued by an inability to meditate any longer. The reasons for this are taken up in treatises on the stages of prayer.5 Master fact two. The meditator's frame of mind is, for instance, troubled by an event of the day and he wants to think about it. These two desires are in conflict. Unless he resolves the conflict before trying to meditate, he is likely to drift back and forth between the two concerns, not knowing which is the prayer and which the distraction. I would like to give an example of a set of points made in this state of conflict. I am in a stage of prayer in whick I habitually want to find God. At the same time I am concerned about my health. Apparently I have done what I can t:or it, but still I am concerned about it. During the last two or three days, the worry has in-truded itself into my prayer. For the subject of medita-tion I choose: The Divine Physician. The scene to oc-cupy my imagination: ]esus putting clay on the blind man's eyek. I ask the grace: To put myself in the care of the Divine Physician. I now think about the subject for a moment (instinctively guided by the two master facts listed above), and reflectively expand it into three points. FIRST POINT: The God-man, the true Physi-cian. SECOND POINT: I put myself completely in Your care, Divine Healer. THIRD POINT: Lord, now that I am Your concern, You can be my concern. I now choose some phrase which in one or a few words cap- Again I refer to Belorgey, The Practice. Method in Prayer REVIEW FOR RELIGIOUS H. F. Smith, $.]. REVIEW FOR RELIGIOUS tures the essence of the meditation. I call it the SPIR-ITUAL CAPSULE: Divine Physician, come! Something very important has transpired here. This simple preparation, which in practice might take me no more than a couple of minutes, was actually a miniature meditation. In this preparation-meditation I have ended my concern by deliberately turning it over ~to Christ. I did that in the second point. At that point I eliminated the conflict and left myself free to pray about my deep-est concerns. That fact is crystalized in the third point, where my attention is focused on the Lord, and I have actually already begun my interchange of affection with Him. In this mini-meditation I have disposed myself for the p.rayer of the presence of God by giving my current concern the momentary attention it needed, which was all the attention it deserves. This telescoping of a medi-tation which might formerly have taken an hour to get the same results into a minute or two is characteristic of persons who have reached more contemplative states of prayer. It proceeds intuitively and almost instantane-ously. It is also characteristi~ of contemplative states of prayer that meditation is displaced from prayer time and is skillfully and spontaneously carried on at odd moments during the day, and at the time of prepara-tion for prayer. Prayer preparation is, in contemplative states, a time to run quickly through meditative mat-ters and then put them aside, and thus put the soul in peace for contemplation. Let us now take the example of a set of points which a man might make while he is in the stage of the prayer of faith, on a quiet day when nothing is troubling him. The master fact governing his choice is his yearning for non-verbal communication with God: SUBJECT Resting with You by faith. SCENE Desert, where You invited the Apostles to come and rest with You (Mk 6:31). GRACE To be still and know that You are G~d (Ps 46:10). FIRST POINT "Commune with your hearts on your beds and be Silent" (Ps 4:4). SECOND POINT "Peace, be stilll" (Mk 4:39). THIRD POINT You lead me beside still waters, You restore my soul (Ps 23:3). SPIRITUAL CAPSULE God There are a number of useful things to be noted in this example. The meditator is addressing God even in the course of preparing points. He sees no sense in talk-ing about God in third person when l~e can address Him directly. Further, he loves to address God and have God address him in God's own words taken from Scrip-ture. And he has culled from Scripture and put down from memory passages he has recently memorised in the course of his Scriptural reading because they aptly de-scribe and Scripturally vouch for the authenticity of his current form of prayer. Finally, he summarizes his whole meditation in one word, knowing that even one word is too many to use in this stage of prayer. A man in the prayer of faith or beyond may make points similar to this most days for months at a time-- or even ~ears. He makes fresh points each day, because there is always a different nuance it is important to ex-press, but the essence remains un.varying. He is in com-munion with God on a deep level little affected by the transient times and tides of each day. The two examples given make it evident that I pro-pose a standard framework to contain the meditation. I call it the spiritual filing cabinet. It is the format made familiar by St. Ignatius. The advantage is that of any filing cabinet. It makes it easy for me to remember and sort out my thoughts each day, since I never vary. the cabinet but only the contents. I write down the medita-tion each night, but just before falling to sleep I can easily recall it from memory because of the standardized framework. On evenings when the preparation is fully successful, I will have disposed of all other concerns by the time I reach the third point, and there be swept up into the presence of God, where I hope to remain until after the hour of prayer the next morning. In that case, I will not recall the points when I compose myself for sleep. The points have eliminated themselves by pro-jecting me beyond them. They have proved their power to be selpeliminating. Let us take an example of a third mood, which is a composite of the two preceding moods, and see the points that come out of it. Personally, the meditator would like to spend his prayer time simply dwelling with God, but he feels he ought to bring the whole world into his meditation. To which of these conflict-ing desires is he really being called by ~race? The an-swer is that if he is in a contemplative stage of prayer such as the prayer of faith, the presumption must be in its favor until experience gives contrary evidence. After all, arrival at such a prayer is a personal invitation from God to come apart and rest awhile. Furthermore, by his contemplation the person is disposing himself to be God's servant to the world. Still, in preparing his medi-tation, the meditator may be able to synthesize the two diverse thrusts of his desire: SUBJECT The God of concern for the world SCENE The God of the world is within me, who am part of the world GRACE To be one with You in Your labors for men, my God and their God FIR, ST POINT 0 God of all origins, Father ingeneratet + + + Method in Prayer VOLUME 29, 1970 + 4. 4. H. F. Smith, S.]. REVIEW FOR RELIGIOUS 356 SECOND POINT 0 God to the world, Incarnate God-Sonl THIRD POINT 0 God to the world-in-process of being reborn, Holy Spirit with usl SPIRITUAL CAPSULE Com~, Lord Jesus! In this meditation the meditator has succeeded in gain-ing a synoptic view of God and the world, thereby rec-onciling the seemingly opposed desires of his state of mind. Whatever direction his meditation takes in the morning, it should be able to take it without distraction from unreconciled contraries. Sometimes, when there are a few extra minutes avail-able, it is useful to jot down a few sub-ideas under one or more of the three points. Under the first point of the sample meditation just given, one might jot: You are the Father who has instructed us: "Be fruitful and mul-tiply; fill the earth and subdue it. Have dominion." Under the second he might jot the words of Jesus: "Fear not, I have overcome the world," and "I have come that they may have life and have it more abundantly." Years ago, I used to find this helpful, but now I generally find that it only clutters up the meditation and interferes with the simple contemplative gaze the preparation helps me to achieve. Anyone willing to experiment with this method for eliminating method may discover to his joy that while he used to wander to and fro from one book to another looking for something to help him meditate, he now easily discovers what he wants. When he asks: "What do I want to pray about, Lord?" the subject readily comes to mind: The quiet of being with You. "What scene to quiet my imagination?" John leaning on Your breast. What grace? To renew my knowledge of what it means to be with You. Point One: Resting here with You. Point Two: Listening in my heart to what You say. Point Three: Returning the love. Spiritual Capsule: I to You, and, to me, You whom my heart loves. In all of this, I have begun with something even more personal than Scripture. I have consulted God and my-self, and from there gone on to use Scripture, as God's means of communicating with me and I with Him. Slowly I formulate what God and I are to one another at the moment. I find God, and, as best I can, remain with Him until the time of formal prayer the next morn-ing. The Praying Itself If I am to pray in the early morning, the time to begin praying is the moment I awake. If, on awaking, I am in the presence of God, I make no attempt to recall my points. I simply remain with Him. When I come to the formal time for prayer, I do not use my points. Points are not lor use. I abide with God. I pray con-templatively, in a form of non-verbal communication represented by the names, prayer oI faith, prayer ol quiet, and so forth. Of course, this method does not produce such a state of prayer. It only facilitates it for those who have attained to it. Often, it is only by turning away from thoughts of God that we can turn to God, for no thought can con-tain Him, but a thought can distract us from Him. One nun to whom I had communicated these reflections wrote me: I've read a little over half of the Ascent to Mount Carmel. I like John. He is very gentle, thoughtful, and humble. 250 pages of how to do nothing in prayer. You sai,d, it in one sen-tence: "Don't think about God; think God.' I understand that all this background is essential, though, especially since I have not yet learned how to do nothing. This self-eliminating method can help us to bank the flies of our own recollection until it reaches the in-candescence of the prayer of the presence of God. The method is for those who have found and want to hold on to the prayer of communication, communion, and union with God. It is for those quiet enough to hear the call to this prayer, and courageous enough to take the solitary path to their meeting alone with God. The points are designed for self-elimination, but they are also meant to serve as an emergency auxiliary. They are supposed to put us into the orbit of our normal prayer, but they are also' supposed to rescue us if we fall out of it. Should I be unsuccessful in finding God when I awake in the morning, I recall my points and mentally run through them. I center my recollection around them until the time for formal prayer. On coming to prayer, I put aside my points and make another attempt to find God without thoughts or words. If I do not succeed, I resort to my points once again, ' since I have put into them the matters which mean most to me at the mo-ment. They should help me to pray the prayer of sim-plicity, or the prayer of affection, or at least to do some meditating. If not, I will have to turn to some other alternative, such as meditative reading of the Scripture, but only as a good spiritual director, or a reliable book on the stages of prayer, advises.n Sometimes when we attempt to prepare our own points, we will find we are devoid of every thought. We have no choice but to resort to some one else's points. Or do we? That is the time to turn to past sets of our own o In advanced states, it is not easy to know whether we are praying successfully or wasting our time. See, once again, Belorgey, The Practice, or the works of St. Teresa of Avila, St. John of the Cross, and others. + + + Method in Prayer VOLUME 2% 1970 357 Sm~t~o S./. RELIGIOUS 358 points, prepared out of our own heads in .richer seasons, and stored up for barren days. At times when I have felt repelled by the thought of any book and unable to prepare a meditation of my own, I have frequently re-sorted to stores of my own points. Almost always two or three sets will guide me into prayer and. recollection within minutes. Once again I am experiencing the grace I received in the day and hour I first used those particu-lar points. Roads we have used to God in the past often remain viable if we can locate them again. We should return often to the sites where He has visited us in the past. This method of preparing points is very useful even for those in earlier stages of prayer, but for them the preparation will not be self-eliminating. They will of necessity take their self-prepared material into the prayer and use it to feed their meditation. They will enjoy most of the benefits of this highly personalized and creative method of prayer. For them too it minimizes method, reduces foreign elements in their prayer to a minimum, and guides them to personal discovery of Christ. When beginners use this method of making points, it will have to be modified somewhat. O[ten, they will not be able to prepare points out of their heads. What they can do is take a Gospel event, analyze it, and put it.into the spiritual filing cabinet according to their own bent. Under each point they should jot down personal ideas and experiences relating to the Scriptural themes. If no personal ideas come, they can be trained to use the ref-erences to related passages such as the Jerusalem Bible gives in such abundance. Looking up these related pas-sages and jotting them down as sub-points will help deepen their understanding of Scripture and develop their power to meditate. They should take about fifteen minutes to prepare points in the beginning. Before long they will show more deftness and originality in use of the method. I taught this method to a group of young sisters with assurance that it would work. Not long after, one of them wrote me: You know, Father, at first when you told us about using our "spiritual capsule" before bedtime and that in time we would awaken at night and find ourselveg" talking to God, I felt it would be years until that could ever happen to me. But it has happenedl Post-Prayer Activity We ought to record worthwhile insights, experiences, and meetings with God in prayer. Reading them over some time later can be the best fuel for future points. As already indicated, we should store up successful self-made points. It is practicable to make points each day in a small note book, dating each day as we go along. When we want to make a post-prayer reflection in writing, put it in the same place. In the future when our mood is such that we want to return to some explicit past meditation, we will be able to find it with ease and benefit by it again. This method for eliminating method in prayer has been well tested and proven. It requires some trouble on our part, but it eliminates a lot more trouble than it takes. It is a method with a high yield. For surely he is going to make the most progress in his search for God who starts not from some one else's starting point but from his own. + + + VOLUME 29, 1970 DOM JOHN MAIN, O.S.B. V ew Dora Johu Main, O.S.B., a monk of Ealing, is presently living at St. An-selm's Abbey in Washington, D.C. 20017. REVIEW FOR RELIGIOUS Once upon a time a small boy and his old uncle were out for a walk in their city. It was a large city and had in it all sorts of wonderful modern buildings and wonderful modern people. It was called Secular City and was beautifully situated in a deep valley with spectacular high mountains rising up all around it. The small boy and his uncle had strayed into an older part of the city, and the boy was very surprised when they came upon a large building in a ruinous condi-tion. This was an altogether unusual sight in the modern city, and the small boy was upset by it. He thought how marvelous the ruins must have looked in their day. Pointing to the ruin, one feature of which seemed to have been a very high tower, he asked his uncle what this ugly eyesore was doing here. The old uncle sighed; he hated his young nephew to see anything that was ugly. "Well," he started, "I can remember that building well. It was very fine in its day, with a great high tower which reached way up above Secular City. They said that the view from the tower was absolutely stupendous." "But how on earth did it become such a ruin?" asked the small boy, looking now with an even greater interest at the noble ruins. "Well, you see," the uncle started, "a rather special group used to live there. They really did a great job for the whole community in rather a strange sort of way. You see in our Secular City we are stir-rounded by mountains and, as a result, we tend to get rather closed in on ourselves. It's rather difficult to ex-plain, but we tend to think of everything in terms of Secular City. Well, the group that lived there built a large and very high tower--to see the wonderful view; and in some strange way this view of theirs seemed to add a new dimension to the life of the group that made them rather special people in Secular City." The boy listened to this explanation with great at-tention. He wondered how a view could have so changed a group. Turning his innocent face to his uncle, he asked, "How do you mean--special people? Did the view make them a bit odd?" "I suppose it did in a way," the uncle replied, try-ing to recall the group to his mind. "We could never quite understand why they were so concerned to pro-vide schools and hospitals, orphanages and old people's homes. We just accepted the fact that somehow or other the view was at the back of it all." He thought very quietly to himself and added: "Anyone who needed help seemed to become the concern of the group. It all happened a long time ago, and I can'( remember too. well now; but it seemed that they brought all their talents together and used them wherever there were people in need." The uncle had not thought of these things for a long time. It was the dedication of the group that now struck him as the hallmark of their work. He wondered, to himself how he had been so lacking in curiosity about the view when the group had been such a creative force in the city. The little boy now looked really puzzled. "Well, what happened," he asked, "How did it all become a ruin? Did some tyrant come' and run them out of town?" "You remember me telling you about the tower, and how hard it was to climb to the top," the uncle went on. "Well, it appears that over the years, the staircase that went up to the top got rather old and worn out-- I think there was woodworm or maybe dry rot--and the group decided that they would have to rebuild it. And that was when all the trouble started. Some of the group just wanted to repair the staircase, but others said that was no good because the dry rot, or maybe it was woodworm, ~vould just affect the new wood. Then someone who was really very modern got the idea of pulling down the staircase and putting in an elevator. The trouble with this idea was that they couldn't get the elevator shaft in without pulling down the staircase, and that's when the trouble really started. In the old days, you see, there had always been some of the group either at the top of the stairs looking at tile view, or. some of them on the way up to encourage the others. I'm not too sure about this, but I think it was.rumored that even before all the discussions started, there. weren't quite so many climbing so high up the tower. I think I remember it being said that the group spent a lot of time looking after all .their plant and not quite so much time getting up to the view. In any case, they all seemed to agree that the stairs had to be rebuilt. But, when this argument started, they all got so involved in the discussion about the elevator, that ÷ ÷. ÷ VOLUME 29 1970 361 ~ ÷ ÷ + Dom John Main REVIEW FOR RELIGIOUS 362 they all began to come down to join one of the com-missions they set up." "What's a commission?" the small boy asked, looking rather puzzled. The old uncle tried to look very wise. "A commis-sion," he faltered, "was a part of the group set up to examine some particular problem. They usually passed out questionnaires which everybody had to fill in, and these suggested new questions and more questionnaires. I never really understood the process---but I believe it was quite essential." The little boy did not seem to be paying much atten-tion to this; and, turning his perplexed face to his uncle, he pondered: "But was anyone trying to keep going up the tower to see the view while those com-missions met?" He was only a small boy, but it seemed to him that if the view had been so important in the past it might even inspire the work of the commissions. "I suppose some were," replied the old uncle, "but then they all seemed to get nervous about the founda-tions." "The foundations," replied the small boy, now look-ing at his old uncle with something like incredulity. "Yes," went on the uncle. "You see, after a while the discussions shifted from the question of the elevator or the stairs to another more fundamental matter, namely, would the foundations really support any new structure at all?" "Well, if they supported the old one, why shouldn't they support the new one?" asked the small boy. "And, anyway, what about the view? Didn't anyone even want to risk trying to get up to see the view?" "The problem was," explained the uncle, "that the old structure had really become very rickety by this time. The group was finding that the stairs just wouldn't carry them up anymore. And the foundations, this was quite a problem. But perhaps more serious was another thing. You remember me telling you that in our Secular City we get rather inward looking--strange to say this way of thinking now began to affect the group. In the old days they had brought quite a new dimension 'to the city, but now somehow or another they became like the rest of the people around them in the city." The boy now looked very serious indeed. "They should have tried to keep contact with that view," he said his face had become very determined and set. "I don't think we should be too hard on them," replied his uncle; "it was a difficult problem to know how to renew those stairs." But even as he was saying this, at a deep level he shared his nephew's regret. "But what happened?" urged the small boy. "Did the commission ever come up with a solution?" In spite of his black looks of a moment ago, his innocence forced him to believe that there must be a solution. The old uncle tried to remember. "I just can't re-call," he said. "There used to be a lot of talk about the group but then people seemed to forget about them." It was getting late and they had to be going home, but the small boy wanted to take a closer look at the ruin. They walked over and both looked at one an-other in surprise. There seemed to be sounds coming from the basement--was someone working at the foundation? But, it was time to go. "I wonder what that view was really like?" mused the small boy, looking up at the great ruined tower. ÷ + ÷ VOLUME 29, !970 EUGENE C. AHNER, S.V.D. Toward a Renewed Life in Communi Eugene C. Ah-her, SN.D., is the dean of men at the S.V.D. Major Sem-inary; 4000 13th St.; Washington, D.C. 20017. REVIEW FOR RELIGIOUS There was a lawyer who to disconcert him stood up and said to him, "Master, what must I do to inherit eternal life?" He said to him, "What is written in the law? What do you read there?" He replied, "You must love the Lord your God with all your heart, with all your soul, with all your s~rength and with all your mind and your neighbor as yourself.' "You have answered right" said Jesus; "do this and lif.e is yours" (Lk 10:25-8). At this level we all find ourselves in agreement. The purpose of our lives, the goal of our struggle as human beings, as Christians, as priests or religious, is the love of God and neighbor. Here we all celebrate together and find ourselves in familiar company whether we are young or old, liberal or conservative, particularly pious or not. In fact, if we really pressed the issue we would find there are very few, if any, who are against love. After all, everyone wants love, truth, peace, brotherhood. However, as we go one step further and begin to ask what is real love anyway and how does one respond in the face of non-love, of hate, deception, and fear, the whole harmonious scene changes. What seems so simple and clear immediately becomes immensely complex and confused. Conflicting attitudes, opposing groups, and divergent ideas splinter in all directions. And we find ourselves in agreement with Qoheleth as he says: "I find that God made man simple; man's complex problems are of his own devising" (Eccl 7:29-30). The real problem, then, is not who wants love and truth and goodness, but how do we live in the face of evil. For, in each of us and in the world about us, there are not only the elements of life and growth but also the seeds of death and destruction. And while we may be quite sensitive to and indignant about the evil out-side of us, we are fearfully reluctant to look directly, clearly, and without dodging or panicking at the evil inside our own hearts. And yet, unless we are in touch with ourselves as we truly are and with our brother as he truly is, talk of love is futile. For the sad fact is that what then goes for love is rather an exercise in self-protection or self-aggrandizement at the expense of both myself and my brother. The gxeat task before each man, then, is really the human task. The fundamental point of religious life is common to all: to find oneself; to find one's brother; to find God. For, unless we are in touch with this funda-merit of reality we cannot walk the way of love. This discovery of our own true dimensions, tlie experience of our human situation, is a prelude to a life of love. And yet the one thing we attempt to avoid is knowing our-selves as we truly are--to enter into the wasteland of our own heart and discover there the dimensions of the sinner as well as the saint, the evil as well as the good, the love of death as well as the love of life. We are ca-pable of hate as we are of love, of anger as we are of af-fection, of the irrational as of the rational. No doubt the religious and monastic thing has always intended to bring a man in touch with himself as tie truly is--the long hours of aloneness, of fasting, of re-flection, of self-accusation, of spiritual direction. How-ever, there is no need to prove that the intended results have not kept pace with the practices and that, to the contrary, there are enough instances of these practices actually being used in such a way as to support and contribute to the dream world of self-deception and of the flight from the reality of oneself and one's neighbor. In fact, we might even wonder whether some of our more recent theologizing and liturgical celebration are not weakened by this very sort of glibness and superficial-ity with which it slides over the problem of evil and death. This can only lead to a kind of astonishment and perhaps eventual disillusionment when the repetition of the words love, community, hope, and life do not really seem to overcome hate, isolation, despair, and death be-cause they have never really met each other seriously and head-on. Each set of experiences is kept separate from the other because deep in our hearts we are not so very sure that love can really overcome fear and that truth is really stronger than pretense. The world of the kingdom, of truth, and of love is expressed and cele-brated loudly and clearly but in an uprooted and imag-inary world of its own. The world of sin and of death is kept apart, quiet and repressed deep inside the heart unknown even to the heart itself. Jeremiah says: "The heart is more devious than any other thing, perverse too; who can pierce its secret?" (Jer 17:9) And it is here in the unfathomable depths of the heart that the human ego keeps itself. + ÷ Toward Renewed VOLUME 29, 1970 365 ÷ ÷ ÷ E. ~. Abner, $.V.D. REVIEW FOR RELIGIOUS 366 The difficulty of honestly facing our fear and the de-viousness of our own hearts has led us to many disguises and subterfuges to avoid the kind of confrontation that brings to light what is now in darkness. More by way of example than by exhaustive analysis, I would like to list three common ways we avoid the reality of who we are. Repression We are all acquainted with the small child who, in wanting to hide from someone, simply covers his own eyes. And so, not able to see the other, he feels well hid-den and secure. We smile at the naiveness of the child but what is innocent enough at that level becomes dev-astat! ng for adults who continue to deal with reality in this way. The easiest way of dealing with the unpleas-ant is to act as if it were not there. Somehow, by ig-noring it, it will go away. If our feelings run counter to what we are expected to feel, to think, or to do, the quickest way of dealing with the situation is to ignore or repress the feelings. If our feelings are so strong that we don't know what they might lead to, the safest thing is to repress them. Concretely, if I have sexual feelings or fantasies for someone of the same or opposite sex and for whatever reason feel that I shouldn't, I will tend to act as if they are not there. If I feel so angry inside that I am afraid that I will lose control and really hurt someone, I will try to play it safe and keep all feelings well under control. If I feel tender or affection-ate but consider such feelings unmanly, I will hide them. But the sad fact is that we cannot exercise such selec-tive repression. Before long we find that we do not know how we feel anymore and soon we discover that we no longer consciously feel anything at all. The price of re-pressing unwanted feelings is the numbing of all feelings. But deep inside there is a lump and we are depressed or forever anxious. And so we walk about like hollow peo-ple, not obviously angry or unkind but not able to love or feel deeply for anyone either. It becomes too dangerous to let go of any feeling because something else might come up that we cannot handle. But even that might not be too high a price to pay for external control. The fact is though that nothing is simply repressed without making itself felt somehow or somewhere--which brings us to our second ploy. Transference Everything that has made up our life leaves its mark and calls for its share of recognition. And if we are un-willing or unable to face the feelings that arise directly from the situation, we will have to face them in some other area that has no direct relation to the original feeling. Almost classic now is the understanding that masturbation, for example, is not simply a sexual prob-lem but a release of anger, frustration, feelings of in-adequacy and overdependency, that are not being met at the level where the issues really are. Another broad area of transference is the focus of all one's interests and energy on the great battle of evil out-side of ourselves. Especially today at a time of such far-reaching change and critical reevaluation there is no lack of evils to attack or causes to be advanced. All of which is fine and to be commended provided that it is not merely a front for avoiding the evil inside of our-selves. The real problem is that whatever evil exists around us also has basic roots and affinities inside of us. So, unless we have faced the evil within, our attempts to deal with it outside will be more a case of evil meet-ing evil, violence opposed to violence, lust opposed to lust, totalitarianism opposed to totalitarianism. And the end result will be ambiguity, hostility, restlessness, and the alienation of feeling. The present day religious community in transition is an excellent breeding ground for this kind of malaise. It becomes so much easier to fight the corruption in institutions and structures than in ourselves. And the sad fact is that there is so much that needs to be renewed but the one who is vigorously tear-ing down structures does not even realize that he is pri-marily fighting something in himself. Intellectualism This is an occupational hazard of any academic or student community. It is rooted in the realization that whatever can be understood can also be controlled. Therefore, if we intellectualize our whole life, our feel-ings and relationships as well, we can always be in con-trol. And as long as we maintain control, no one can get too dose to us, no one will be able to hurt us. manipulate persons and relationships, often unknow-ingly, in order to keep them at a distance and so pick and choose what is safe and what we can master. It means, of course, that all spontaneity must be censored and no feelings may overstep our present intellectual understanding. Feelings, then, become techniques to use "for effect." Relationships become calculations and the question becomes what should I feel rather than what do I feel. Life becomes a question of control, and lost are the directness and closeness of Christ: anger, fear, tears, and tenderness. And in the end, since the feelings have not been dealt with honestly, they will crop up in some often unsuspecting way and cry out for recognition. + + + Toward Renewed VOLUME 29, 1970 E. C. Abner, $.V.D. REVIEW FOR RELIGIOUS 368 Perhaps it will be one person or one thing that will have to bear in an unreal and overdependent way our total emotional life. These are some of the more common ways we use to protect ourselves from others. But systematically and imperceptibly what we have hidden about ourselves from others also becomes hidden from ourselves. And so we find that we are not only strangers to others but finally also to ourselves. By middle-age most of us are accomplished fugitives not only from others but radi-cally from ourselves, thereby losing touch with the true source of life and renewal and motivation within us. What is it that drives us so far from ourselves and others? What subtle and all-pervasive element in our lives creeps into every aspect of it? What holds us in a closed and guarded defense rather than in an open and loving embrace? We are in fact face to face with fear-- our great fear that if we are known as we truly are we will not be lovable, will not be accepted, but rather that we will be taken advantage of, laughed at, hurt, or ignored. If others really knew that I am not only strong and capable but also weak and afraid, that I not only have desires of love and goodness but also of hate and destructiveness, would I still be loved and accepted or would I be crushed and rejected? I would venture to say that the great feeling of worthlessness so prevalent among people today is a direct result of their fear to be themselves. And we have reason to be afraid because to be our-selves means openness and vulnerability and honesty and confession of weakness. Revealing ourselves might destroy us. And if life is a little flicker between the darkness from which we have come and the darkness to which we will return, then we will do all that we can to grab it and. protect it. And so we proceed to build walls a~ound our weakness, to present only our strengths, to acknowledge only what is good and loving in us and we try to cover over what is weak and evil. We will be careful always to be in control and to have enough "pro-tection" between ourselves and others. And yet the fact is that only when we break through this hard shell can we be truly lovable. Only then can someone know who we are and love us. The very defenses we use not to get hurt are the walls that keep others out and make it ira-possible for another to really love us. And so we end up with the sad paradox that what we want most, to love and to be loved, is the thing we most thwart by our at-tempts to achieve it--through impressing others with being strong, trying to merit another's love by only re-vealing our "best" side. All this despite the experience we also share of actually feeling a greater love rather than less towards someone who may have revealed his own weakness to us. As John says so succinctly: "In love there can be no fear, but fear is driven out by perfect love: because to fear is to expect punishment, and any-one who is afraid is still imperfect in love" (1 Jn 4:18). So the very possibility of love depends on our willing-ness to face weakness and evil as it truly is--in ourselves and in our brother. Love does not solve the problem of evil by eliminating or avoiding it. That is impossible. To attempt a solution of evil by elimination is to believe that evil is only extraneous to man, that were it not for an evil society man could live in love and truth. In this view, evil would be successfully overcome if it could only be eliminated from the society in which man lives. It would be to act as if man were an angel who did not have deep within himself seeds of both good and evil. Rather, the only route open in the face of evil is to suff~r through evil without the loss, the capacity for love. In other words, evil must be transcended, not es-caped from or eliminated, and this cannot be achieved apart from the journey through the lust of one's own hell. So, finally, it is man himself and not evil which is redeemed. Evil, sin, and death will remain but they can be transcended provided that the individual face them in imagination and go beyond them in an act of love that restores the mystery of being and reveals the limit-lessness of man's freedom and responsibility. It is only by personally facing the depths of one's own despair, hate, violence, doubt, nothingness, aloneness that hope and love and redemption and faith are the victories that overcome, transcend the world. We do not face evil by simply committing it because this is in fact to sur-render to it. We do not face it by acting as if it were not a reality inside ourselves because this is mere,escapism to an unreal world which makes any real solution impossible. But rather, we must enter it through the imagination, risk the possibility of doing it, and with this necessary psychic distance, to transcend it. But as we consider these dynamics, are we not face to face with the religious thing, with the task of religious development in a community? A home wher~ I can search out my own heart, to discover the depths ~f the sinner and the saint, and to be accepted and erhbraced in a fraternity of sinners redeemed by Christ's 10ve. A group of persons with whom I can be myself, be open with-out deceit and not stand constantly under the sentence of being ridiculed, ignored, or taken advantage of. A place where the forgiving and creative form of love is operative and allows new possibilities of life to be re-vealed from sin and death. A zone of truth s~here evil will not be run from or ignored but faced ste,hdfastly with + + Toward Renewed Lile VOLUME 29, 1970 369 love. A community where there are honest men seeking for truth and love who are willing and able to accom-pany me in my journey. For this kind of atmosphere will allow an individual to take the fearful plunge and search the darkness of his own heart, to transcend the evil in his own life, and to face clearly the choice of lov.ing or hating, believing or doubting, being honest or hiding, hoping or despairing, living or dying. Is this not really what we should be about in our own life in community? The religious community is not a place to protect a person from himself, from reality, to escape or ignore evil, but rather to open him to the reality of himself and to reality in general. What re-newal has discovered is not a new commandment but the necessity of more penetrating and decisive ways of facing and knowing ourselves totally, good and evil. Only then can we really begin to walk the way of that first and all-inclusive command: "Love God with your whole heart and your neighbor as yourself." 4- 4- E. ~. Ahnt~', $.V.D. REVIEW FOR RELIGIOUS 370 ALAN AMBORN The Helpful,.Lifer It seems to be rather common opinion' that convicts who turn to God are nothing but hypocrites. Nothing could be farther /from the truth. You can read here what rel!gion really means to a prisoner. There are many people who seem to wqnder exactly what part religion can and does play in American prisons today. It is my opinion that it pla~s a very im-portant part, even though people may frequently say: "Isn't it all hypocrisy? Is a convicted felon ,really sincere when he turns to God only after he has b~en found in his crimes?" To that question we can posiibly have as many answers as there are men in prison. It may seem strange but it is nevertheless true that the people who ask such questions are us~ually people who have little, if any, firsthand information about prisons or prison inmates. What little info,rmatlon they have was obtained from reading the newspapers. Only too often such information is scanty and, at times, even misleading. , Suppose we begin with the assumption, that ninety-nine per cent of the men and women res.iding in the penitentiaries are guilty of the crimes for, which they have been sentenced. A large proportion 'of these are first offenders, many of whom have been committed to prison for crimes of omission, accident, or sheer stupid-ity rather than deliberate crimes of cupidity. Further-more, I would say that by far the majority of these are determined that they will never again come in conflict with the law once they have completed their sentences. The point I am trying to make is that among our prison inmates there are those who could possibly be classed as ogres, madmen, or depraved individuals, but they are in the minority. The greater part of our prisoners are peo-ple who have feelings, conscience, and a deep awareness of what they have done to their victims, their loved ones, and to themselves. In a prison, men and women who have been torn from their homes, wives, children, sweethearts, and + + + Alan Amborn 16376 can be writ-ten to at Box 900; Jefferson City, Mis-souri 65101. VOLUME 29, 1970 ÷ ÷ Alan Ambo~n REVIEW FOR RELIGIOUS friends are forced to live an almost completely monastic life. Despite the many humane reforms in our modern penal systems, the average prisoner still undergoes the shock of isolation, the moral shame and degradation that follow his being sentenced. A first offender's initial few months is, generally, a period of shock, humiliation, despair, and above all, one of loneliness beyond descrip-tion. No one, not having experienced that first night when the cell door slams with such frightening finality and the lights go out, could be expected to understand the feel-ings that encompass the now totally miserable individ-ual. Along with the sense of loss come degradation and despair with a special kind of fear--spiritual and moral as well as physical. A person having experienced these feelings could never forget them. A person not having experienced them could never understand exactly what they were. Those first-night horrors can, and do, shake the most calloused lawbreaker to the very core of his being. Is it any wonder, then, that prisoners turn to what should have been their constant solace and comfort but, too often, is their last resort--their God and their Bible? It is the only answer and solution to a problem of pain that can drive the most hardened sophisticate mad. I speak from firsthand, if tragic, experience. I am an inmate of a Midwestern penitentiary. This is not my first prison. Yet, in each I have seen the word of God work wonders when everything else tried had failed. Any man or woman who is not completely amoral has some degree of sensitivity. Convicts are no exception. Even though the State, through legislation, charity, and necessity, provides for the prisoner in regards to his or her material and spiritual wants, there is always one factor that cannot be provided for, and that is the purely private and personal feelings of the individual. From unforgettable personal and bitter experience I know this common factor. Even though the warden of a prison were to offer a sympathetic ear to the inmate, the pris-oner's recent association with the police, the court, judge, and the jury, would have, consciously or uncon-sciously, erected a mental barrier that is, during the first months of imprisonment, not easily scaled. To the average prisoner who is experiencing his first imprison-ment, even the kindly ministrations and gestures of a chaplain, psychologist, or psychiatrist are often rejected and disregarded simply because the prisoner is not in a receptive mood or frame of mind. Very few convicts .are inclined to make officials of any stature their confidants. In the case of the new prisoner's family, the shock and shame emanating from their loved one's conviction and imprisonment is usually so great that they are at a com-plete loss as to what to do toward comforting or en-couraging their father, brother, or son. In a great ma-jority of the cases I have personally observed, the family procrastinates; they do nothing, waiting for the impris-oned man to make the initial move. Any conscientious prison official can tell you how inadvisable this attitude is. It is the usual procedure or custom in most prisons to have the new inmate or "fish" go through a thirty day period of isolation. There are two reasons for this pro-cedure: a hygienic check-up first, and then the period in which the authorities observe the conduct and attitude of the man. The officials, for security purposes, must know the moods, manners, and intentions of their new charges. Is the "fish" mentally or physically sick? Is he antagonistic or dangerous? Will he harm himself or some inmate in his anger and frustration? This period of isolation is by far the worst part of imprisonment for any convict, but especially so for the prison novice. This is the danger point for the emotion-ally distraught and the mentally unbalanced; this is the period where the man, all alone, must separate himself from the world of the living he has "always known, and accept and adjust himself to the frightening new world of the living dead. It can very well be the ebb tide of his life. This is the time when, no matter if he has been lax in his practice of religion, an agnostic or even an atheist, he will, he must, within himself turn to God. He must if he is to survive. For be he Christian or Jew, Muslim or Buddhist, young man or old, every fibre of his body, mind, and spirit will search for someone or something to turn to--someone who is understanding and who will show forgiveness without reservations. And it is inevita-ble that sooner or later he must come to realize that the someone or something that fills all his desperately needed requirements is the Someone who has always been standing by to forgive, forget, and accept. Happy indeed is the individual who brings a Bible to prison with him. Very few prisons provide a newcomer with this precious and cherished book. Many times I have overheard convicts state their desire and need for a Bible. In some prisons the chaplains provide these holy texts out of their own pockets. To my knowledge and experience, though, no American prison voluntarily supplies them to their inmate population. I assume that the reason for this seemingly official attitude is felt to be in keeping with our inherent American principle of freedom of religion, or in this instance, freedom from religion. + ÷ ÷ TI~ l:leIplul Liter VOLUME 29, ~.970 4, 4, Alan Ambo~n REVIEW FOR RELIGIOUS :374 Again drawing from personal experience, I know just how fertile a field for converts prisons are. Much has been written about our jails and prisons being breeding places for more crime, moral deterioration, and physical perversion. This, too often, is the case. Men who are lonely, devoid of hope, ambition, and initiative are easily led. The professional criminal and perennial jailbird are too often the leaders. These emotional and moral misfits know only one path to take. If a man can-not find the comfort and solace he desperately needs in this crisis of his life from friends and family, he will seek these two important factors in one of two places: with his equally despondent, lonesome, and lost fellow-convicts, or in his God. And there are infinitely more convicts in prisons than there are messengers of the Lord. Peace of mind and acceptance of God's will are even more important in an imprisoned man's life than it is in a free man's. For, having broken both God's as well as man's laws, the prisoner is usually weighted down with a double sense of guilt and remorse. And many times I have seen the moral and spiritual rebirth of an individ-ual brought about by his reintroduction to his Maker through the Bible. I was born of God-loving Roman Catholic parents. In our home, belief and respect for God were made part of our daily lives. Furthermore, He was a most essential part. I was sent to parochial and higher schools and, as a result, was well versed in the fundamentals of my faith. It was only after I stupidly and callously began to disregard the teachings and tenets of my faith that I began to ruin my life, and even worse, the lives of those who loved, believed, and trusted me. That, to me, is the greatest tragedy of the man in prison--those he left on the outside. Like so many of my ilk, stewing in bitterness and shame, I gave little thought to God during my first years of imprisonment, particularly after I was no longer a "fish." I turned completely deaf ears to the overtures of the prison chaplain and to well-intentioned state of-ficials. My attitude was one of "these state officials put me in here and now they are trying to persuade me that they want to help me; how stupid do they think I am?" That's a question I often ask myself these days. I know now how stupid this line of destructive thinking is, but I didn't in those earlier days. I know, too, that this is the line of thought that most new inmates take. Out of sheer boredom and because it afforded me an opportunity to get out of my cell for an hour, I attended a few church services. But if I actually thought of God at all, it was to blame Him for having failed me--never my having failed Him. That should give you an idea of how stupid a man in prison can be. That old clichd of "misery loves company" really gets a workout in prison. I recall vividly some of the discussions I had with fellow-convicts during my first days in the "joint." Few, if any, were ever in a construc-tive vein. They were almost always filled with bitterness and recriminations; not directed at ourselves where they rightfully belonged, but at our captors, our wardens, and even at our families and friends. As for me, per-sonally, I was the epitome of bitterness, frustration, and hopelessness. Through my own stupidity and cupidity I had lost my family and friends (so I thought at the time), and instead of doing anything constructive about regaining these lost loved ones, I submerged myself in a sea of self-pity in which I almost drowned. I was simply over-flowing with moral indifference, false pride, and per-verted thinking. I was fast approaching a point of no return. That is the point in a man's life when one more foolish or careless mistake can completely and irrevoca-bly preclude any possibility of his again becoming a use-ful, acceptable part of the human race. Then, I met a convict named Alex. One day during a recreational period in the yard, an inmate I didn't know came up to me. Though I had never spoken to this convict, I knew about him. I had first noticed him through a peculiar habit he had. I should clarify that by stating that this habit was pecu-liar in prison; he carried a book under his arm wherever he went. Upon asking some of the other inmates about this, I was told that he was a "lifer" who had already served twenty years, who had little or no hope of a pardon or parole, and that he was a religious fanatic. In prison, the term "religious fanatic" has a wide meaning, ranging from a man who goes to church services once a year to a man who attends services regularly. Another thing that set this inmate in a separate category with his fellow-convicts was that he was a "loner." A "loner" in prison jargon is a convict who stays strictly to himself, has no friends or close associates, and never participates in any prison activities. Even the prison officials look askance at this type of a convict and pay particular at-tention to his every move. For "loners" are the ones who most frequently crack mentally or emotionally. This prisoner I am writing of was in his early fifties, of a serious demeanor, short and on the heavy side, and whose face, though handsome, was lined with suffering. His eyes indicated character and depth. The moment he spoke to me I knew he was well educated. He was courteous and had an air of quiet dignity about him, 4. 4. 4. VOLUME 2% 1970 375 + 4. Alan Ambovn REVIEW FOR RELIGIOUS and I immediately sensed an aura of well-being and contented resignation emanating from him. He wasted no time on social discourse. His opening words were: "Alan, I understand you are a Catholic." As he saw the look of complete bewilderment on my face, he continued: "Father Jerome told me that you had been educated in Catholic schools and that you might be able to help me with my catechism. You see, I am a convert and I'm hoping to be baptized in the near future." I was too amazed to answer him. The first thought that went through my head was that this was a gag of some sort, perpetrated by the fellows I had been hanging around with. Noticing my hesitancy and seeming to read my mind, he went on: "I'm really serious about this, Alan, and though I haven't much, I'd be willing to pay you for your trouble." Something in his manner told me that he was in earnest, but I still hesitated. Finally, I asked him: "How come you and Father Jerome picked on me? I haven't been to Mass since coming here and, as a matter of fact, I have not even been inside a church in over two years." "We never discussed that," he replied. Then he con-tinued: "All we talked about was your school back-ground. Alan, there are a lot of fellows getting instruc-tions and Father, with all his other work, is getting snowed under. When I asked if there were any Catholic men here that might help me, your name came up. As I'm sure you know, each Catholic convert needs a baptismal sponsor. I have no family or friends, so I thought that you might." His voice trailed off, as if in embarrassment, and he waited to see what I would say. When I didn't answer, he said: "I swear to you that there was nothing put on or planned about my asking you this. Your name was alphabetically first and that is how I chose you. Father even warned me that you would not be very receptive to the idea, but I thought otherwise. I guess I was mis-taken. If you'd rather not do it, that's okay, too." He started to walk away. I perhaps will never know just what made me stop him, but stop him I did. It probably was the wisest decision I ever made: "If Father Jerome and you think I am qualified to help you, it's all right with me. Forget that talk about paying me. Remember this, though, it has been a long time since I've seen a catechism book or even discussed religion. You might very well know more about the subject than I do. If you really feel that I can be of some assistance, it's a deal." To this day I don't know what Father Jermone's mo- tives were in sending Alex to me. I honestly can't say whether he had a motive or not; but whatever the case, it helped the two of us. Alex was baptized and I re-turned to my lost faith. As I told Alex, I was very rusty on my catechism and had to do a lot of research. Alex's knowledge of the Bible was far superior to mine; and though, at first, he was kind enough to pretend that this was not the case, it wasn't long before I was the student and Alex was the tutor. His tremendous grasp of both the New and Old Tes-taments was amazing. He could quote verbatim lengthy passages from both texts and never in a parrot-like man-ner. He had a profound understanding of its parables and lessons. No matter what subject or problem we might be discussing, he could find a parallel in the Holy Book, and no matter how bleak a person's outlook on life might be, Alex's Biblical parallels always seemed to offer comfort and hope to the individual. Though I don't believe he ever realized it, Alex was a salesman for the Lord; and he was a good one. The one thing that impressed me and everyone who knew him was his obvious sincerity and his calm acceptance of a fate that was, by all standards, unenviable. As I mentioned previously, he was serving a life sentence with little or no hope of pardon. The fact that this out-wardly didn't raze him and his seemingly calm accept-ance of spending the rest of his life behind bars natu-rally puzzled me. I told him so on one occasion. He explained that when he had first arrived at the prison he had been bitter and lost. Due to his behavior pattern, he had spent forty-nine months of the first five years of his sentence in solitary confinement. It was during one of these sessions of enforced solitude that Alex was given a Bible. Sheer boredom and the lack of anything else to read led to his initial interest in the Book. He honestly admitted that this interest was fostered by a human desire to do something--anything--to help pass the endless hours he was forced to spend alone. Alex had never spoken of the crime that had put him in prison; and I, in keeping with prison custom, had never asked him. However, it was common "yard" gossip that it was murder. Alex told me that his behavior problem came from his overactive conscience and his inability to forget what he had done. He was in a position that thousands of convicts find themselves in. For though soc!ety had in-dicted, convicted, and punished him, and then legally forgotten him by reason of more notorious and head-lined crimes, Alex himself could not forget nor forgive ÷ + + VOLUME 29, 1970 4. ÷ Alan Amborn REVIEW FOR RELIGIOUS 378 what he had done. His misbehavior and antagonistic attitude was a masochistic drive to punish himself. One day while going through the Bible in his solitary cell, he came across the story of Mary Magdalene. It fascinated him. Here was someone who had been steeped in sin like he was and who had asked for and had been given mercy and forgiveness. He went on with his reading, this time deeply impressed and eager. When he came to the story of the crucifixion, he was spell-bound. The agony and torture that Jesus went through wrung his heart. He told me that for the first time in his adult life, he wept. When he came to the climax of the great tragedy, the scene in which Christ, suffering unto death, took time out from His final agonies to forgive His murderers and the Good Thief hanging beside Him, Alex said a wave of understanding and peace descended on him. He said that he had gotten down on his knees to pray, and that while doing so he suddenly and finally knew that he had someone to turn to. Someone who would understand and forgive and who would give him a chance to atone for his sins and his crimes. This knowledge was what permitted Alex to accept his fate and lot so calmly. Through Alex and his application of the Bible in his daily life, I came to know and realize that many of our everyday seemingly insoluble problems have answers that can be found in the Holy Book. The trials and tribulations of our daily lives seem minute in compari-son to what the people of Biblical times faced. I believe that anyone possessed of an inherent sense of honesty detests hypocrisy. Convicts are no different. Any prison chaplain is constantly bombarded with this hackneyed excuse: "Padre, I didn't go to church on the outside, why should I be a hypocrite and start going now?" It's true, the words may differ on occasion, but the philosophy never changes. In many ways this atti-tude could be interpreted as an admirable quality in a man if it were not, in the case of the convict, such a stupid and senseless one. Anyone taking the time to look through the Bible can find any number of instances where even the most devoted and revered of God's saints were at one time in their lives steeped in sin and wickedness. Some, such as St. Paul, were even violently opposed to the teachings of Christ, God's beloved Son. From persecutor of the members of Christ's Church to a pillar of that Church is certainly a complete turn about in policy and belief. In other words, St. Paul was certainly no hypocrite. As Alex often pointed out to me, if the Lord could forgive and accept into His heavenly kingdom the murderer and thief hanging on the adjoining cross to Him; if He could forgive and accept into His earthly entourage Mary Magdalene, a woman who was a con-fessed harlot; if He, in His infinite mercy and in His dying agonies could even forgive His murderers, why, then, surely it should not be beyond belief and compre-hension that He could and does accept a modern-day sinner. His Bible constantly reminds us that eternal salvation is ours for the asking. Remember His very words, "Ask and you shall receive." I honestly believe that convicts might ask more often if they had Someone to show or to tell them how. To-day's prisons certainly offer a. fertile field for present-day missionaries. For just as the man or woman dying of pneumonia or a similar infectious disease needs the shot of penicillin more that the ,healthy man does, so does the acknowledged and convicted sinner need the word of God and the comfort and solace that word gives us all. And should any skeptic question the worth of these ¯ sinners and the redeeming of them, I humbly suggest that he read the Parable of the Prodigal Son. + + + VOLUME 29, ~.970 379 FREDERICK A. BENNETT What Makes a Happy (or Unhappy) Nun? Fr. Frederick A. Bennett is intern-ing in clinical psy-chology and lives at St. Therese Rec-tory; 1243 Kingston; Aurora, Colorado 80010. REVIEW FOR RELIGIOUS Innumerable books and articles have been written about nuns during the past few years. Yet very little empirical evidence has been brought forth supporting the contentions of the authors. Thousands of nuns have left their communities yet there is a dearth of scientific findings either explaining why these nuns have left or probing the present feelings of those remaining. This study was an attempt to provide a few basic facts relating to psychological factors, particularly happiness, as found today among American nuns. 950 sisters, chosen at random from an original mail-ing list of 35,000 individuals from 91 different active communities across the United States, were mailed a questionnaire in March of 1969. The form used had been tested on a pilot study in late 1968, had under-gone some revision due to findings on that pilot study, and was composed of 54 questions in its final form. Novices and postulants were deliberately excluded. Su-periors, when they could be identified, were replaced by non-superiors in the same convent. The nuns in-volved were guaranteed anonymity both for themselves and for their communities, were told that the results would be made available at least to people in a position to act on the findings, and were then asked for their cooperation. The hoped for cooperation was magnificent. One follow-up letter was mailed and at the conclusion, 853 sisters had returned their questionnaires. This totaled 88% of all possible respondents. The average age of those replying was 4'~ years. The results give a broad cross section of thinking and feelings of pro-fessed American nuns in non-leadership positions. An obvious caution is warranted, however, before considering some of the results. The findings cannot be applied to any individual sister. For example, age is found to correlate highly with happiness. It is dear, however, that this is a generalization. There are happy and unhappy nuns at every age level. But for those who are concerned about th~ future direction of religious life and what must be done on a broad scale to give it the greatest chance of surviving and growing, such generalizations can be of great value. This project falls into a category of psychological studies measuring "avowed happiness" or the happi-ness which a subject claims for himself. Such studies have a long history dating back at least until the 1920s. Recently, however, more extensive work in this area has been carried out through several centers of investigation. Two of the more notable undertakings were those carried out by Gurin and his associates in 19571 and by Bradburn and Caplovitz in 1962.2 The latter concentrated on four small towns in Illinois, two of which were economically depressed, and thus they have a dearly biased sample. Gurin, however, used a nationwide sample of 2460 people "selected by methods of probability sampling to represent all American adults over 21 years of age living in private house-holds." Gurin and associates, Bradburn and Caplovitz, and the present study all asked respondents to note what they considered to be their present level of happiness on a tripartite scale using the classifications of "Very happy," "Pretty happy," or "Not too happy." Despite the simi-larity of responses, however, the results are not ex-actly comparable because of other differences. For example, the replies from the sisters were obtained by mailed questionnaires while the other two projects used personal interviews. Nonetheless, curiosity at least, calls for a comparison of the results of the three studies. Bradburn and Caplovitz (women only) Gurin and associates (women only) Nuns Very happy 23% IPretty happy 60% 50% Not too happy 17% = 100% 12%--- 100% 13% = 100% A comparison of the replies of the subjects of Brad- + burn and Caplovitz in the four small Illinois towns ÷ with the answers of the sisters shows the religious to have both a higher percentage making "Very happy" XG. Gurin, J. Veroff, and S. Feld, Americans View Their Mental Happy Nun? Hea¯lth (New York: Basic Books, 1960). VOLUME 29, 1970 2 N. Bradburn and D. Caplovitz, Reports on Happiness: A Pilot Study o/ Behavior Related to Mental Health (Chicago: Aldine, 1965). 381 replies and a lower percentage giving "Not too happy" responses. As was mentioned above, however, by re-stricting their sample to the four small towns, the atuhors also assured themselves of a biased sample. When the replies of the sisters are compared with the subjects in Gurin's nationwide sample, there is vir-tually no difference in the total responses of the two groups. But a very important difference is found when replies are analyzed by age of respondent. A comparison with Gurin's work by age group shows the following: Gurin (all subjects) Nuns Percentage giving "Very happy" responses Under 35 35-44 45-54 55 and over 40% a~% a4% 27% 31% 31% 36°/o 39°/o ÷ ÷ F. A. Bennett REVIEW FOR RELIGIOUS 382 Gurin (all subjects) Nurl8 Percentage Under 35 giving "Not too happy" responses 35-44 45-54 55 and over 10% 13% 18% 15% ~4% 9% Thus as those who live outside of the convents grow older they show a gradual decrement in "Very happy" responses and an increase of "Not too happy" replies. But for the nuns the trend is in the opposite direction. The nuns who are older tend to have a greater per-centage of their members answering in the "Very happy" category than do younger nuns. Likewise, these older sisters have fewer making "Not too happy" re-sponses. The youngest nuns while claiming less happi-ness than the older nuns also avow less happiness than their age counterparts outside of religious life. One immediate reason that might be advanced for the trend toward greater happiness with advancing age among nuns is that less satisfied members of communi-ties have tended to leave and the more satisfied have tended to remain with the passage of years in religion. This does not seem, however, to account for all of the differences since nuns in the older groups today have lived most of their religious lives in a period when leaving the convent after profession was often the exceptional case. Moreover, the younger groups have already suffered a severe depletion of their ranks and yet the ones who remain are much less happy than those in the older groups. A factor that is considered to contribute to the lessened happiness in older people outside of convents is the loneliness that comes to elderly people through loss of a spouse or breakup of the family. The nuns do not have the problem of widowhood and remain with their communities regardless of their age, This may explain, at least partially, why the older nuns claim greater happiness than older non-nuns. It does not ex-plain, however, the differences between older and younger sisters since both seem to have the same op-portunities to avoid loneliness. But since the degree of loneliness is an important factor in the lives of many, and perhaps most people, a question in the present study was directed toward the investigation of their relative loneliness. The question was phrased as follows: How frequently do you feel lonely? Often __Occasionally __Seldom __Never An analysis of replies to this question uncovered a significant negative correlation between loneliness and the basic question of happiness. Actually, the correla-tion of happiness with loneliness was greater than the correlation of happiness with any other element of the nun's life that was tapped in this study. The basic cor-relation between the two was --.50 which could be expected far less than once in a thousand times simply on the basis of chance alone. The meaning of this correlation is that those who tend to report more frequent instances of loneliness also tend to claim sig-nificantly less happiness for themselves. The question must arise in every correlation as to which is the cause and which is the effect. Thus in the present case, does the loneliness cause the unhappiness, or do those who are unhappy tend to be lonely because they are unhappy? Or is some third factor causing both the loneliness and the unhappiness? Although the ques-tion is insoluble at the present time, one of the sugges-tions that will be made later in this article is based on the premise that loneliness is causing some of the unhappiness and that a major point of concentration should be that of overcoming loneliness. Other significant correlates of happiness were also found. In advance it was hypothesized that three ele-ments would figure prominently in the overall 'happi-ness of nuns. These three can be summarized as inter-personal relations, job satisfaction, and leadership. All were found to be significantly correlated with happiness. Loneliness was considered as pertaining 'to inter-personal relations. But there were also other questions + + + What Makes a Happy Nun? VOLUME 29, 1970 383 pertaining to interpersonal relations that showed a high correlation with happiness. For example, one of the questions asked: Do you feel that the majority of sisters with whom you live really are interested in you as a person? ._____Definitely ___.Probably ~robably not Those who are happier tend to say that they feel that other members of the convent are interested in them as a person and those who are less happy take a dimmer view of the interest of others. In job satisfaction, another highly significant correla-tion with happiness (.34, p. < .001) was found. Those who said they found their job more satisfying also tended to be happier. Leadership was also significantly correlated (.34, p < .001) with happiness. The more favorably the sister rated her superior, the happier she was likely to be. The immediate conclusion is that interpersonal re-lations, job satisfaction, and evaluation of leadership are all significantly related to happiness. But it is most interesting that of the three, leadership and job sati~- faction are less important than interpersonal relation-ships. This is especially worthy of consideration because so much more effort at renewal in many communities seems to be directed toward improving job satisfaction and changing leadership patterns rather than toward improvirig interpersonal relations among the nuns themselves. + ÷ ÷ F. A. Bennett REVIEW FOR RELIGIOUS Leadership An example of leadership modifications is found in communities that have eliminated the local superior. The opportunity to investigate the benefits of this change in leadership role was available in this study since 123 sisters said that they were living in a convent in which there was no local superior. In examining these figures, however, it should be remembered that not having a superior allows for a diversity of ways of being carried out in practice; and no attempt was made to define more exactly what each of the 123 nuns meant when she said that she had no local superior. But taking all those without a superior as one group, no significant difference in happiness was found be-tween those having a superior and those not having one. There was actually a slight tendency for those with a superior to claim greater happiness than those without a superior but this may have been merely a chance happening that would be reversed on another sample. The following are the percentage of responses in both groups: Have a superior Do not have a superior Very happy Pretty happy Not too happy 37% 49% 14%-- 100% 32% ~4% ~4% = ioo% Therefore it appears that simply not having a superior does not necessarily improve chances for happiness among members of the community. Sisters who had a local superior were asked to rate their superior in the following question: How do you evaluate the job of leadership being done by your present local superior? __.Excellent ~_Fair ~.Poor __.Very poor An interesting comparison appears when those who do not have a superior are matched with those rating their superior either high or low. Sisters rating superior good/excellent Sisters rating superior poor/very poor No superior Very happy ~6% 23% 32% Pretty happy 46% Not too happy 8% = 1oo% 33% := 100% i4% = 100% Thus being without a local superior is not as favor-able as having a good superior but is preferable to hav-ing a superior whom the subject feels is doing a poor job. Another area that is of importance today in the question of leadership is that some local communities are able to choose their superior in contrast to the former policy of having all superiors appointed either by the major superior or by vote of the chapter. In this study 82 nuns said that they had been allowed to select their own superior. For this group the following percentages were found: Very happy Pretty happy Not too happy Chose their own 50% 40% 10% = 100% superior ÷ ÷ 4. What Malws a These figures indicate that being able to elect a VOLO~E mo ~gro superior is a very desirable arrangement. Gomparing $85 these figures with those given above for sisters rating their superior as good or excellent, the groups are very similar in their avowals of happiness. Consequently it seems preferable to elect a superior rather than to eliminate her altogether. Election is also, of course, far preferable to having a poor superior imposed from above. + + F. A. Bennett REVIEW FOR RELIGIOUS 386 Departures Sisters have been leaving in substantial numbers dur-ing recent years. To determine the unrest that still re-mains in the convents the following question was asked: During the past six months, which of the following would describe feelings or thoughts you have had about leaving religious life? (60%) I have not considered leaving (23%) I have considered leaving but not seriously (10%) I have seriously considered leaving but have de-cided against it (5%) I have seriously considered leaving and may do so (2%) I will probably leave 100% (The percentage of sisters responding in each way is noted in parentheses before each response.) Although the majority of nuns have not considered leaving during the past six months, a substantial minor-ity of 40% have at least had the idea of leaving enter their minds during that period. Moreover, 17% have seriously considered such a possibility. Thus, although only 7% were still seriously considering leaving when this study was conducted, there is a large group that is somewhat shaky and it is not unlikely that many of this group will again have the idea of departing enter their minds. In addition those who do actually leave will probably intensify thoughts of leaving in others and may induce such thoughts in some of those who have not considered it. It appears, therefore, under this inter-pretation of the figures that the exodus from convents is far from completed unless very drastic changes come about in the thinking of present members. When thoughts of leaving are analyzed by age of respondent, very important differences are again noted. The percentages in each age group are on p. 387. As would be expected, the younger groups are much more likely to be thinking of leaving than are the older nuns. But the extent of the differences between the groups is rather surprising. It is especially important that 73% of the youngest group has considered leaving and 40% have seriously considered it. Thus those who will be leaving will usually be the ones who formerly would be carrying the hopes for religious life in the Have not considered leaving Considered but not seri-ously Seriously considered leav-ing May leave Probably will leave Under 28 ] 27% 33% 10% 100% 28-34 43% 15% 7% lOO% 35-44 57% 25% 8% 8% 2% 100% 4~-55 66% 5% 100% Over 55 89% 4% 0% 0% 1oo% future. A further comment on the ramifications of this will be made later in this article. Other Findings Religious life is directed in large measure toward supernatural and eternal goals. The question arises whether remaining in religious life is dependent on present happiness. There was another highly significant correlation of .47 between happiness and the tendency to remain. This strongly suggests that they are related. Regardless, therefore, of how religious life may have been viewed by spiritual writers in the past, in today's convents present happiness is of importance. The nuns who are less happy are generally the ones who are doing the most thinking about leaving. Religious life cannot be divorced from the spiritual activities of the sisters. But in trying to analyze the influence of spirituality, many very obvious and perhaps insoluble problems arise. Because of these difficulties a very simple question was asked. This question did not attempt to assess the influence that the spirituaI ac-tivities have. It merely inquired about the satisfac-tion that the sister receives. The question was phrased in this manner: How would you describe your usual feelings about the daily spiritual exercises that you are expected to perform? __.I find them very satisfying .I find them somewhat satisfying __.I get little human satisfaction from them Another significant correlation was found with hap-piness. Those who are happier tend to receive greater ÷ satisfaction from their spiritual exercises. But here ÷ especially, the relationship of cause and effect is blurred. ÷ Such a finding could signify that because the sisters are What Makes a happier they thereby tend to be more satisfied with Happy Nun? their spirituality. But it could also signify that because the sister receives greater satisfaction from her formal VOLUME 29, 1970 praying, she thereby tends to be happier. Or again, a 387 ÷ ÷ ÷ F. A. Bennett REVIEW FOR RELIGIOUS ~388 third and unknown factor may well be present which is influencing both happiness and satisfaction from spirit-ual exercises. Much research iri past years in social psychology has been devoted to the ideal size of various types of groups. Generally, the best size is found to be less than 12. It was therefore somewhat surprising to find that the number of people residing in the convent in which the sister lives had little effect on her happiness. There were similar reports of happy and unhappy sisters in all sizes of convents. Size was related, however, to some other aspects of the sisters' lives. For example, signifi-cantly more indications of jealousy were found in the largest convents. Conclusions Religious life as we know it seems to be headed for more rough days ahead. Unrest among the nuns is far from terminated. With 40% of the sisters saying that they have at least considered the possibility of leaving their communities within the previous six months, ~many more departures can be anticipated. Moreover, the thoughts of leaving are heavily con-centrated among the younger age groups. When this factor is combined with the importance of interpersonal relationships among the nuns, another disturbing pre-dicament becomes apparent. The younger members are tending to leave more rapidly than the older; if this trend continues, the average age of members of the communities will advance. New young members enter-ing the community in the future will find it all the more difficult to find convents when they go on mission that are staffed by nuns of their own age. A consequence would seem to be that these young nuns of the future will have even greater difficulty in establishing close relationships with other nuns and therefore the chances for loneliness will increase. It is certainly possible and often happens that a young nun finds companionship and meaningful re-lationships with older nuns. But it is more likely for the young nun to find that necessary companionship among nuns of her own age level. Again, this study was not related only to individuals as such, many of whom will go contrary to the findings of this work. Rather the concern was with the overall conditions of religious life. Here it can be said that as the average age of sisters increases, a larger proportion of young nuns will likely find it increasingly difficult to overcome the loneliness that is probably causing some present problems. A personal anecdote may be appropriate here. I re- cently had contact with a large community of contem-plative nuns in which the youngest member had already celebrated her silver jubilee in the community. This convent had not been able to retain the few novices or postulants that had been with them in recent years. Moreover, it would seem to me to be a minor miracle if any young women could be found to enter and re-main in a convent where they would have to bear with such a wide disparity of age. Fortunately such cases are not common today; but unless solutions can be found, it seems likely that other communities, both active and contemplative, may experience somewhat similar difficulties in the coming decades. Further evidence for the stumbling blocks that wide age discrepancies can pose for religious life comes from one of the open-ended questions that were included in the questionnaire. The nuns were asked what they found to be the least satisfying or most discouraging aspect of their life as a religious. The differences be-tween the age groups were striking. For example, a 59 year old nun answered: "The frustration with some younger members." A 30 year old sister said: "Judgmental attitudes of older sisters toward myself." A 73 year old sister pinpointed the age gap saying: "The lack of close communication between the much older sister and the New Modern Sister." Perhaps the split between the generations was most apparent in the attitudes toward change. Frequently the older nuns were most disturbed by what seemed to them to be excesses and the younger were distressed by what they considered to be the hesitancy of some members to change. This was not universal, however, as a few of the older came out with high praise" for the changes but these latter were the exceptions. In general, the generation gap was clear. But as important as age is in laying a foundation for compatibility among sisters, similar age does not insure good interpersonal relations. There are other elements involved in coming to an understanding and meaning-ful relationship with another person or persons. Many psychological, intellectual, and emotional factors are involved. Outside of religious life, freedom of the in-dividuals to choose the companions they wish to have takes account of some of these factors. Freedom to choose one's own companions has never been considered feasible in religious life until very re-cently when it has been tried in a few communities. There was no opportunity in this study to test the value of such a procedure. But an indication of the possible advantages of this arrangement may be inferred fi:om the decided advantage noted of being able to select What ~l~l~e~ a Happy Nun? VOLUME 2% 1970 389 ÷ ÷ F. A. Bennett REVIEW FOR RELIGIOUS 390 one's own superior. This latter also was not considered feasible until very recent years. With all of the inherent problems involved in being able to select the ones that the sister wishes to live and work with, further con-sideration of such a possibility seems warranted. Additional training in the development of interper-sonal relationships during the novitiate and juniorate may also prove advantageous. Some communities have used sensitivity training and T-groups for this purpose. Unfortunately, there is again no empirical evidence to base a sound judgment upon as to the advantages of such training. But in view of the problems connected with interpersonal relationships within the convents, such training merits consideration and research. Decreasing loneliness among the sisters is not solely dependent upon interpersonal relationships within the convent itself. Nonetheless, community life should be a basic bulwark against loneliness. As of now, however, community life is sometimes [ailing to accomplish this. The findings of this study, however, were not com-pletely negative. There was strong evidence that loneli-ness is not an inherent part of religious life. Not a few of the nuns recounted their experiences in having deep friendships with other sisters as one of the great plus values of religious life. In response to the question: "What do you consider the most satisfying aspect of your life as a religious?" a 34 year old sister replied: "The sisters I live with at the present time." A 64 year old sister replied to the same question saying succinctly: "The sisters." "Community living; the spirit of our com-munity (friendliness and joy)," was the response of a 28 year old nurse. A 39 year old teacher answered that it was "living with sisters who are interested in me as a person," while a 53 year old sister cited "the possibility [or personal fulfillment found in community living" as the most satisfying part of her religious life. It is obvious from these responses that loneliness does not have to accompany religious life. But it has also been shown above that community life does not insure that loneliness will not be present. In summation it can be said that new approaches to interpersonal relationships are needed. The gravity of this need is brought into focus by the distinct possibility that the whole question could become academic. With 70% of the youngest group already considering leav-ing the trend could conceivably be against the continued existence of present type congregations. Reversal of such a trend is not impossible but will take much concen-trated effort. LOUIS TOMAINO The Sister as an Agent oJ.Change As Warren Bennis and his colleagues have suggested, radical change is the one constant which seems to char-acterize this age.1 It seems clear that change is occurring in both the church and in religious orders of women. Sisters are all too familiar with problems of change for they are confronted with the problem of trying to bring about meaningful change in their congregations. They have the task of sorting out planned change from ac-cidental change so that only the more constructive as-pects of the process may be realized and the sisters helped to find more satisfying levels of community existence. Change in this instance may be the basic con-dition for the freedom without which religious life might well become increasingly difficult and unreward-ing; yet, from the standpoint of short range needs, it is often more comfortable for individual sisters not to change. The reluctance of an individual to give up old ways of doing things is understandable when one con-siders the meanings change may have for those who face it. : Out of the many things which could be said about sisters and change, we have selected the idea that sister is an "agent of change" in her own community. If this is true, it might also be added that, in general, she plays the same role in the Church itself and in her apostolate. In the past two years, we have held group dynamics workshops with over 1000 sisters from various congrega-tions during which time we have stressed the change agent concept. In their case, the issue no longer seems to be whether change should occur, but rather, what change is to be encouraged and how might it be facili-tated? This paper reports on some things which char-acterize sisters and change. 1 Warren G. Bennis, Kenneth D. Benne, and Robert Chin, The Planning of Change (New York: Holt, Rinehart and Winston, 1962). Louis Tomaino is the acting direc-tor of Worden School of Social Services; Our Lady of the Lake College; San Antonio, Texas 782O7. VOLUME 29, 1970 391 Robert Blake and Jane Mouton, two inventive be-havioral scientists, conceptualized a model called the managerial gridS which unified their lengthy study of management and organizational structures. This model proved highly successful in understanding the manage° rial process and helped .develop new techniques in management. Jay Hall and Martha Williams, social psychologists at the Southwest Center for Law and the Behavioral Sciences and former students of Blake and Mouton, utilized the grid concept with an instrument called the change grid. This grid was extremely valuable in workshops with the 1000 sisters. Sisters who are interested in meaningful community change might be expected to have some concerns about the quality of the change. These concerns provide the basic grid dimensions and are expressive of the sisters' thoughts. These are the concern for conformity (that members adhere to community norms) and the concern for commitment (that members truly internalize com-munity norms). Put another way, this says that sisters should comply with what the community expects but do so because they really accept and value those expectations. These dual concerns will affect the kind of change strategies a sister would utilize in her community. The two concerns are thought of as being independ-ent of each other. The sister may fuse them in some way in her relations with other community members but the concerns appear thusly in the beginning: C 0 M MITME NT (The complete grid appears on the following page) Loui~ 2"omai.o REVIEW FOR RELIGIOUS CONFORMITY Different sisters impute varying strengths to these con-cerns. Those who perceive themselves as "traditional-ists" may exhibit more conformity interests, while those who view themselves as "progressives" might prefer commitment concerns in their approaches to change. So ~ Robert Blake and Jane Mouton, The Managerial Grid (Hous-ton: Gulf Publishing Co., 1964). that we might consider "how much" concern sisters manifest, each axis is scaled from 1 to 9. The value 1 will mean "low concern for" while the unit 9 will de-note "high concern for." Three methods of securing change assume that the concerns for conformity and commitment are in con-flict-- that communities cannot hope to insure both ends and must thereby choose one over the other. These methods (reading grid fashion, fight and up) are the 9/1, 1/9, and I/1 approaches. High THE CHANGE GRID ~/9 Ptrson-~Tentsred Clu~ng~t : There is a natural trend toward personal growth once an individual is free to accept himself. The task of the change agent is to help the person accept his strengths and weaknesses without the judgmental pressures of othersD values being in-troduccd. Then he will be able to accept both society and its values. 9/9 C~ang¢ ola CndiMli~y : Since behavior is learned, it may b~ modified through relearning. The change agent's task is one of creating conditions under which people can learn the consequences of current behavior and explore the feasibility of new behavior~ in realistic settings. Reality testing resalts in conformity based on commitment. Low Charismatic ~hangt : People accept suggestions only from people they can respect. The change agent must be "one of the guys" ff he is to gain enough prestige to influence. Changees will copy his behavior to win his respect and will then learn it is better. ~ustodial No one person can really change another. People only conform or fail to conform if they want to. The task of the change agent nccessarily is one of apprising the changce of the rules and then leaving it up to him to decide whether he wants to follow them and stay out of t~ouble or break them and suffer the conse-quences. At the same time, the change agent must keep those in authority informed as to how the changee is behaving. 9/t C~angt Via C~mplianrt: It may not be possible to change a personDs attitude, but one can change his behavior if he makes it elear what is expected of the changcc and what can happen if the changee fa~ls to conform. The change agent's taak is to transmit this information dearly and then to follow up by keeping "tabs'~ on the changee to see that he con-forms and knows that the change agent means business. 4 5 6 7 8 9 High Coastrn for Conformity The 9/1 .4pproach--Change through Compliance The lower right hand corner of the grid tells of that change strategy which is maximally concerned for con-fortuity and minimally concerned for commitment. This sister decides that community members cannot do both Agent oJ Change vo~u~ 2,, ~97o 393 Louis Tomaino REVIEW FOR RELIGIOUS ~9~ so it is better to use one approach and make it work. The 9/1 sister will likely express her philosophy in this manner: It's been my experience that people do things only when they have to. A lot of the time sisters can't possibly agree with the way the Church says they have to conduct themselves, but they have to nevertheless., or suffer the consequences. Once a per-son realizes this, he makes it easier on himself and everybody else. I think change can best be brought about by spelling out what is expected of a person and what provisions exist for dealing with him when he doesn't conform. My job, as an agent of change, is to work with persons closely and see that they follow the letter of the law so that their behavior is acceptable and in accordance with general values o£ the Church. The 9/1 strategy does bring about change in many instances. The thing communities need to be aware of is some of the consequences which this approach pro-duces in others. Such responses as fear, rebellion, re-sentment, and hostility are byproducts in others of the 9/1 stance. Such psychological outcomes are unfavor-able for effecting change in the people who have those feelings. Under this system the community must be run as a "tight ship" with few democratic overtones. Indeed, for many years religious communities functioned as 9/1 organizations. Some still do. However, other 9/1 systems like the military and the police have begun to change albeit imperceptibly. With the advent of Vatican II, religious orders have also witnessed a trend away from compliance oriented styles of management. It used to be that sisters' behaviors could be regulated under con-ditions allowing little deviation from specified require-ments, and that by this fait accompli effect sisters would eventually acquire commitment. This "legalized" ap-proach to change does not seem a very satisfactory method for inducing long term commitment. The 1/9.4pproach--Person-cente~ed Change The person-centered strategy represented in the upper left grid corner assumes that people want to gain the values of the congregation and will gravitate toward that end when they are "freed" to do so. Concerns for conformity are rejected as antithetical to free choice. Person-centered change is designed to help the sister ac-cept her own shortcomings as a means of finding herself in her community and accepting others as well. Trust and appreciation are central to this relationship and concerns for conformity are seen as "getting in the way" of real commitment. This sister would likely perceive matters as follows: Basically people want to live good lives and get along well in their communities, but many of them just don't knowhow. Too many people have never had the opportunity to get to know themselves and, consequently, they can't really accept themselves or other people. I think the job of an agent of change is to work closely with people so that they can first learn to accept themselves as genuinely important human be-ings. Then they will be able to accept and appreciate others as well and will feel worthy of the religious life. Once a person has gotten rid of his own self doubts, he will naturally begin to grow and seek out the solid values of his congregation. The job of the change agent is one of helping people find self-ac-ceptance and freedom of expression, on the basis of which real growth can occur." The 1/1 Approach--Laissez Faire Change CustodiaI change as depicted in the lower left-hand corner of the grid presumes that individuals are autoge-nous and change or fail to do so as a result of their own desires. This really is not a change strategy but more a reflection of the change agent's unique perception of his own role. These sisters believe in "the way we have always done things" and think that change is up to other persons. Her philosophy would read like this: I believe that in the long run it is impossible for one person to really change another. Human nature is the strongest determinant of behavior and some people are just naturally better than others. It seems to me that the best thing for an agent of change to do is to spell out the rules for people as clearly as he can and then let them make their own choice as to whether they are going to follow them or not. Where there are clear rules, there are also pretty clear consequences spelled out for any failure to conform. People are pretty much their own bosses and it isn't realistic for any one person to try to change them. At best, a change agent is a representative of his community who hopes and prays that others will obey. In the end this way of thinking will promote "don't rock the boat" values, and terminate in "rut." Idealistic 1/9 type candidates who enter the 9/I congregations might well end up making 1/1 adjustments, Psychic en-ergy gets diverted to secondary external matters such as housecleaning, posturing, gestures,, and various other correctness models. Under these conditions communities may appear to function smoothly because everything seems to be in order. Underlying this facade, however, is a profile of non-involvement by community members with each other and, sometimes, an apparently perfunc-tory apostolic performance. The 5/5 Approach--Charismatic Change In the grid center we find a 5/5 strategy which says that the sister must have concern for both conformity and commitment. However, this approach also states that the more concern exhibited for one means less for the other. In effect, this sister goes half way with both concerns. She seeks to gain the respect and affection of Agent o~ Change V0LU~E 29, 197o 395 Louis To'malne REVIEW FOR RELIGIOUS 396 others and utilizes this commitment to herself as a per-son to bring about change in others. Her philosophy is expressed along these lines: I think people basically resent being told what to do or what is expected of them by other people who don't really understand their problems or have had no experience in com-mon with them. I think the agent of change has to be a person who understands the situation of the people he is trying to change so that they will respect his judgment. The best way to bring about change is to first convince people that you are "one of them" and then set the exam.pie. When a person sees someone he respects and can trust acting a certain way, he will usually try to act the same way simply because he respects that person and wants to be respected by him in turn. This is a hard but effective way of bringing about change and the agent of change has to be sincere and willing to really give of his time. Change through 5/5 dynamics can be very effective. Its implementation is difficult because it requires a highly

PI'S RELIGIOSITY IN YANN MARTEL'S LIFE OF PI Yektiningtias English Literature, Art and Language Faculty, State University of Surabaya yektiningtias@gmail.com Drs. Much. Khoiri, M.Si English Literature, Art and Language Faculty, State University of Surabaya Much_choiri@yahoo.com Abstrak Agama merupakan istitusi mengenai ketuhanan. Agama berisi sekumpulan pengertian dan kebiasaan yang mengacu pada individu. Individu tersebut adalah individu yang religius, pernah religius, atau bisa jadi religius. Partisipasi dalam suatu hal yang berbau religius didefinisikan sebagai religiusitas. Individu yang memiliki religiusitas tidak berarti mereka menganut sebuah agama. Selagi mereka melakukan hal hal yang sebuah agama perintahkan terhadap para pengikutnya, seperti percaya kepada Tuhan, mencintai ciptaan Tuhan, dan melakukan tindakan religius, individu tersebut dapat dikatakan religius. Life of Pi, sebuah novel karya Yann Martel, menggambarkan religiusitas seorang anak laki –laki, Piscine Molitor Patel atau Pi. Sejalan dengan hal tersebut, tujuan dari pernelitian ini adalah untuk menggambarkan religiusitas dari Pi dalam hidupnya dan mengungkapkan faktor-faktor yang mempengaruhi religiusitas tersebut. Metode analisis secara tidak langsung berdasarkan teori psikologi remaja karya Frederick Tracy karena sebagian besar novel tersebut menyuguhkan kehidupan Pi ketika dia masih dalam masa remaja. Hasil penelitian menunjukkan bahwa Pi telah memenuhi tiga komponen religiusitas-keyakinan, perasaan, dan tindakan. Terlebih, ada lima faktor yang mempengaruhi religiusitas Pi. Faktor tersebut adalah pengaruh keluarga, pengaruh pekerja professional, kebutuhan, ketertarikan, dan rasionalitas. Kata kunci: agama, religiusitas, komponen religiusitas, remaja Abstract Religion is the institution of godness. It contains a set of meaning and behavior referring to individuals. The individuals are religious, were religious, or could be religious. The participation in religious things is defined as religiosity. Individuals who have religiosity do not mean they commit to a religion. As long as they do what a religion tells its followers to do, like believing God, loving God's creation, and doing religious action, the individuals are considered religious. Life of Pi, a novel by Yann Martel, depicts the religiosity of a boy, Piscine Molitor Patel or Pi. In line with that, the purpose of this study is to depict religiosity of Pi in his life and reveal the factors that influence it. The method of the analysis indirectly works mostly based on Frederick Tracy's psychology of adolescence theory because mostly the novel presents the life of Pi when he is in adolescent period. The result of this study shows that Pi has fulfilled three components of religiosity—knowing, feeling, and doing. Moreover, there are five factors that influence Pi's religiosity. They are family's influence, professional workers' influence, needs, interest, and rationality. Keywords: religion, religiosity, component of religiosity, adolescence INTRODUCTION Fiction, by its definition, is describing imaginary events and people. The contents of a prose literature which are included in fiction are drawn from imagination that shows creativity or original thought. An unrealistic plot like a boy who flies by a broom, talking animals, aliens, or monsters that attacks the earth often cause delusion. Thus, an author puts truths to make the work more realistic although as the mentality history, a work of art can be a manifestation of reality, critic of reality, and alternative thought of reality (Supaat, 2008: v). A modern literature has a notion that art or literature is a matter of creativity. Often the creativity is bounded with the legalistic and formalistic doctrines of religion. Thus Western societies put the religion aside from their literature. The literature is free and free from religious matters. On the contrary Y.B Mangunwijaya in Supaat (2004: 175) stated that basically all literatures are religious. T.S Elliot in Supaat (2004: 166) added that the value of literature must be seen from the ethic and religiousness. If there is an idea or agreement of a society of a religious ethic so the literature must be 'good' like the religious ethic. Religion within a fiction is based on religious ideas from the real world. The religious ideas can be included into a fictional prose because basically fictional characters are imaginary. Although the characters are made up, they still have people's same willingness, needs, and drives in the real world. What people do in real world includes seeking religious understandings. (http://altreligion. about.com/od/artandculture/a/Religion-And-Fiction.htm retrieved on March 7th 2013). Based on the explanation, art works often raises religious issues to make the story becomes more real. The issues contain the truths from real religious ideas. The authors put more understanding to the issues from the facts. A character seeks for religious understanding for some reasons. The character may find peace and satisfied feeling towards his or her life in religion. Although religion is a term for conceivable religions whether formal or informal (Ferm, 1959: 647) a character does not always practice what a particular religion that he or she commits' rules. A satisfaction is found deep inside a feeling. Because it is related to feeling, it can be related to religiosity. Stolz (2009: 347) defines religiosity as what an individual chooses, feels, believes, and acts that refer to a religion that already exists or to a self-made religion. Religion itself is a cultural symbol-system that responds to problems and possibilities that are related to a very important reality. This system influences everyday life and cannot be controlled directly. Stolz continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god while the religious symbol-system or religions are like Christianity and Islam (Stolz, 2009: 347). An author may put his understanding about religious things to his works. 'Literature going behind God' is an effort of a man in letter by his works in which nuances in religious with his total comprehension of faith , so that he could comprehend fully of his seeking of God, his Creator, and literature is a dynamic, productive, and creative media (Supaat, 2004: 176). Yann Martel puts his idea of religion and religious things into his fictional work, Life of Pi. "Pi is interested in religions: so am I. Pi is open to all faiths: so am I. Pi is comfortable in different Godhouses: so am I. There is a sociocultural component to religions. Just as there are different ways of feeding the body, there are different ways of feeding the soul. Each religion is one group of people's attempt to understand ultimate reality. I think in each one there is a portion of truth and a portion of error. So I see in all great religions the same frame of being, only seen from a different perspective." (http://abcnews.go.com/GMA/Books/story?id=124838&page=5 retrieved on March 7th 2013) Life of Pi mostly presents such unrealistic things and events. The carnivorous trees and an impossible 227 days survival of a boy together with a Bengal tiger floating on a boat in Pacific Ocean seem hard to dissolve by mind. Although these things are in some ways unrealistic, Martel puts Gods and religions ideas into this work. The Author's Note in the beginning of his novel states that the story comes up from a man named Mr. Patel. Yann Martel, the author of Life of Pi, was in India in searching for inspiration here he met a man in a café who then tells him to meet a man with great story i.e. Piscine Molitor Patel. He then says that the story will make him believe in God. Life of Pi is uniquely presenting its adventurous content with religious values and zoology. Yann Martel was intelligently put those different things into synchronized single unit. The coordination of the true story of Mr. Patel told in first person is incredible. The story begins about Mr. Patel's education and working life which serve with the fact that he was a student of religious studies and zoology. Then it shifts to his life when he was a boy, son of a zoo owner. In this part, the story provides facts about some animals' life inside the cage or out there in the wild. The story next progress is story about Pi's religious life when he was in his teen that reveals his strange religious practice. The 227 days survival in Pacific Ocean on a boat with a Bengal tiger is the next part of this incredible story and it is closed with he is survived. This novel once comes up with controversy of its originality. Some critics come up with their idea that this novel resembles Scliar's Max and the Cats, a story about a family of German zookeepers sets sail to Brazil. The ship is shipwrecked and only a young man survives after floating at sea with a wild jaguar. This issue then goes down as a discussion between Scliar and Martel done. But Martel had been firstly mentioned Scliar's name in his Author's Note part of his book. (http://www.sparknotes.com /lit/lifeofpi/context.html, retrieved on February 12th, 2013). This issue affects the outstanding content of this novel. Some critics, however, still appreciate the novel. This novel makes the reader recalls the story of Ernest Hemingway's The Old Man and the Sea Yann Martel was an author of seven awards in literature. His first book entitled The Facts Behind Helsinki Roccamatios and Other Stories was a collection of four short stories published in 1993 deals with themes like illness, the anguish of youth, grief, and loss that blend with the lunacy of 20th century history. This book achieved Journey Prize in Canada. Martel's second book, his first in the form of novel Self published in 1996. This book succeeded to win Chapters/Books in Canada First Novel Award. This novel's theme was study of sexual orientation and identity. Also Martel was the author of a collection of letters to the prime minister of Canada, What Is Stephen HarperReading? (http://Literature.britishcouncil.org/ yann-martel on 17 oct 2012) After the publication of his novel in 2001 Life of Pi, his name was widely recognized by literature world. This novel was able to win five different awards. In 2001, this novel won Governor General's Literary Award for Fiction in Canada and also Hugh MacLennan Prize for Fiction. A year later, it won Commonwealth Writers Prize in Eurasia Region as the Best Book although it won over the shortlist. Also in the same year, Life of Pi was able to get the Man Booker Prize for Fiction that made him create much of literary splash rather than with his first two books and it also won the Boeke Prize in South Africa. As the recent achievement, Life of Pi has been filmed in 2012 and achieved a great success. Martel's works have been praised seven different literary awards although his life began with various odd jobs after he graduated for a degree in philosophy in Trent University in Ontario. He ever became a tree planter, dishwasher, and security guard before he committed in writing at the age of 27. Although he began his life with various odd jobs, his decision to write books after that was a right decision. He got praised for his ability to make multi themes and problems that are not common to be bound in to one. For his ability to combine uncommon multi themes and problems, he succeeded to make Life of Pi to become a novel of great combination of religious values, zoology, and adventurous life. As the opening of the novel, it is told that the novel will make you believe in God. This story reveals Pi's journey of life since he was child until he was mature and graduated from university. This story provides about Pi's religious life which is strange and it affects his understanding about his life and God's destiny for him. The combination of religious theme and zoology of the novel is purposely done for enriching Pi's religious life portraits. Pi is kind of person with maturity in his mind to combine his understanding about God of his religions towards the objects around him although he is still young. As human life is divided into four divisions (Tracy, 1920: 10) in which the first period is the period of childhood. The second is period of youth where this is the period of procreative function to the process of self maturing. The next period is the period of manhood and the last is the period of decay that is being dead. As the character of Pi in Yann Martel's Life of Pi is in the second period of life, he experiences great things in his religious life. In his adolescence that is ranged from 12 up to 24 years of life, Tracy (1920: 187) points out that, youngsters seek for spiritual meaning in religion as well as from the objects of nature, events, and their relationship with other fellows. Piscine Molitor Patel or Pi is originally a Hindu. He lives in a Hindu neighborhood when he was kid until he is adolescence. His religious practice has become strange when he meets two religious people i.e. a priest and an imam. Thus, this introduction constructs his understanding about other religions, Christianity and Islam. His decision to commit three religions, Hinduism, Christianity, and Islam simultaneously is also influenced by Bapu Gandhi who said that the most important thing is to love God. Pi has a strong love towards God although he is still a young man. Pi is having a disliking towards his biology teacher who does not believe in God's existence. Pi sees the doubt on the important of religion and the existence of God as just a while. Every man will pass it someday and reach a happy life. Although Pi is still young, he has already experienced his deep feeling about being religious and to religion itself. The feeling creates him to experience religious flaming. This deep religious feeling or religiosity happens in his teen. His religious feeling seems have mutualism with his personality as adolescence. His life whether they are individual or cultural and social more or less influence personality and affect his decision in understanding religions as the way to love God and being a religious on his multi religions practices. This religiosity that is seen from his religion combinations stresses the importance of individual factors, including social background and personal history. Those backgrounds are to build up his mind of committing three different religions at the same time. Thus this study is to reveal the form of his religiosity in the novel and the influencing factors. RESEARCH METHOD The source of this study is taken from a novel by Yann Martel, Life of Pi reprinted and republished in New York in 2012. The data collection is by analyzing the quotations, phrases, dialogues, or monologues in which reveal thought, speech, action, and attitude that reflects the idea of religiosity of the main character, Pi, from the novel Life of Pi. This study of religiosity will be applied by the concept of religiosity with its components, modes, dimension, orientation, and changes that often experienced by people. The religiosity used to determine and explain about the main character Pi issues of religiosity. To analyze the background of his commitment, it is used psychology of adolescence concept that consists of several psychological points of view about relationship between adolescence and family and religious life of adolescence. Close reading of the novel is done first to determine the major issue of it. The major issues are collected and proposed into a topic of the study by seeing the conflict, the monologue, the dialogue in the novel. After the topic is already decided, it is tried to figure out what should be analyzed with the topic. Thus it is collected two statements of problems. There are the depiction of Pi's religiosity and the factors that influence his religiosity. The next step is searching related information about concept of the topic and to figure it out, it is used religiosity concept and theory of psychology of adolescence for the analysis and the conclusion. CONCEPT OF RELIGIOSITY Religiosity is a concept that has a bound with religion. This concept of religiosity can be defined in some definitions that relate to the religion itself. Supaat (2008: 175) defines religiosity as an aspect which lies inside the deep heart, flaming in the inner heart, personal attitudes which more or less are mystery for the other people, because are based on intimate psychology i.e. universal totality, that includes human's ratio and feeling, inside the personal being. This religious attitude is pointed on personal side of an individual toward his God, and having attitudes as what God wants. Stolz (2009: 347).continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god. Religiosity can also be defined as participation in religious rituals, various behaviors, and attitude in group or society by an individual (Theodorson, 1969: 345). Rituals are usually what a religion tells the adherents to do. Whitehouse (2004: 4) explains rituals as actions that have lack of intrinsic meanings although there are possible interpretations or symbolic motivations that may be the background of the rituals. Although these actions are lack of intrinsic meaning, the ordeals are ritualized and the speculation of their significance and meaning are still present. Focusing on implicit motivations of people doing the behaviors has some tactical merits (Whitehouse, 2004:24). The explicit religious concept that ethnographers interpret is often difficult to differentiate that the concept is the interpretation of the ethnographers or the people's actual explicit religious concepts. The other reason is from the psychological point of view, implicit concepts are better predictors of behavior. The people can also be manipulated to do the actions because they are not consciously aware and will of their response to the stimulus. This leads to explicit reason to do the behaviors instead of the real motivation of them. The explicit knowledge is likely consisting of post hoc rationalization rather than a guide of the motivation for the behavior (Whitehouse 2004: 25). On the contrary, Fazio stated in Whitehouse (2004: 25) says that the conflicts between the implicit concept and explicit concept are not always true all the time. He says that explicit belief can also be a guide to the motivation. People who do the same ritual procedures regularly results in habituation. Those automated habits can make the people to have less reflection of the symbolic meanings of the rituals (Whitehouse, 2004: 6) for example in religious speech. People can be feeling bored of the doctrinal repetition. Rituals are the main things to do in order to get merits and not being sinful. As Tracy (1920: 183) stated that religion involves man's attitudes towards the Supreme Being without age differences and the main thing is to do positive attitudes towards the Being. To support these, an adherent often does various behaviors like fasting and to behave or keeping his or her good attitude by helping other people and doing good things. God is the invisible but owns the highest power and attitudes towards the Being, as sacred and profane. Durkheim (1915: 37) states that there are two divisions of world. They are sacred in which is the one containing all and profane which is the other all. These are the distinctive characteristics of religious thought. Sacred thing is not only about the personal beings called gods and spirits but a rock, a house, a tree, or anything can be sacred. Profane is what relates to daily life experience of human beings. For example, it is about someone's attitude that results in sins or the way a religion teaches human being to have a meaningful life by giving charity and helping one another so it will result in man's goodness. The representations which express the sacred things, the virtues and powers that they have, or the relation with profane things are like beliefs, myths, dogmas, and legends (Durkheim, 1915: 37) As well as Theodorson, Tarigan (2007:11) supports that. The definition of religiosity for him is as the human attitude which comes from God's blessing. God blesses human to believe in God, to enjoy modest life, to give charity, to help other people, to be lovable, and to be friendly. Because of the participations, behaviors, and attitudes based on particular religion that an adherent must do, sometimes these will cause strain to the adherents. They may feel under pressure because if they are not doing them, there will not be merits that they will get but sins and being afraid of God. God is someone who watches you to see that you behave yourself. (Powell, 1963: 289) The concept of religiosity is also generally accepted as multidimensional phenomenon. The phenomenon happens in the society related, influenced, or caused by many dimensions. The dimensions come from cultural, social, or individual contexts. Religious as the result of practicing and believing religion is also influenced by the religion's system of beliefs, rituals, and practices. Thus, individual actions are often influenced by the religion. Because of factors like afraid of being sinful person or to be considered as a religious person, adherents may do more than what a religion tells. This actualization of excessive religious, religiosity (Concise Oxford English Dictionary Eleventh Edition), besides to show that they are religious by doing it excessively, it also can be deviated from the real doctrines. It is agreeable that religion has to do with the relationship between man and his Maker or specifically it is the relationship between man's attitudes towards whatever he believes to be the owner of the highest power in universe (Tracy, 1920: 183). Because of the existence of attitudes, it needs to differentiate religion and religiosity although they bound each other. Religiosity is something that adherents do from what a religion orders. Then, religion defines as follows A religion is a set of meanings and behaviors having reference to individuals who are or were or could be religious. (Ferm, 1959: 647) The statements means that a religion is a container of what an individual must do or must not do either the individual is religious, was religious, or could be religious. Thus, it is only a term that contains all formal or informal religions in the world (Ferm, 1959: 647). Religion is the institution of godness which is unified system of beliefs, rituals, and practices that typically involve a broader community or believers who share common definitions of the sacred and the profane. (freebook.uvu.edu/SOC1010 retrieved on 18th October 2012) Supporting Ferm, Evans (1978: 305) has a definition of religion in which also has relationship between things or power which are uneasy to explain. Because religion freely allows a man to relate himself to the outer power that cannot be explained with science, quality and intensity of man's religiosity of his religion can be low or high. A man considered himself as religious man not only because he believes on religion , he can be considered as religious without doing religion's doctrines or a man who does it but is considered as not religious one as explained as follows that it needs a deep understanding to consider a man as religious person or not. To be religious is to effect in some way and in some measure a vital adjustment (however tentative and incomplete) to whatever is reacted to or regarded implicitly or explicitly as worth of serious and ulterior concern. (Ferm, 1959: 647) Supaat (2008: 175) stated that someone who is religious is defined as human being who has serious inner heart, pious, careful, and with deep spiritual considerations. GENERAL COMPONENT OF RELIGIOSITY For the social psychologist, religion has five main facets. They are the ideological or beliefs, the ritualistic or practice, the experiential or feelings, the intellectual or knowledge and the consequential or effects (Watts and Williams, 1988: 10). These facets bound into one dimension of religiosity. On the other hand, Duke (1988) defines the general components of religiosity seen from social psychologist are knowing or cognition, feeling or affection, and doing or behavior. Knowing or cognition is abstract. Knowing about things that are related to religiosity and religions are inside every man's mind. This is an ideology. The people believe what he believes that the things are true and good for him. Because ideology is only idea in this context in idea of religious things, the only thing that can be seen from this is the realization of this belief in the real world. For example a person believes that a religion is true. People cannot see his belief but can only see how the person shows his belief true religious doings like doing rituals. The feeling or affective is the feeling dimension of religiosity towards the social situations. The social situations contain things that God has created. Human being, animals, plants, goods, or institution are the creation of God. People who have religiosity are feeling grateful of the existence of His creations. Doing or behavior is the action of showing religiosity. This action aims to get positive effect. Religious doings are the realizations of religion as ideology and the feeling towards the God and His creation in the world. The behaviors are like attending religious rituals like servings God as a duty, studying about religion as the feeling to enlarge his knowledge and religiosity to his God, doing charity as the praise for his sufficiency and love feeling towards fellow, and helping the others to tighten the fellowship. In the matter of religious behavior, cognitive scientists more or less ignored the roles of explicit religious ideas and sentiments as the motivations of people doing the religious behavior (Whitehouse, 2004: 24). Boyer stated in Whitehouse (2004: 24) says that people are feeling the compulsion to participate in rituals because the natural environment often produces contaminants so the people use the rituals as the detection of and protection against them. These specializations are actually just normal cognitive systems. Of these components of religiosity, many researchers still hopes for more developed ways to measure religiosity of someone that the participation in institutional religion because there are differences in religious attitudes and experiences between dominations and between different people with the same denomination and there are fact of the equivalency of average attendance figures (Watts and Williams, 1988: 11). Some people may define themselves as religious in some sense although they play no part in organized religion. From a survey on religious scale items from Independent Television Authority Survey stated in (Watts and Williams, 1988: 11), individuals scored high on religiosity because they classified themselves as very religious or fairly religious, are certain that having some religious beliefs lead a good life, without belief in god life is meaningless, religion helps to maintain standard and morals of society, there is God, god watches each person, are very likely to think of god when they are worried or happy, religious belief affected their everyday lives. MODES OF RELIGIOUS INVOLVEMENT Individual participation on religion consists of two modes of religious involvements. Duke, in his journal, states that the modes are personal mode and institutional mode. The personal mode is built of religious beliefs, feelings, and behaviors. These are found in personal and individualized religion. The person accepts doctrinal orthodoxy from the cultural society around (Duke: 1998). In institutional mode, the religious beliefs, feelings, and behaviors are found in formalized and institutionalized religion. This mode accepts them in which related to religious rituals and worship services like in a particular church or other religions. While Duke divides an individual involvement is a religion as personal and institutional mode, the others like Davidson stated in Duke, separates it to private and public modes. RELIGIOUS ORIENTATION People's interest toward particular religion that makes them religious depends on their own decision. It is whether they are extrinsically or intrinsically oriented (Allport, 1967: 144). Allport's point of view of extrinsic religious is caused by outer reasons or influence. The reason why an individual is committing religious acts aims in seizing mundane goals like feeling comforted and protected and also is like to get a social status and approval. To measure an individual religiosity based on extrinsic orientation is by seeing the influence given by peers, family members, or professional workers. Durkheim demonstrates how process that influence by society motivates individual action. The only source of life at which we can morally reanimate ourselves is that formed by the society of our fellow beings; the only moral forces with we can sustain and increase our own are those which we get from others. (Durkheim, 1915: 425) It is different from intrinsic orientation which assumed without achieving a mundane goal even self denying quality as the reason of religious involvement. This orientation arises from the goal of the contents of the religious tradition itself. To measure this orientation is by seeing the personality. CHANGE IN RELIGIOUS COMMITMENT AND PARTICIPATION Life events relate to religiosity. Peter Berger stated in Cornwall (1998) states that plausibility structures i.e. family, church, or voluntary organizations and conversations with the others are important and can give influence to religiosity. Because there are many life events that will influence someone's religiosity, there is chance of the change of his or her commitment and participation in religion. The changes are change in belief and activity over the life cycle, religion disaffiliation and dropping out, religious conversion and reactivation, religious change as personal development. The changing of religious belief and activity can be related to life cycle. Teens or early twenties may have less religious belief and activity than they who are in late twenties or thirties. This changing is caused by several backgrounds like family backgrounds, early socialization, and to developmental issues of adolescence and young adulthood (Albrecht and Cornwall: 1998) In religious disaffiliation and dropping out, an individual decides to not join one organization because she or he chooses to join another or decides to stop his religious involvement in the organization. Even though this is action of switching, it does not mean they loose their religious faith. They only choose the best belief for them. Religious conversion has often been defined as a rather sudden process consisting of new religious insight or experience which leads to greater religiosity on the part of individual involved (Donahue taken from Albrecht and Cornwall: 1998). Supporting Donahue, Starbuck (1900: 21) added that sudden changes of character like from evil to goodness, sinfulness to righteousness, and indifference to spiritual insight or activity. In the adolescent period, the conversion is an awakening. The conversion can happen in many motifs: conversion from private investigation of alternative ideologies to highly social, emotionally arousing experience (Lofland and Skonovd stated in Albrecht and Cornwall: 1998). Starbuck (1900: 49) states that the motives and forces behind the religious awakening is based on the nature of conversion. To study the motives and fears, the people are grouped into their likeness and differences. They are fears, other self-regarding motives, altruistic motives, following out a moral ideal, remorse and conviction for sin, response to teaching, example and imitation, urging and other forms of social pressure (Starbuck, 1900: 49) Religious development changes as the individual goes matures. This maturation process is primarily seen through psychological study without focuses on the impact of normative events like marriage, first job, child bearing, and death (Albrecht and Cornwall: 1998) PSYCHOLOGY OF ADOLESCENCE Adolescence is the second stage of human life. In this stage, adolescents will experience a period of the birth of procreative function until the full maturity of their powers (Tracy, 1920: 10). This stage is begun in the second dozen period of human life. The first dozen period is childhood, the third is manhood and the fourth or the last period is the beginning of decay of the powers until death. In other word, the adolescent period started from the age of 12 years. Supporting Tracy, Goldenson (1984: 17-18) explains further about the beginning of adolescent of girls and boys. He stated that adolescent period of girls is begun when they are 12 until 24 years. Boys have a year later the beginning of adolescence than girls, which is from 13 until 22 years. The period of adolescence is subdivided into two periods but some writers divided it into three. In the three divisions of this period, there are early, middle, and later adolescence. In this division, the beginning of adolescence happens in the four or five first year while the rest divisions follow this. In two divisions, the period of adolescence is subdivided into early and later adolescence. Both are lined when the adolescents are in their sixteen or seventeen years of life. During the period of adolescence, adolescents will experience a period of puberty. Puberty is a period when sexual life is born and it is also the beginning of procreative quality of them. Although puberty will happen to every person, the birth is varied between an adolescent to the other adolescents. This means that an adolescent can have it when he is 12 and the other may have it in his 14. Besides puberty is the birth of sexual maturity, in some civilized people, puberty is a sign of social and religious obligations of individual. … Frequently by some new emphasis on the social and religious obligations of the individual, evidently with a half-conscious recognition of the close association between the racial and the religious life. (Tracy, 1920: 17). The same thing happens to adolescents in Christian Communions. In this community, adolescents are hoped to take new step of their religiousness and begin to take their religious responsibility. This will lead them to the closer and more open relationship with their church. As well as Tracy, Goldenson (1984: 17-18) stated that during this period, adolescence will experience major various changes that have different rates one to the other. The changes include changing of sexual characteristic, body image, sexual interest, social roles, intellectual development, and self concept. Tracy (1920: 18) stated that in the matter of thought and feeling, adolescence is the period of 'deepening'. The feeling of adolescents will experience a flaming where they will find deepest meaning of things. All experiences of them will make them to interpret them deeper and bound them into a higher thought. In this case Evans (1978: 93) supports Tracy. He explained that in period of operational thinking, adolescents will not face conflict in thought process from the concrete to the abstract form. The adolescents will be aware of logical of basic things and the formulation of hypotheses (Evans, 1978: 93). Thus, they will seek for the logical reasons behind some things, conditions, or situations around them then they began to understand them as something that they have known or purposely introduced when they were kid. The mind of the adolescent reaches out to that which is implicated or involved in the presentation. In a deeper sense than ever before, the mind now takes hold upon the ideal, builds castles, lays plans, and indulges in day dreams, with all kindred psychic adventures (Tracy, 1920: 18) The feeling of adolescents will be richer than when they are children. This will also become actual. The combination of feeling, thought will result of the birth of emotion. Adolescence has primary emotions. They are love, fear, anger, and curiosity. The adolescence does not learn the emotions. The emotions are inborn. Other emotions are built on those primary emotions. Love is a feeling of strong affection or attachment. This emotion makes adolescence concerns for someone or feels delight in an object, person, or situation. This primary emotion builds some secondary emotions like affection, joy, pleasure, and delight. Adolescence will feel alone and insecure without love. Fear is an emotion which ranges from worry. Hurlock stated in Kapunan (1971: 55) categorizes fear into three: fear of material objects, like animals, airplane, elevator; fear of social relationship, like being alone, meeting people for the first time, making a speech; general fear, like poverty, death, darkness, physical incapacity, marriage. Gates and Pressey stated in Kapunan (1971: 56) say that fear has positive values. Fear causes someone to be cautious and careful, thrifty, sober, and the fear prevents one from doing wrong. But, fear also can make one from going a head and can lead to failure. There are three ways to overcome fear. They are forewarning in which the adolescence should be cautioned of something they are afraid of, assurance in which they are told that nothing is to fear, and to live the experience. Some secondary emotions of fear are moods, anxiety, and worry. Anger is an emotion from resentment to rage. This emotion is caused by inability to do or get what is wanted. It may be being teased, treated unfairly, and being bossed. The expressions of anger are like disobedience, resistance, sneers, threats, satire, gossip, or oral attack. This anger also has positive effect. This can make one accomplish more, make one pause and re-examine his practices and limitations. Curiosity is the beginning of knowledge and learning when one starts asking question. This interest or curiosity makes children being aware of the changes around them. This makes their interest aroused. The birth of emotions of adolescence makes the adolescents becoming aware of the combination of those emotions. After that, the action rises. When children's action is imitative, habitual and automatic adolescents' action will be less imitative, habitual, and automatic. It will be controlled by the will although it is not fully controlling the action. It is because their intelligence control is spasmodic and intermittent. FAMILY AND ADOLESCENCE Family condition whether it is related to the parents' attitudes influences the attitude of adolescence. Since many of attitudes or values own by children are well structured in their eight or nine years that are difficult to change, this means the home environment is the primary factor involved in structuring them. Powell (1963: 266) added that although parents have strong role of structuring children's attitudes and values, the home environment also influences them. It is including children's observation of his parent's interaction with each other and with other adults. According to Warnath in Powell (1963: 267) home is the place for children of learning developmental social skill and the desire to participate in activities related to other individuals. THE RELIGIOUS LIFE OF ADOLESCENCE Everyman is basically a religious being. They are capable of religion not at this age or that age. They are always capable of this. Although everyman's naturally religious, they are not capable of it in the same sense. It is not also the ideas and feelings towards a religion are the same in every man. An immature man does not have the same things as a mature man has of the ideas and feelings. It can be said that child's capability of religious experience is not the same in form and content as youth's and adult's. Since religion is a matter of thinking, feeling, and acting, children who are not mature, they themselves have intellectual power over their feeling and behavior (Tracy, 1920: 186). As long as they are given early introduction to God, their life is genuinely religious (Tracy, 1920: 186) as they easily absorb things around them. Thus, the character of children's religious life is based on their mental life and this progress. As everyone knows, child absorbs things around him but without the knowledge of his sense. Although the child tries to look deeper about the knowledge he gets from his surroundings, there is not larger degree of understanding that he will get. Although child may comprehend and speak bout the un-sensed for example the unseen and untouched things, there is not understanding about it. They only know that they can see the unseen if they have keener vision and where to look them. During childhood, children are told that God sees them but they cannot see God and God is near to them but they still cannot see God. They may ask such questions but without understanding. Thus, they will be satisfied to any answers given to them. Religion of child and the religion of youth have much in common but there are still features that differ one from another. The religion of youth is more subjectively personal than the religion of children. Religion of children is natural religion but the youth's is spiritual religion. Youth tries to find spiritual meaning of objects, events, and relationship of human life. Religion influences moral values as well as social attitudes not only for adults but also children and adolescents. Children know about religion early from the one closed to them like from parents. Since the children's religion is natural, as long as they are given early introduction about this, they will likely be religious. This differs to adolescent. Early introduction to concept of religion that is relationship between God and man often creates conflict in adolescence. They begin to question the concepts they have absorbed (Powell, 1963: 284) because they start to find out the hidden meaning of something, like no children. For in childhood there is a simple, direct response to the impressions of the environment, on the sensori-motor reflex plane, without the possibility of the deeper and stronger emotions, and with a minimum of logical interpretation or critical analysis. In youth this naive outlook gives way by degrees to one in which the subjective elements play a more prominent part, with the simple feelings giving place to the profounder emotions, mere sense-perception being supplemented by the more ambitious processes of cognition, and the instinctive and habitual motor reactions by deliberate choice and higher volition. (Tracy, 1920: 189) Adolescence is an important period of dedication in participation of organized religions in the world even in primitive form (Ferm, 1959: 378). Ferm also states that When the religious nurture of childhood must issue in personal commitment if significant religious maturity is to follow (Ferm, 1959: 378) Tracy (1920: 191) distincts two distinctive features of adolescence's religion. The first are the experience of intellectual doubts and difficulties whether it is accompanied by emotional tension and upheaval or not. The second is the experience known as conversion. Doubts and difficulties are related to religious questions. As children is very dogmatic which means they greatly absorbs what others say and answer based on questions that they ask, the mind of adolescence begins to criticize that. Ideas which have heretofore dwelt side by side in consciousness without any sense of clash or conflict, may now reveal to the more alert mind of youth certain incongruities and contradictions. (Tracy, 1920: 193) If the adolescence cannot deal with the idea that they have with the reality that they face, there will be conflict which leads to doubts of what they have believed. In some researches stated by Powell (1963: 286) relating to loss of religious interest with adolescent, show that young people do not loose 100 percents the interest of religion but they do not seem feeling satisfied with traditional religious belief and ritual. In this period, he added that confusion seems to happen that may lead to guilt feeling. Family environment which is included attitudes of father and mother influences the development of young people's religious attitudes, Parents often give their children with strict adherence to specific religion. This habit can make confusion to the children when they come to a more liberal home (Powell, 1963: 286). However, children with less religious even irreligious parents will make them insecure and envy of seeing their classmates involved in religious experience denied them. A better point of view of religion will be in the attitudes of children whose parents are religious and liberal. These combinations seem to make result in developing more mature religious views (Powell, 1963: 288). According to Allport cited in Powell (1963: 290) religious sentiments occur from needs, interests, temperament, rationality, and cultural response. Young people seek for new experiences, awareness of the presence of God, to be useful and unselfish, to participate responsibly, and become members of a wholesome fellowship (Powell, 1963: 291) Kuhlen and Arnold cited in Powell (1963: 289) agrees that religious beliefs become increasingly abstract with the increase of age. The more age he has, the more likely he becomes religious. For many adolescents, leaving religious practice is temporary since they will enter their adulthood that makes them likely to become affiliated with religious practice. DEPICTION OF PI'S RELIGIOSITY Three general components of religiosity are depicted by Pi. The depictions are Pi's knowing about God's existence, knowing about religion, feeling grateful of animals' existence, grateful of goods' existence, Pi's doing like serving God through personal prayer, committing three religions, loving the fellow, and loving animals. As adolescence, Pi has knowledge about the great power of God. Pi thinks that it is only a very serious disease that will kill God. What is meant by serious disease is a real serious disease that infects a human being. Pi thinks that God, the Supreme Being who has super power over all things in the world will not die or never dies because of thing like suffering disease like a man can. God is the creator of human being and all other creatures in this world. He disagrees with his teacher's opinion that God died during partition in 1947. He might also die during the war or when he was in orphanage. Pi believes and knows it so he thinks that it is an impossible thing for God to die that way like a human being does. He also thinks that if God's existence in a man's heart is dead, this condition will lead to terrible things. In other words this is a very dangerous condition. Pi states this because he does not want God disappears from every human being's heart. He compares the terrible things that will happen because of that condition with terrible disease. He attempts to say that the effect of both things towards human beings and other creatures in the world is vey dangerous. Someone who suffers a not-dangerous disease still can infect the people around him then imagine if the disease is terrible. This will have greater effect towards them. Then, if someone does not recognize his God anymore, this will make destruction. For example, if human beings are the highest God's creature compared to animals and plants do not have God inside their minds then the God's blessing like mercy towards the other will be lessen and the worst is disappearance of that. If the people do not have mercy anymore, they will damage the environment. Relating this to Pi's life that is closed to animals, Pi knows and believes that by keeping God inside his heart will make the world and its contents peaceful. Pi has a positive point of view of religion. For him religion is light. The light will guide human beings to the right way along their life's way. When Pi met his teacher, Mr. Kumar at his father's zoo, Pi was so happy to see him there. Mr. Kumar said that he often went to the zoo and thought that other people might think that it was his temple although he was indicating to the Pit of goats' and rhinos' cage. He later talked about politic that lead to religious debate between him and inside Pi's heart. Mr. Kumar thinks that the world will be peaceful if the politicians are like the goats and rhinos. But the real condition is reversed. Pi does not know anything about politics although his parents often complained about Mrs. Gandhi. He bluntly said that religion would save them. After Pi mentioned that they will be saved by religion from the political condition that was terrible, Mr. Kumar's response was not very good. He admitted that he did not believe in religion. He thought that religion is darkness. He thought that there were no grounds for believing thing like that. He only thought that religion was a superstitious bosh. He did not believe in God's existence. Hearing this Pi was only thinking that Mr. Kumar was only testing him for his knowledge of religion. He thought that he was like purposely saying that mammals lay eggs. After that Mr. Kumar is an atheist was in his mind. He was then surprised when he was told that God may have died somewhere some when. Although he was surprised of this, Pi did not hate the fact that Mr. Kumar is an atheist but Mr. Kumar's agonistic made Pi upset. Mr. Kumar spoke that God never came when he needed Him. When he was Pi's age, he was racked with polio. The God never came and saved Him but the medicine did. Pi did not respond anything about it although it was a bit much for him. Pi chooses not to argue with Mr. Kumar not because of his anger but more afraid of loosing someone he loved. The depiction of Pi's gratefulness of animals' existence is found when he was in the zoo. Pi's father was the owner of a zoo in Pondichery. He was feeling very happy of growing up in a zoo. Almost every animal in the zoo left an impression to Pi. In some case, Pi did not have to depend on his activity to the mundane thing like alarm clock for example. Pi did not have to have the clock because he could use the voice of animals around him to wake him up, to remind him for breakfast. He used the roar of a pride of lion who usually roar off between five-thirty and six every morning. The loud voice of howler monkeys punctuated his breakfast time. The animals in the zoo also give Pi a happy feeling. Besides from his mother's gaze, he also got a benevolent from bright-eyed otters, burly American bison, and also orang-utans. Pi was living his life as prince who had the fondest memories of living in a zoo because of the animals. The animals brought him advantages. From morning until dark, Pi was always welcomed by them. Every animal in the zoo has different characteristics, habits, and action. There are animals which voices are very disturbing but there are animals which are not. The habits or the actions of the animals whether they are annoying or not, has brought him to think that they are the graceful gifts from God. Seeing their action made Pi feeling as a lucky boy. Pi has always been feeling grateful of what God has given to him. Once when he is in trouble when floating on the Pacific Ocean, he finds goods that will make him survive. Although he is in trouble, he still remembers about the relationship of the goods' colour with one of the religions he has committed. In Hinduism, saffron is the most sacred color for the Hindu. This color represents fire and symbolizes purity. Wearing this color symbolizes the quest for light. If this color is related to what Pi finds in the lifeboat, this means the goods are source of light for Pi. The light is his survival from the fear. The boat makes him safe from the Pacific Ocean beneath him and the tarpaulin separates him with his Bengal tiger. At first, Pi does not think that the goods he has found will become his lifesaver. But, he then thinks that with the lid, he is separated from Richard Parker. This means he is protected from carnivore that is in the same boat with him. He is feeling grateful of that. Then if the tiger is managed to attack Pi from below, he should push the lid and it will warn him and make him fell backwards to the water. And here it is the function of the lifebuoy. The existence of the goods has caused joyful feeling for Pi. He even cannot compare them with all giving occasions that he has experienced before even the occasions bring great pleasure. Although Pi is floating on the Pacific Ocean, he still does prayers. Pi does the religious rituals adapted to the circumstances. He does all three religions rituals he commits. Pi still does the prayers because he has felt that doing prayer will bring him comfort. But, in practice, doing prayer is very hard for him. He thinks that to have faith in God is difficult. He has to have an opening up, trust, and act of love towards God. It is because he is not in a save condition. There are dangerous problems that he faces on the ocean. He sometimes fills with anger, desolation, and weariness. He is angry at the God who puts him in this kind of situation. In that kind of situation, Pi ensures himself that everything around him is God's, even the hat he is wearing, the attire, the cat, the ark, the wide acres, the ear. Pi has a very strange religious practice. Although he is still adolescence, he has already practiced three different religions. They are Hinduism, Christianity, and Islam. At the age of fourteen years old, Pi meets Jesus Christ and becomes a Christian although he was born Hindu. He is admired by the God's Son's sacrifice. He willingly sacrifices Himself for the goodness of humanity. He pays the humanity sins. The reason is because of love. Although Pi is a Hindu, he also commits to Christianity. He does both Hindu and Christian prayers even right after becoming Christian. Pi commits to Islam a year later. Again he is introduced to Islam by a professional worker. He is a Sufi who is a Muslim mystic. His name is Satish Kumar, person with the same name as his biology teacher. Pi is attracted to Islam because of the brotherhood and devotion that are told in Islam. Pi also feels good when he brings his forehead to the ground. He feels a deep religious contact then. After all those introductions to new religions, Pi practices all of them. Pi's love toward the fellow is depicted through his relationship with his biology teacher. Although Pi is born Hindu and is a well-content Hindu, he still respects anyone who does not have the same faith with him including his biology teacher, Mr. Satish Kumar. One day Pi sees Mr. Kumar in the zoo. He is a regular visitor of the zoo. When he is visiting zoo, he always reads labels and descriptive notices of every animal. He feels scientifically refreshed after visiting the zoo. In the zoo Mr. Kumar and Pi have a talk about political things in India. Mr. Kumar imagines if they have politicians like two rhinoceros and a goat, that live together in harmony that they are watching, India would not have faced many problems. Then Pi says that religion will save them. Mr. Kumar's response is out of Pi's mind. He thinks religion is darkness and God does not exist. Pi is surprised about this. Pi only thinks that he is testing him. But it is not. Mr. Kumar is an atheist, someone who does not believe in God's existence. Although Mr. Kumar's point of view about religion and God is not the same as Pi's, he still accepts this. He only thinks that anyone has doubt like Christ who ever doubts God for forsaking Him. Pi still makes Mr. Kumar as the reason he choose zoology as one of his major in university. Because he is the first atheist person that Pi meets, he is able to think that atheists are his brothers and sisters. He considers Mr. Kumar as a person of blood-relationship with him no matter what faith he has. The faith is their faith. They are free for it like Pi himself. Pi's love towards animals has made him to become a vegetarian. When Pi is in trouble finding the source of food on the boat on Pacific Ocean, he is finding many flying fish, Dorado fish, have flown into the lifeboat. He is finding this event as happy event because Richard Parker has had some food supplies to fill its hungry stomach. Pi also takes one of the fish. He covers the fish with blanket in order to not make him hurt. After that, he tries several times to kill the fish but he could not complete the action. Pi cannot make it because he feels pity of the fish. He even feels a bit responsible of the rat's death because he threw it to Richard Parker. To kill the fish, he thinks that he is between the affection feeling towards animals and the need to have meal. In his lifetime, he is a vegetarian. When Pi has been succeeded in killing the fish, the tears come down his cheeks. He cannot feel the life fighting anymore. He feels sad knowing that there is blood on the fish. Although fish is a common animal that human even other animals eat and they rarely think that the fish is a creature that has soul, Pi's aware that there is soul inside the fish. He is very sorry toward the soul living things that he has killed. The fish cannot enjoy its life anymore. Pi thinks the fish and him are the living creation of God. They should not kill each other. Because he loves it, he is feeling guilty. Then, he promise to pray for the fish in his prayer. FACTORS INFLUENCING PI'S RELIGIOSITY The religiosity of a person can be begun since early life of that person. This can appear to the mind of people when they are children. Not all people will experience religiosity since in their early age. Usually the forms of religiosity are based on religion. The moral values and social attitudes of the people will be likely influenced by it. Early introduction of religious things to people are mostly from the people around them but this religiosity can also come from inside the individuals. The factors that influence religiosity of Pi are family's influence, professional workers' influence, needs, interest, and rationality. Pi's religiosity comes from the influence of his parents because they are the closest figure for the children. Although Pi is from Hindu family, he defines his father as person who does not have strong belief about religion. He later explains that all new animals in the zoo owned by his father are blessed by priest. In the zoo there are also two small shrines. They are to Lord Ganesha and to Hanuman. But, the reason behind this is only to please the zoo director. His father thinks the existence of the shrines is good for his business to build a better relationship with the public, not personal reason like personal salvation for him. It is true that Pi is religious because he has been falling in love with Hinduism. But, the children's mental life grows. Pi sees his father as a less or lesser religious than him. Then he might think that committing two new other religions is okay for him. Because of this reason, he begins to think it won't be any problem with my family if I commits to these new religions. Besides of the religious life of his father, Pi also feels that when he was kid, he has never prohibited reading comic and other papers that contain anything about gods of any religion. Pi thinks that his mother was pleased to see him reading any books so long it was not naughty, because she herself is a big reader. Professional workers have a great influence towards Pi's religiosity. Pi was originally a Hindu because he was born in Hindu family. During his childhood, he was familiar with everything about Hinduism. Later on when he enters his adolescence period that is in his fourteen years old, he begins to know about Christianity. Pi is on a holiday trip in Munnar. In Munnar there are three hills. The hill on the right has a Hindu temple, the hill in the middle has a mosque, and the left hill has a Christian church. Pi is a school boy who attends a Christian school but he never goes inside a church. Then, because of curiosity he decides to hide around a corner of the rectory of the church because he is afraid. Inside the church he sees a figure, a priest who is sitting quietly and patiently waiting for anyone who wants to talk to him. On the next day he manages to enter the church and is welcomed by the priest, Father Martin. Pi thinks he is very welcoming. In that church he was told some story about Christianity including God's son who was willing to pay the humanity sins. Pi cannot accept this. He always questions this thing to Father Martin. He always answers it is because of love. Pi does not feel satisfied of the answer. On his last day in Munnar, Pi decides to come to the church again. At first he thinks that the priest is not in but he is. He says to Father Martin that he wants to be a Christian. He says that Pi already is. Before Pi leaves, he finds Father Martin smiling to him. It is the smile of Christ for him. From these, Father Martin's patience and kindness to give explanation to Pi and answers his questions too have made Pi to feel that Christian is not as what he thinks as people with great violence. He has seen the sincerity of Father Martin. He is feeling comforted about what the man is telling. These makes him understands about the religion and finally commits in it. Another professional worker that influences Pi to Pi's religiosity is an imam of a mosque in Mullah Street. At that time, Pi is also in his adolescent period. He is sixteen years old when he knows Islam. Pi actually does not have good impression about Islam. Islam has a reputation worse than Christianity. Islam has fewer gods but greate

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

The Mercury June, 1893 ADVERTISEMENTS. IRailroafc "The "Royal 'Route" /Viu^rc and ^rfc C°1s^^Vato^y. Chartered 1850, offers Classic, Normal, Music and Art courses for Diploma and Degrees ; comprises three large brick buildings, situated on ;t beautiful eminence, a lovely campus, library, apparatus, hot and cold mountain water, steam heat, gas light, electric bells, a suite of rooms nicely furnished for every two or three students, music lessons on 1'ipc Organ, Reed Organ, Piano, Violin, Guitar, Mandolin, IJanjo, and Cornet. Lessons in Drawing, Crayoning, Pastel, China and Oil Painting. German and French languages taught and spoken. Special attention paid to Elocution and Voice Culture. Normal course with Diploma for teaching. Strict attention given to Physical, Social, and Religious culture. Kee Mar College is located in a most attractive, refined, and healthful city of 14,000 people. SEND FOR CATALOGUE AND JOURNAL TO Rev. C. L. KEEDY, A. M. M. D., President, Hagcrstown, Mel. To th$ StlJd^rjts oF New and Direct Line To and From QETTT5BURQ. Fast, Frequent and Superbly Equipped Train Service Between NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Barber SfrQP> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK QANDERS & OTAYMAN Beg to call attention to their splendid exhibit of the leading makes of Pianos and Organs Including the famous ESTEY OROAN, WEBER, DECKER BROS., ESTEY, FISCHER, AND IVERS AND POND PIANOS. Also a full line of Sheet Music, Music Books, and Musical Instruments of all kinds, including Violins, Mandolins, Banjos, Guitars, Cornets, Autoharps, &c. SANDERS & STAYMAN, 13 NORTH CHARLES ST., BALTIMORE, MD. 934 F STREET, N. W., WASHINGTON, D. C. Music Sent " On Selection." Catalogues Free. We are Sole Agents for the Wonderful "JEOLIAN," an Orchestra in Your Own Parlor, With You as Musical Director. Spalding's Livery Stable, STRATTON ST., GETTYSBURG, PA. Branch Office, E. S. Faber's Cigar Store. Hacks, Carriages, Wagonettes, Double Teams, Riding Horses, Large Wagons Capable of Holding Sixty Persons at a Time. COMPETENT GUIDES FOR THE BATTLEFIELD. CHAS. J. SPALDING, Proprietor. "-vjX5))jj ■ ■ ■ ■ 11 ■ 11V? 11111:111 -1 -11: ■ i.ii i.iiiiiiiiiiiiiiiiiiuiiiiiiii-iiiaiii'iiuiiiiiiiiiiiiiiiiiiiiiiiimlftQv1*^— Gettysburg Carriage Works, CHAS. J. SPALDING, Proprietor. WEST MIDDLE STREET. BUILDER OF « Surreys, Buggies ^ Road Wagons.>« REPAIRING PROMPTLY DONE. ADVERTISEMENTS. B. # O If you are Going to the World's Fair— And we suppose you are— We desire to Call your attention To the Baltimore and Ohio Railroad, Because it is The Shortest Route From this section Of the country, And because it Is the most Picturesque and Historic. Its solid Vestibuled Trains from New York, Philadelphia, and Baltimore Run via Washington, Traverse the Historic Potomac Valley, the theatre Of the war between the States, and cross the Allegheny Mountains, 3,000 feet above The sea level. All through trains carry Pullman Sleeping cars. The rates to the World's Fair via the Baltimore and Ohio R. R. Will be very cheap, And the train service Will be unexcelled. The Baltimore and Ohio Has direct tracks From its station at Chicago to the World's Fair Grounds. Apply to Chas. O. Scull, General Passenger Agent, Baltimore, Md., if You desire to know More about this Great Route. ADVERTISEMENTS. iii Society Baboes flbri3e flfcebals Stationery The most successful designers of College and University Badges in the Country Estimates— -Designs on Application BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, *Pa. iHary had a Little Lamb, (Stam> your Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for S1 5.00 you know. These Custom-Wade Suits are popular throughout America — because they represent the very Quintessence of Nobby Dress, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, stating kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Balti-more cheapest market. KEELER the largest custom producer. Full Dress Suits, Trousers, - - Frock Suits, • Overcoats, - - JOnN M. KEELER, 5 N. Calvert St. Baltimore, fid, "Suffer no longer the extortions ofloco-1 tailors. S25.0U Up. $4.00 Up. $18.00 Up $18.00 Up. OEHM'S AGME HALL @nirm Hnnm & ruinisnrm 5 and 7 W. Baltimore Street, Annex 6 and 8 S. Charles St., BALTIMORE, MD. Correspondence Solicited With Responsible Parties Desiring to Act as Agents. NEW SPRING STYLES Of Suits and Overcoats now ready at 20 to 30 per cent, under com-petitors' prices. Write for Samples and Price List. WILLIAM SMALL, DIM DQOH nnra AND BOOK DMDLX 6 WEST MARKET STREET, YORK, PENNA. w. SJSGHRODER, DEALER IN rjafrs and Caps? ^ No. 6 Balto Street, Gettysburg. IV ADVERTISEMENTS. p. D. SCHRIVER Draper, Importer, • AtfD Merchant Tailor 23 Baltimore Street, GETTYSBURG, PA. The College Mercury. Vol. I. Gettysburg, Pa., June, 1893. No. 4. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor: JULIUS F. SEERACH, '94. Associate Editors : ALBERT S. COOK, '95. FRANK E. FICK1NGER, '94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL \V. KOLLER, '94. ROSCOE C. WRIGHT, '95. SUMNER R. MILLER, '95. Business Manager: BENJAMIN R. LANTZ, '94. Assistant Business Manager : CHARLES F. KLOSS, '94. T^n^.r-. f One volume (ten months), . . . . $1.00 lERMS-| Single copies, .15 Payable in Advance. AH Students are requested to hand us matter for publication. ' The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. eONTE/NTS. EDITORIAL, 55 CHARLES S. WOLF, 56 RESOLUTIONS ON THE DEATH OF SUMNER R. MILLER, 57 THE PROGRESS OP MESMERISM, 58 AN EPISODE 59 SPECIALISM: ITS NECESSITY AND ITS DANGER, . 59 PROOF-READING—MENTAL AND MORAL, 61 PAPA H 's SOLILOQUY ON THE DAY THE KEE-MAR GIRLS WERE HERE, 62 COLLEGE LOCALS, 63 ALUMNI, 66 FRATERNITY NOTES, 69 ATHLETICS, 70 TOWN AND SEMINARY, 71 LITERARY SOCIETIES 73 E/DITO-RIAL. WITH this number of THE MERCURY, the lately elected staff takes charge of affairs. It is their desire to mirror faithfully the life and thought of the students of Gettys-burg College, and bring before them in read-able form the doings of each month. Such work, however, calls for the heartiest co-opera-tion of the student-body. We, therefore, ask you for your willing help and for contributions to its columns. Remember that THE MER-CURY is the true representative of the college, for it alone stands for the interests of the students. * * * IT is of peculiar interest to us, who are train-ing for active work in the world, to know just what sort of material the world demands. The idea is slowly dying a natural death that four years of Latin, Greek, and Mathematics will fit a man to deal with all the problems of life. Text-books and dictionaries contain ten times more knowledge on these subjects than the average student, but they are powerless to effect the solution of our daily enigmas. The world calls for more than that, it calls for men. Our learning is of no account to those around us, unless a man stands behind it. Character-is a prime necessity for a man, and here is the place to develop it, for the college is a little world with duties as real as those of the throbbing world about us. If we fail here when the test is applied, we are bound to fail when larger duties demand our attention. The world is a severe judge, and takes no excuses. We are weighed in the balance, and, if found wanting, the command comes : " Make way for a man !" To quote the words of Dr. Hulbert: " Men are in demand; not homines—animals 56 THE COLLEGE MERCURY. that wear pants—but viri, plumed knights, with swords upon their thighs," ready to battle for right and truth, and make the great world better. THE spirit of death seems hovering over our college. But a short time ago we were called upon to mourn the loss of one whose college days were nearly over, Charles Wolf. Then came the announcement of the departure of the College Treasurer, Alexander D. Buehler, a man full of years and honors. And now again we have to bow to the will of that dread power, giving up one whose whole life lay before him filled with the glorious promise of highest achievement. Sumner Roscoe Miller, a member of the Sophomore class and one of the editors of THE MERCURY, died May 30th, shortly after the hour of noon. His illness was of a short duration, and the end came unexpected, swift and terrible. Just the day before his death, all reports spoke of speedy recovery, but now such.hope is vain—his health has come to him in a happier land. But words fail the writer, and the task of telling the story of that bright life must be left to a calmer mind and a quieter heart. Grief, deep and sincere, is in the hearts of all his fellow-students, and words are slow to come when the heart quivers in pain. IN days of old, when the burden of thought was turned to things heavenly, a common belief was expressed in the words of the adage : " Cleanliness is next to Godliness;" but now that the minds of men have deigned to descend from their lofty flight and take an interest in human affairs, the thought implied finds better expression in the changed form : " Cleanliness is next to manliness." Refer-ence is made to this in order that the careless-ness, so prevalent lately, may cease, and that the rubbish which litters the campus may dis-appear. It is to our interest to appear neat and tidy to the visiting world and the Faculty. We are judged by what is seen of us, and we naturally desire favorable judgment. But to obtain such judgment we must do something worthy of it. Let us, therefore, respect the request made of us, and rid ourselves of waste matter through the proper channels. If we respect the wishes of others, we have more chances of having our own respected, and more right to claim consideration for them. * * IN the editorial concerning the glee club, which appeared in the last issue, it should have been stated that the club was granted permission to be absent from college for sixteen periods. The reason that they were not allowed to give concerts away from college this term is owing to the fact that the time granted was exhausted last term. CHARLES S. WOLF. CHARLES STORK WOLF, son of Rev. Dr. and Mrs. E. J. Wolf, was born in Baltimore, Md., December nth, 1873. He was named for and baptized by the late il-lustrious Dr. Charles Stork, and it would seem that there was transmitted to the child the same gentle and charitable spirit of the sainted man whose name he received. In his second year, he removed with his parents to Gettysburg, and resided here until his death. He began the work of his education in the public schools of this place, and was graduated from the High School with the highest record of his class in June, 1887. The following Sep-tember he entered the Preparatory Depart-ment, where he remained for two years, and entered the Freshman class in college in Sep-tember, 1889. Three years of his college life had passed and the day of his graduation was at hand, when, on April 26th, he left home to spend a few days in New York city, at a con-vention of the Sigma Chi Fraternity, of which he was a faithful and devoted member. He returned home on the evening of Saturday, THE COLLEGE MERCURY. 57 April 29th, happy and apparently in excellent health. The next morning, however, he be-came sick, and after an illness of little more than forty-eight hours, he died at 6.15 o'clock : on the morning of Tuesday, May 2d. Such are the facts connected with the brief life and sudden death of Charles Stork Wolf- He was a gentle, amiable, happy boy, scatter-ing smiles and sunshine into the lives of all with whom he came in contact. His nature was beautifully childlike in its tenderness and simplicity; his character was pure, noble, and upright. In his home he was an example of filial respect and brotherly love; in his frater-nity he was the type of loyalty and devotion ; in his class and the whole college community he was loved by all and hated by none. Among the citizens of Gettysburg he had a smile and kind word for all, knowing no dis-tinction of high and low, rich and poor; and beyond the limits of Gettysburg his friends were numbered by the score. His death came just at that period of transi-tion when the youth is passing into the man. The arena with its activities lay just before him, and in a few months he would have met the world, and dared the decrees of fate. What the future held for him we cannot say; if the boy was prophetic of the man, we believe his life would have added blessings to the world and benefit to the race. From child-hood his heart had turned longingly toward the work of the ministry, and it is not for us to predict what words of sacred eloquence and deeds of Christ-like love would have been his, had he lived to carry out his purpose. It is sufficient for us to know that God needed him and his service in some foreign part of his great universe, and that the bright boy, who so recently moved among us, still labors and loves in a broader and better life in the presence of his Father and his God. W. K. D. the death of a member of the active chapter. As we con-template the death of our young and beloved brother, Charles Stork Wolf, involuntarily we bow and say, " Truly death hath all seasons for her own." The very type of youth and health and happiness, he walked among us only a few days ago, and the thought of death was never associated with that bright face and manly form, but in a twinkling of an eye the summons came and he was taken. Charles Stork Wolf was a youth of rare and enviable qualities. His nature was bright, genial, and affable; his character pure, upright, and noble. Cheerful smiles, gentle words, and kind deeds were his constant companions. In his home he was a loving and obedient son and a kind and gentle brother. In his friendships he was true, sincere, and faithful, and in the world at large he had a heart of love and charity for all men. Only the garlands of friends rest upon his newly-made grave, and from no heart rises the curse of an enemy to distract the peacefulness of his slumber. In the death of Charles Stork Wolf, Theta chapter of the Sigma Chi Fraternity has suffered a sad and heavy loss. He became a member of the chapter early in the present col-legiate year, and during his membership his devotion to the White Cross and its interests was constant and memorable, and new lustre has been added to the emblem by his pure and unselfish life. As we gather in our chapter lodge it is hard to think of him as a " silent Sig," but the vacant chair with its drapings of mourning, the longing for " The touch of a vanished hand And the sound of a voice that is still " are sorrowful reminders of the truth. Our hearts are filled with sadness, for in the years to come we shall miss his hearty hand-shake, his cheery laugh, his happy ways. Resolved, That the chapter lodge be draped in mourning for a period of thirty days, Resolved, That a copy of this action be sent to the family of our deceased brother, spread in full upon the minutes, published in the college publications, and the Sigma Chi Quarterly. ED. W. LOUDON, CHAS. W. HUMRICHOUSE, FRANK S. LEISENRING. FRATERNITY RESOLUTIONS. 1'or the first time in the almost thirty years of its existence "as Theta chapter of Sigma Chi been called upon to mourn RESOLUTIONS ON THE DEATH OF SUMNER R. MILLER. WHEREAS, God in His all-wise providence has seen fit to summon from our midst our dearly-beloved friend and class-mate, Sumner Roscoe Miller; and WHEREAS, In his sad and unexpected death the class of '95 has lost a most talented and devoted member, and the ' ministry a most promising candidate ; therefore be it Resolved, That while we bow in humble submission to the will of Him " who doeth all things well," yet we deeply mourn the loss of him who, by his manly character and Christian conduct, had endeared himself to us; and, 58 THE COLLEGE MERCURY. Resolved, That in him we have lost one whose place can never be filled, and whose memory will ever be cherished, not forgetting that our irreparable loss is his eternal gain; and Resolved, That,as an expression of the sincere sorrow which we experience on account of this mysterious act of God, we extend to the bereaved family and friends of our departed classmate our deep sympathy; and Resolved, That a copy of these resolutions be sent to the family of the deceased, and that they be published in the College journals, Church papers, and The Millersburg Sen-tinel, E. H. WERT, W. H. FELDMAN, W. A. KUMP, W. D. MAYNARD, R. C. WRIGHT, Committee. THE PROGRESS OF MESMERISM. THE world to-day is alive with scientific investigators. Who will be the next to affix his name to the scientific roll of honor ? Such was the question that forced itself into the chemical brain of William Belshazzar Lutz but a very short time ago. Outside of compounding vile chemical mix-tures in the laboratory, the subject of mesmer- , ism has been the one absorbing topic that has occupied the mind of this gentleman for many years. Ofttimes when the bell in the tower would toll forth the silent hours of midnight, and when the rest of his college mates were wrapped in the sweet embrace of slumber, this devotee of science, with his face wreathed in smiles, would read how Joseph Smith, the great Mormon leader, had practiced the virtues of animal magnetism upon his credulous followers. Why not put this art to a more noble use ? Lengthy and deep were the medi-tations which followed, and many were the conclusions at which he arrived. His plans being formulated, the one great thing that re-mained to startle the scientific world with the results of his study was to make test of the same by practical experiment. Who should be the subject of experimentation ? This new and great difficulty now confronted him. The mesmeric ability of " Homer" Kloss, that lengthy man of antiquity, was well established. After mature deliberation, he resolved to give him a share of his confidence, and to make him the first and only partner in his mesmeric firm. These two worthy Juniors, the convolu-tions of whose brains are deeper than the teeth of a ten-foot ice saw, persuaded Freshman Carty and " Sister " Hedges to permit them-selves to be operated upon. Carty, whose will-power is remarkable, proved himself to be but a poor subject. " Sister " next seated him-self in the experimental chair, and Belshazzar, with a flourish of his hands that would have rivaled that of an Indian juggler, soon had his patient under mesmeric influence. The opera-tor softly whistled " Annie Rooney," and when the music had ceased the circus began. " Sister " performed all sorts of queer pranks. He washed his face with Sozodont. He jumped on the springs of Belshazzar's bed, and said he was riding in a Pullman palace car. He combed his hair with a broom, and put on a storm overcoat, saying that it was about time he had found his linen duster. He lathered his face with blacking, and tried to shave with a yard-stick. He imagined he was Bare's phonograph, and, when asked to hum a good old gospel hymn, he whistled " Reddy Get Your Hair Cut." He brushed his toe-nails with tooth-powder, thinking his teeth were at his pedal extremities. " Enough !" the brilliant operator exclaimed. "Now, gentlemen, allow me to remove the charm." His hands flew heavenward over " Sister's " face, but, alas, the patient only rolled his eyes and groaned. The operator was startled. Again he tried to break the spell, but a deeper groan and a more horrible rolling of eyes was the only result. The operator was unnerved. A third attempt was made, but groans and sighs that would have wrung the heart of any human being were the only response. The wildest alarm now followed. Never was there such consternation since the infernal fiends THE COLLEGE MERCURY. 59 were pitched over the " battlements of heaven." Belshazzar, naturally a religious man, gathered together all the busts of the immortal gods, and, having placed them on a copy of Clyde " Remsen's" Chemistry, prayed to each one separately. He besought Bacchus to pour some fire-water down his patient's throat and thus restore him. He tearfully asked Zeus to hit poor " Sister " with a thunderbolt and awaken him. He prayed Neptune to run his tri-dent through " Sister's " hair and electrify him out of his accursed spell. He prayed Apollo to shoot him with a golden arrow. He prayed jEolus to squash him with an Omaha cyclone. He prayed Vulcan to hit him with a brand new sledge-hammer, " but not too hard, dear Vulcan." He sought the aid of Juno, but Juno wasn't " in it." He prayed to Venus, but Venus said he had sported around the " Kee-Mar " girls, and she would have nothing to do with him. He lastly besought Minerva to grant him enough wisdom to restore poor " Sister," but Minerva did not look with appre-ciation upon the actions of such mortals as himself. Finally, in despair, he borrowed a new Columbian cent from his partner, " Homer," and, having placed it between his patient's teeth, he prayed that Charon might successfully ferry him across the hated river. But a greater surprise was in store for him. Belshazzar glanced toward the wall, and there an unknown hand was busy tracing, in bold hieroglyphics, the following terrible words: " Take him up town, set up the ice-cream, and get a Freshman to sleep with him." Only too thankful to follow some kind of directions, Belshazzar complied with the strange request, and the next day his patient was fully restored. Billy's scientific aspirations are now buried in the depths of the " Tiber." Like many other would-be scientists, he will eke out his exist-ence only as a disappointed and heart-broken man. But, what is still harder to bear, he has learned that the human heart is desperately wicked and deceitful above all things. The whole thing was a farce, for his partner was in league against him, and the joke was only brought to a beautiful termination by " Sister's " apparent innocence. " SUPER." AN EPISODE. He went to hear the phonograph, With her upon his arm ; He entertained her with his laugh, She with her eyes did charm. And when, the entertainment thro', They homeward took their way, They did not cease to laugh and coo, And much they seemed to say. She lolled her eyes, until her glance Beamed on his lovely face; And then, by some peculiar chance, Unknown to such a case, He turned and met those lifted eyes, And smiled his sweetest smile; For he did naturally surmise She loved him all the while. But next day, when the sun was bright, She, with those eyes of blue, Her lover had forgotten quite; For light made love untrue. Tho' in the dark she favored one, Yet, when it did come day, Round in the tennis-court she'd run And shout " Love thirty-Play." A. H. B., '96. SPECIALISM: ITS NECESSITY AND ITS DANGER. FIELDS of work, like fields of grain, look all green from a distance. In the general view, which is all that we commonly get of a science or an art, it is attractive, and like Hamlet we are apt to see the charms of each path so clearly that we are loth to choose one and forego all the rest. There is nothing more delightful than to take such peeps into the treasure boxes of knowledge as the maga- | zines afford. But not in such a way can one become the owner of a jewel or even tell the diamond from the paste. Yet it is often said that the periodicals are convenient forms in 6o; THE COLLEGE MERCURY. which to get the information that makes a " well-rounded man." Nothing more false! The well-rounded man is not the one who is symmetrical because of equal supcrficialty in all parts of his mind. For making a fine im-pression it is enough to converse about books which have been reviewed in the Pacific Monthly, but the habit is weakening to intellect and character. This is somewhat from the subject, but is a plea for the " man of one idea " over against the dead-level man of no idea. It is often said that a man never again knows so much as he did when he was a Senior at college, and it is because a man reaches the period then when he has just looked into the open gates of history, science, language and literature, and sees beautiful vistas of trees laden with ripe fruit. He has not yet learned of the labor of which he sees the result. He offers immense chunks of wisdom from what department you will, but after a while he begins to see that he was borrowing, and that he did not under-stand whereof he spoke. Then he wants to know something. One says to himself, I will pursue Science, and then decides that a life-time is too short for that, and says, I will learn Geology, and finding that too large, seeks to find the language of fossils. At last he begins to know something. Another will sacrifice all else to History, but how can he for himself find out anything when so much ground is to be covered ? He narrows himself to the history of Italy, but again he must take his knowledge second-hand, and finally, when he has become modest enough to confine himself to Florence or Venice, he says, this one thing I can know. And then a man becomes a power. Then he can be something more than a sponge, and leave a mark to show where he has been. Nature holds more truths ready for the dis-coverer than she has given up to Darwin. The world is learning fast, and it seems that it is learning so many new things that old tradi-tions cannot give way fast enough. Perhaps, j therefore, there will be a pause in religious in-vestigation until the Church can chew the large bite thrust into its mouth. But the energy will go into some other department. Deep dark-ness is all around us. Exploring parties go on in one direction until they are frightened by the distance they have come, then wait for the rest of men to come and occupy. Hut while they rest another party of specialists is en-larging the lighted area in another point, and so, by each individual working away at his one idea, the people get more light. It is surprising how much can be done in the knowledge of books by those who can give only surplus of time to them, if the study is specialized. Most of those who know why Shakespeare is the greatest poet that ever lived have read him from their youth up. He has been a companion of many men all through life. By giving themselves up to him, and growing into him, they have learned the secret of his greatness, have known him. What can be gotten from reading tons of criticism and ephemeral talk to compare with this intimate acquaintance with one or two great minds. By such specialization a man is developed. He reads literature as it ought to be read, namely, as thing inseparable from living, and not as a literary exercise. Hence he will be free from pretentiousness. One result of the other method is to tempt to a display of knowledge which is only on the surface. " Knowledge comes, but wisdom lingers." Objections are heard to specialism and specialists. It is said that those who give a great part of their time to either art or the pursuit of knowledge become self-absorbed, absent-minded, and egotistical. It ought not to be so. If it is the case, they are getting more than they can digest. They are apply-ing more to the surface than can be absorbed into the inner man. Ambition often drives the worker to this forcing process, and it can-not fail to have evil effects on his character. This, then, is a danger of specialism ; this is the abuse of the good thine. The man ought THE COLLEGE MERCURY. 61 PROOF-READING—MENTAL AND MORAL. to grow with his work. No matter how special his department, his acquirements ought to spread their influence through his nature j and leaven the whole. If, on the other hand, it takes the form of an outside excrescence, not only is it valueless, but also, as we are naturally more vain of the things we have ac-quired than of those we have by nature, the student fails to recognize it as a deformity, and feels pride in his borrowed glory. It is the old story of the peacock proud of his voice, j But this is only when conditions are abnormal. ' Healthy work on a chosen subject makes the mind broader, opener, greater in every way. It makes a man more capable of friendship and of higher feeling ; it raises the plane of his life. The man or woman who knows one thing has an anchor. He is no longer the slave of every doubt. He need no longer be a led-horse. He has some equipments for fighting the bat-tles of his own mind and for facing the ques-tions which assail every man. M. W. CROLL. TO the uninitiated eye, there is an air of deep mystery about the mutilated text and hieroglyphic margin of a corrected proof-sheet. The ranks of printed words have a grim and battle-scarred look, like a veteran regiment with tattered flags and ragged uniforms ; the gaps left by fallen comrades are not yet filled, and many of the survivors bear abiding marks of the stern conflict through which they have passed. The marginal corrections, in every variety of curve and angle, irresistibly suggest the bursting bombshells and bayonets keen of thrust which have wrought such havoc in the brave array. But these are only fancies ; and our supposed observer, being presumably of a practical turn of mind, soon seeks to discover a more intimate i relation between the text and the corrections —the casus belli, so to speak, which has occasioned this pitiless decimation of the soldierly ranks. A comparison of the marks in the text with those on the margin soon reveals the purport of the strange hieroglyphs, and the investigator sees how, by means of a few strokes and letters, omissions are supplied, confusions rectified, and intruders expelled, all with a view to the ultimate perfection of the text. A brief inspection will probably suffice to convince him that proof-reading is a very easy thing indeed. Yes, the typographic symbols of the proof-sheet disclose at least a part of their meaning without much difficulty to an intelligent observer; but to the mind of one who com-bines some degree of experience with his observation, the same lines and curves have another story to tell. To him they speak of that eternal patience which is yet not genius:— that patience which scans and scans again the printed lines, striving to detect the smallest error, until it seems that not so much as the ghost of a mistake can lurk within the tangled maze of words ; that patience which even then is not satisfied, but still scrutinizes each sentence over and over, going beneath the mere form of the words, not content until it has endeavored at every doubtful point to fathom the author's meaning, lest some mis-placed phrase, some intruding word, some omitted sign, should obscure the thought and frustrate the purpose of the writer. Such is the patience which perhaps of all patience sees the least result of its own toils, and has least confidence in the correctness of its own work— the keen-eyed patience of the proof-reader. But this is not all that the proof-sheet sug-gests. Strangers though most of us may be to the actual task of correcting proof, we are daily and hourly applying the methods of the proof-reader to the products of our mental activity and to the conclusions of our judg-ment and experience. The more we learn, the more deeply do we realize how much of our knowledge and belief is merely tentative—how frequently our opinions must be altered and revised, and how few of them can be depended 62 THE COLLEGE MERCURY. upon as absolutely correct in every particular. Even what we call facts are often largely relative, and the slightest change of circum-stances may introduce variations which will overturn our most careful inductions and dissipate our most ingenious theories. There is in almost all our thinking an element of un-certainty similar to the feeling of the proof-reader— a doubt that lingers after the most painstaking revision, and questions whether there may not still be somewhere an un-detected error which must be discovered and eradicated before the opinion or system of thought can be trusted. While it is unworthy of a rational being to accept a belief without good reason for its entertainment, it is equally irrational to close the mind against conviction, and to refuse, either from obstinacy or from indolence, to revise an opinion whose faulti-ness has been shown by the light of increased knowledge. The man who would rather think wrongly than incur the trouble of correcting his thinking needs to take a lesson from the proof-reader. Not only must our opinions be ever open to revision, but a similar method must be pursued in the developing of character. Our lives are not what the Author of our being intended them to be. An adverse force has twisted and marred and spoiled them, yet so artfully that we do not recognize it until we test them by the standard of the highest Truth—the only truth which is absolute. Then we cannot help seeing how faulty and incorrect our lives really are ; but it is so hard to change them ! An uncorrected proof-sheet looks so clean and fair beside the scarred face of a sheet that has been revised! As long as one does not read the former closely, the mistakes will not be noticed ; and so we are tempted to think that no one will mark our shortcomings unless our correction of them draws attention thereto. And these are the hardest of all errors to remedy—hardest to detect and hardest to elim-inate ; but if we would be true to our highest interests, we must not evade the task. We need not always perform it alone. A proof-sheet has far more chance of being correct if several readers have perused it; for one may detect what another has missed, and a third may notice what has escaped the others ; and so it is in moral proof-reading. " In the multitude of counselors there is safety." Not all persons, indeed, are willing to tell us of the faults they see in us; but as long as there are candid and truthful souls on earth, we need not fear that we will be left in utter ignorance of our defects. Happy are we if the lips that tell us of our faults be friendly ones. Nor is this the only assistance that we have. The author of a production is best qualified to read its proof, since he is so well acquainted with the form and sense of the original; and in reading the proof of our lives, we may always have the assistance of the Author, if we will. And when, at last, every error has been rectified, the corrected pages will not be allowed to remain marred and mutilated, any more than the finished book is composed of the disfigured proof-sheets. The final copy will be not only correct, but clean and beauti-ful as well; and the Author, seeing His pur-pose wrought out and His thought expressed in all its pristine perfection, will pronounce it very good. M. R. H., '94. PAPA H 'S SOLILOQUY ON THE DAY THE KEE-MAR GIRLS WERE HERE. To go, or not to go, that is the question :— Whether 'twill be better in the end to go With the pretty Kee-Mar girls from Hagerstown ; Or not to go, and run the risk that they will Think us slow: That must not be; too slow; but yet, If I should go, what would Miss H J say ? Would She permit me thus to flirt the whole day long With pretty Kee-Mar girls, and not object ? If She were only out of town to-day;—this day; That's a consummation devoutly to be Wished; but, then, she isn't—ay ! there's the rub. Dear me ! Now I almost wish that I had never gone To Middle Street until this day had passed. But Yet, we cannot always look ahead to times Of so great moment; and now I must decide. THE COLLEGE MERCURY. 63 When such grave questions stir the souls of men, No wonder that we hesitate. If I were (Inly familiar with such questions, 'twould be Far different; but as I've never gone with The girls before this year, I don't know what to Do. But, then, I am a Senior and that makes Up for all deficiencies, and Miss H will Not jilt me; for, if she did, who would translate Her Latin lessons? But conscience does make Cowards of us all. I have decided. I'll go, and if the boys Do tease me, I'll not mind it. Ha! ha! Yes, that Reminds me of a fox and a grape story I once read. 1 fully realize that I am risking Much ; but this is an opportunity of A lifetime. Some of my Kee-Mar friends are from Washington, and quite elite, you know ; much so, Tis said. And as I am a Senior of our Beloved G. C, perchance I may—, but I won't Soar too high, lest with broken pinion I fall Back crushed. But what's the use of further meditation. The die is cast. I am resolved to go. COLLEGE LOCALS. ALBERT S. COOK and SUMNER R. MILLER, Editors. AT last the long-expected and much-talked-of visit of the Kee-Mar girls to historic Gettysburg is an event of the past, and the College boy consoles himself, while he nurses his empty wallet, by thinking and talking of the fair one whose guardian angel he was on that glorious day, Saturday, May 13th. Ever since the Musical Clubs were at Hagerstown, this proposed visit has been looked forward to with the greatest pleasure and expectation. The boys were royally re-ceived and entertained by the ladies of Kee- Mar, and they were only too anxious for an opportunity to return the kindness shown them there. The disappointment of the previous week increased this desire, for it had caused many bitter sighs and " weeps." All was excitement here on the morning of May 13th. Nearly all the boys were dressed in their best, and some of those who had never been known to " dress up," except on Sunday, were " sporting around " with the others. The Kee-Marians owned the battle-field, the town, the college, the boys, " and all the ap-purtenances thereof." The fellow who didn't have a girl wasn't "in it." Many were the hearts that were broken and the tears that were shed on parting ; but the boyshavemany mementos of the happy time in the shape of photographs, etc., which will ever be a source of pleasure to them. Dr. Keedy, whose kindness made it possible for the boys to have a good time, is most warmly praised, and their fondest wishes are that he may long continue to be President of Kee-Mar College, and often repeat the visit of May 13th. On Monday, May 15th, the ladies of Wilson College, Chambersburg, visited Gettysburg. Dr. Edgar loaded the girls into hacks outside of town and did not permit the boys to get near them. It was very considerate on his part, as the boys were all "dead broke," owing to the visit on the Saturday before. Examinations are rapidly approaching, and the Seniors are busily engaged on their Com-mencement work. The general inclination of the boys for the past week or two has been to imprecate the weather, and rejoice over the absence of several members of the Faculty. 'Rah ! 'rah ! 'rah ! —'rah ! 'rah ! 'rah ! Penn-syl- va-ni-a! was replaced by 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! Gettysburg ! at a recent mass meeting of the students in Brua Chapel, April 29th. A second yell, Hoo-rah ! hoo-rah ! hoo-rah ! Get-tys-burg-i-a ! was also adopted. The value of having several yells was demonstrated during the Dickinson game, as was also the necessity of practicing them before trying to give them. It is rumored that some of the boys find more than flowers on their botanical excur-sions. Grave charges against some of the pro-fessors have been floating around the college during the last few weeks. They are accused of having stolen " horses " in broad daylight during the late racing season, and their owners declare that they continue prowling around their stables. Let the owners of " blooded stock " keep a sharp lookout lest their " record-breakers " be led away during the coming races. We suggest that the owners build hedges around the entrances, and fill the inter-vening spaces with (k) erbs. He was wheeling the carriage along the back streets, the while talking to a pretty com- <*4 THE COLLEGE MERCURY. panion, and one naturally made a slight mis-take, but the occupant of the carriage belonged to a different duffer. Dr. N.—" Gas tends to escape from open vessels, because it is lighter than air." S., '94.—" Can't you keep it in by putting a cover on the bottom ?" B-» '93-—" I think we will have a thunder-storm to-day—I feel it in my head." —, '95 (unconsciously).—" Your head must be a little bar(c)ometer." The latest chestnut.—" Pappy, when will the invitations be here ?" The next latest.—" Ben, when will The Spectrum be out ?" " Good-morning, Mrs. Smith." " Good-morning." "Any ice?" "No ice." "No ice? Get up J" Prof H.(in rhetoric).—" What is the theme ?" H., '95 (after thinking awhile).—" The theme of what, professor ?" E., '95, wishes to inform his friends and classmates that he has a large supply of " in-dices rerutn " on hand. • B.,/95, junctive?' -" Doctor, what tense is that—sub- L, '94 (just finishing speech on " Cleve-land's Cabinet").—"Professor, I forgot Mr. Smith, shall I bring him in now ?" Prof. H.—" Yes, bring him in." R, '94 (translating " Die Friede wohnt in diesem Kleide ").—" In this garment priests-beasts dwell." W., '95 (translating Homer's description of Thersites).—" There was a very ugly man came from Troy. He was cross-eyed, and his other foot was lame." Dr. N.—" Mr. C, put the multiplication table on the board for me." C-i '95-—"Doctor, I don't just know what you mean." Dr. H. (in English Bible).—" Mr. H., can you give me the etymological meaning of ' transgress ?' " H-, '95-—" Handed down from generation to generation." R., 95.—" Say, Jones, where is your hornet? I want to serenade my girl to-night." S., '94 (learnedly discoursing at table).— " Yes, the German pheasants eat rye bread and are healthy." Miss B., '96.—" Look here! this book tells you ' How Plants Grow—Gray'—that must be interesting." Dr. N.—" If I should throw a piece of chalk-up in the air, would it start a train of thought in your mind ?" N., '94.—" I don't know, Doctor." We are pleased to inform all that Nick has resumed his cordial relations with Grand-mother Pitzer. Dr. B.—" Marriage is of much more import-ance than most people make it." " Homer" (emphatically—just rousing from a day-dream).—" That's right." W., '95.—" I do wish Hill would pitch some of his straight curves." Dr. N.- Mr. Kemp, what is 'specific gravity ?'" K., '94.—" Pacific gravity is when a body is in motion it remains in motion, and when at rest tends to remain at rest."—Kemp studied Neptune's Oceanic Physics before coming here. A Senior says he has a dim idea how it goes for a woman to put up her hair. We gu(e)ss he does. Dr. S.—"What are warm-blooded ani-mals?" E., '96.—" Quadrupeds, such as men and birds, are said to be warm-blooded animals." E., '96.—" I have been out to Culp's Hill all morning." S., '96.—" Looking for flowers ?" E., '96.—" No, bullets don't grow on flozucrs!' Dr. H.—" How did Aaron excuse himself for making the golden calf?" L, '96.—"And Aaron said: 'The people brought their earrings to me, and I put them in the fire, and there came out a golden lamb! " The following letter was sent to Philo. Society by O. W. Holmes as a letter of en-couragement to its members. Mr. Kuhns, who solicited the autograph, deserves high praise for his wide-awake activity in behalf of his society. THE COLLEGE MERCURY. 65 BOSTON, May 6th, 1893. DEAR SIR :—I am much pleased to hear that the students of Pennsylvania College are diligently studying the best authors of their country, and, if by their indulgence my name is found among them, I will trust it to their charitable judg-ment. It is well that they should read French and German—that they should study the Greek and Latin classical writers, but best of all that they should be well acquainted with the mas-ters of their own language—for the only tongue a man thoroughly knows is the one he learned to speak through his milk-teeth. With heartiest good-wishes, yours very truly. OLIVER WENDELL HOLMES. Y. M. C. A. NOTES. On Saturday evening, May 20th, in Brua Chapel, Mr. Walter Pelham gave his excel-lent and amusing character entertainment, under the auspices of the Lecture Course Com-mittee. The audience received, with great ap-plause, the renditions of this celebrated im-personator. The Association has authorized delegates to be sent to the Northfield Training School, and it is probable that we will be represented also at the Lake Geneva (Wis.) School. The efficiency of the local work of our Y. M. C. A. would be greatly increased if we were provided with a separate building for Associa-tion purposes. The need of such a building has been felt for some time, and a Building Fund has been slowly accumulating. We believe the cause is worthy of outside help, and all receipts from Alumni and friends will be gratefully acknowledged. Among other things of interest to the As-sociation, the delegates to the Carlisle Confer-ence of Y. M. C. A. Presidents report that our Association has a larger percentage of students engaged in systematic Bible study in classes than any other institution represented at the conference. This shows the result of the earnest and repeated efforts in this line, and is most gratifying. But from the same source we learn that our work in the cause of Christian missions has not come up to a desirable standard. It is earnestly hoped that more active interest will hereafter be taken in the cause of missions. There is need for men to carry the Gospel to the young men of foreign lands who are with-out the blessings we enjoy, and the obligation largely rests upon us. The men are ready to go, the one thing needful is funds to send them. The attendance at the devotional meetings still continue to be good, and the meetings are made both interesting and profitable. Let us all put forth every effort to keep up the good attendance during the remainder of the term, and the good results will be veiy apparent. PENNSILFAUNISH DEITSCH GESELLSCHAFT. Schon etlicha yohra hen die Studenta g'schwetst fuhn en Pennsilfaunish deitsch societie ufgriega; aber es is alia mohl darich g'falla; die Ursach wahr das sie gemehnt hen dass es net 11 f g'halta sie kennt. Now des wahr all g'schwets. Sie hen ahner a dinger uf griega kenna un die hen auschalda, un fer-was net soh eppes. Aber sacha sin now ahnister. Letscht Dinshtag Ovet, der 23sten Moy, sin sechtza deitsha tzamma komma im Briider Bortner sei Sthup undhen en organ-ization g'formed. Die sin Charter members. Es wahr en enthusiastic meeting. All die members missen deitsch schwetsa kenna, un kenn English wort is erlaubt im meeting. Die object fun die verein is, ehrst, das wir Deische, unser Mutter sproach net gohns fergessa sol-len; un, tzwet, dass wir tzamma sticha sollen in en binderlicher weg. Die officers sin: President, Briider Bortner; Vice-President, Briider Ibach ; Secretary, Briider Newcomer ; Treasurer, Briider Kump; Gahrt, Briider Menges. Die charter members sin Briiders Dundore, W. H. Ehrhart, Uhler, Ibach, Nicholas, Rudi-sill, Becker, Nipple, Newcomer, Kump, Meisenhelder, Menges, Danner, Smith, Hain, Bortner. Professor (looking at his watch).—"As we have a few minutes I shall be glad to answer any questions that any one may wish to ask." Student.—" What time is it, please ?"—Ex. 66 THE COLLEGE MERCURY. ALUM/SI. FRANK E. FICKINGER, Editor. WITH this number of THE MERCURY, a new editor of this department appears before you. It will, perhaps, be necessary to say nothing more than to reiterate the words of the former editor, in outlining the aim of the Alumni Department to be that of keeping the former graduates in closer touch with one another, with the undergraduate, and, in chief, with their A/ma Mater, and likewise to repeat his requests, earnestly soliciting all proper in-formation, both concerning yourselves and others, that you may be disposed to give. Let the Alumni Association at its Commencement meeting not fail to elect a wide-awake inter-ested man as Alumni Editor. The success of THE MERCURY depends in great part upon the attitude of the Alumni toward it, and we would therefore most earnestly hope for your hearty co-operation, sanction, and support in the June meeting. We trust we will not be disap-pointed. We are pleased to learn that the class of '78 will hold a reunion in Gettysburg, with a banquet at McCullough's cafe, on Tuesday evening of Commencement week, June 20th. Other reunions are being talked of, but as yet nothing else authentic has come to our ears. Let us have a large representation of the Alumni with us this year. Your presence is inspiring both to the professors and to the students. '39. Rev. Dr. C. A. Hay, of the Seminary, delivered the address at the laying of the corner-stone of St. John's Lutheran Church, Steelton, on Sunday. '39. Rev. P. Willard, now at Mexico, Pa., is writing a history of the Orphans' Home at Loysville, Pa., of which he was the founder and for many years the superintendent. '44. Rev. P. Anstadt, D. D., of York, Pa., will install his son as pastor of the Lutheran Church at Bedford, Pa. '48. Hon. Edward McPherson, one of the executors of the estate of the late Hon. Thad-deus Stevens, filed his report the early part of May. The bequest of $1,000 to Stevens Hall (the Preparatory Department of our college), is sustained with interest. '49. Judge Wm. McClean began his series of lectures to the Senior class on Constitutional Law last Wednesday, the 24th ult. '51. Hon. David Wills, of Gettysburg, was in attendance as delegate from the Carlisle Presbytery at the General Assembly of the Presbyterian Church which convened recently in Washington, D. C. '53. Rev. P. Bergstresser, of Middletown, Md., will not remove to Chicago as stated in the last number of THE MERCURY. '55. Philadelphia, Pa.—The day for the dedication of the new Calvary Lutheran Church, Rev. S. A. Holman, D. D., pastor, will doubtless be fixed for Sunday, June 18th. '55. Rev. Dr. Huber, professor and chaplain in the college, contemplates building a resi-dence this season on his lot, on the northeast corner of Carlisle and Lincoln Streets. '57. President C. L. Keedy, of Kee-Mar College, Hagerstown, Md., has been appointed Vice-President of the Department Congress of Higher Education to be held at the World's Fair. On May 13th, the doctor, with a party of 35 of his charming students, visited the battle-field. The Kee-Mar girls and the Get-tysburg boys are always on the best of terms, so of course—well, you know—everybody had a nice time. '59. On Sunday, May 7th, Rev. J. G. Goett-man, D. D., pastor of Trinity Lutheran Church, Allegheny, Pa., preached the third in a series of inter-denominational sermons in progress in that city on " Why am I a Lutheran ?" The Doctor's congregation has arranged for an excursion to Gettysburg in June, to be present at the college Commencement and to view the battle-field. '61. Bethlehem Lutheran Church of Har-risburg, Pa., has extended a call to Rev. I. C. Burke, of the Third Lutheran Church of Baltimore, Md. Rev. Burke has been pastor of the latter church for sixteen years. '61. Rev. J. R. Williams, of Uniontown, Md., has received and accepted a call to the Millers-town charge, Chicora, Pa., and will begin his labors June 1st. '64. Rev. H. J. Watkins, pastor of the Luth-eran Church at Lockport, N. Y., recently cele- THE COLLEGE MERCURY. 67 brated his 55th birthday, when he was pleas-antly surprised by a visit from the pastors of all the other churches in the city, accompanied by their wives. The evening was spent in a most enjoyable manner. '65. Dr. McKnight, from latest advices, is at present in Paris, having left the Mediter-ranean coast very much benefited in health. The time, till June 8th, when he sails from Southampton, will be spent in sight-seeing. His full and complete recovery is earnestly and universally hoped for by the students. '67. Rev. Charles S. Albert, D. D., of Balti-more, Md., was elected president of the Gene-ral Synod, lately in convention at Canton, O. '67. Rev. W. E. Parson, D. D., has been secured to deliver an address at the Chicago Lutheran Congress on " Liberty in the Luthe-ran Church." '68. Rev. D. L. Mackenzie lately had an article in the Sioux City Times, entitled " Now and Then." '68. We were pleased to greet on our streets, the latter part of April, Rev. R. F. McClean, formerly of New Bloomfield, Pa. (pastor of the Presbyterian Church), but now located tempo-rarily in Carlisle, Pa. Sunday evening, April 30th, the reverend gentleman preached a most excellent sermon in the College Church. '68. Rev. J. W. Richard, D. D., of Gettys-burg, Pa., will next year deliver a course often lectures on Ecclesiastical Architecture. These lectures will treat of the history and develop-ment of the Roman, Gothic, and Italian archi-tecture. '69. The opening sermon of Rev. J. A. Clutz, D. D., the retiring president of the General Synod, was published in full in the Lutheran Observe}-, and is a masterly produc-tion. Dr. Clutz has been invited to deliver an address before the Lutheran Congress at the World's Fair. '70. The Board of Directors of the German Lutheran Theological Seminary, at Chicago, have elected the Rev. G. F. Behringer, A. M., of Saddle River, N. J., professor of Systematic and Exegetic Theology in that institution. '71. Rev. D. T. Koser, of Arendtsville, Pa., with his brother, A. S. Koser, of Muncy, left home the latter part of May for an extended trip to California and through the West. '71. Rev. W. H. Dunbar, D. D., of Leba-non, Pa., will preach the Baccalaureate sermon to the graduating class of the college on Sun-day, June 18th. Rev. Prof. Jacob Yutzy, '76, of Selins Grove, will deliver the annual address to the Y. M. C. A., on the evening of gradua-tion day. The Alumni address will be deliv-ered on the evening of June 21st, by Mr. Sterling Valentine, Ph.D., '82, of Lebanon, Pa. '73. Rev. Philip Graif's congregation at Oakland, California, will in a few days break ground for their new church edifice, which will be exceptionally handsome. '74. Rev. F. W. Staley, of Middletown, has been appointed by the General Synod as its fraternal representative to the next meeting of the General Convention of the Reformed Church in the United States, to convene in Reading, Pa., May 24th, 1893. '74. Rev. J. A. Wirt, of Hughesville, Pa., was here in attendance at the funeral of his father-in-law, the late Alexander D. Buehler. Rev. Wirt will preach a sermon to the Y. P. S. C. E., of Irving College, Mechanicsburg, June 4th. '75. Rev. E. G. Hay, of Pottsville, Pa., visited his parents in Gettysburg during the first of May. '76. Rev. S. E. Smith, of Newport, Pa., after the General Synod, will spend several months in the West. '79. The corner-stone of St. Matthew's Lu-theran church, on the Manor near Buckeys-town, Md., was laid in the presence of a large congregation on April 23d. The sermon was preached by Rev. Luther Kuhlman, of Fred-erick, Md., president of the Maryland Synod. Rev. A. H. Burk is pastor loci. '79. J. B. Raby, Esq., formerly corporation lawyer for Frick Co., Waynesboro, Pa., has opened a law office in that city as a practic-ing attorney. '80. Rev. A. H. F. Fisher, wife and son, of Barren Hill, Pa., spent a week in Gettysburg the latter part of May, visiting Mrs. Fisher's mother, Mrs. Picking. Mr. Fisher speaks in terms of the strongest commendation of his people at Barren Hill. 68 THE COLLEGE MERCURY. '80. The corner-stone of Rev. M. P. Hook-er's new church edifice at Steelton, Pa., was laid on Sunday, April 30th, amid large crowds and imposing ceremonies. '80. Rev. L. B. Wolf, President of the Watt's Memorial College, Guntur, India, ar-rived in Gettysburg, Wednesday evening, May 17th, after an absence of five years. After a few days' visit among friends and relatives, he repaired to the meeting of the General Synod, leaving his family here. '82. Messiah Lutheran Church, Philadel-phia, Pa., of which Rev. M. H. Valentine is pastor, at a recent effort, raised $2,000 toward making repairs and alterations in the church edifice, which was damaged by fire several months ago. '82. The Pennsylvania Lawyer, containing abstracts of the laws of Pennsylvania, and of the postal, patent, copyright, and pension laws, with legal and business forms, is a new book-by W. C. Sheely, Esq., of this place. It is published by L. G. Firestine & Co., of Mechan-icsburg, and sold by subscription at $4 and $5 per volume of about 700 pages. '83. The Second Lutheran Church ofJohns-town, Pa., Rev. G. W. W. Amick, pastor, has built a parsonage for its pastor. '83. Rev. Wm. W. Anstadt, pastor of the Lutheran Church at Bedford, and Miss Mary Alice Hantz, were married at the residence of the bride in York, Pa., on Wednesday evening, May 3d. The ceremony was performed by Rev. P. Anstadt, D. D., '44, father of the groom. '83. Rev. H. L Yarger, of Lawrence, Kan., will address the Y. M. C. A. at Midland Col-lege, June 7th. '84. The work of Rev. L. M. Zimmerman, pastor of Christ Lutheran Church, Baltimore, Md., has received the highest commendation at the hands of the city papers. The Balti-more Herald, of May 7th, contains a three-column review of his six years of labor there. '85. Rev. L. E. De Yoe, pastor of the Mes-siah Lutheran Church, Harrisburg, Pa., preached a sermon to the G. A. R. posts of that city on Sunday, May 28th. '85. We congratulate Mr. S. S. Neely, Esq., on his appointment by the Government as statistical agent of the State for the Agricul-tural Department. Mr. Neely's duties in his new position will not be of a very onerous nature, we understand, while the attendant salary is quite a lucrative one. '86. Rev. Prof. O. G. Klinger, principal of the Preparatory Department, spent a week in New York, recently, in the interest of the col-lege. '87. Hagerstown, Md.—Rev. S. E. Bateman, pastor of St. Mark's, has been called to All Saints, Philadelphia. His success in building up a new congregation, and erecting in a grow-ing part of the city an attractive and comfort-able chapel, has brought this popular and efficient worker into deserved prominence. '87. Rev. W. F. Steck, having accepted the call extended to him by the Lutheran congre-gation of Port Royal, Pa., has left the people of his former pastorate amid universal regret. May success attend him in his new field of labor. '88. The Church of the Reformation, Balti-more, Md., of which Rev. D. Frank Garland is pastor, was dedicated on Sunday, May 21st. The exercises consisted of a dedicatory ser-mon at half-past two o'clock, by Rev. J. W. Richard, D. D, '68, of Gettysburg Theological Seminary, and a sermon at eight o'clock in the evening by Rev. J. G. Morris, D. D., LL D. Short addresses were made by the pastor, by Rev. Charles S. Albert, D. D., '67, Rev. H. F. Kroh, '84, and others. '88. Rev. C. A. Hoy, Orrstown, Pa., reports having resigned his charge on the 21st inst, to accept a new mission congregation in south-east Philadelphia. '89. Rev. S. J. McDowell was installed as pastor of Emmanuel's Lutheran Church, Fries-burg, N. J., on Sunday, April 16th, by Rev. Dr. Enders, of York, Pa. This is one of the oldest Lutheran churches in America, having been founded nearly two hundred years ago. Mr. McDowell is performing an excellent work among his people, and has earned the esteem of the entire community. '90. C. B. Fager, Jr., Geo. B. Kunkel, and Wm. H. Ulsh, received their degrees of M. D. from the University of Pennsylvania, on May 10th. We expect the gentlemen to be with us Commencement week. THE COLLEGE MERCURY. 69 '90. L. M. Kauffman, lately graduated among the first in his class from Bellevue Hospital Medical College, is practicing his profession with his father at Kauffman, Pa. He was offered a hospital appointment, but declined. '90. Rev. N. E. Yeiser and wife, recently-sent by the General Synod of the Lutheran Church as missionaries to India, arc for the present living with Dr. Kugler and Miss Fannie M. Dryden, two lady missionaries who have been there some time. '91. D. A. Buehler, now with the A. E. Footc Co., wholesale dealers in scientific books, Philadelphia, Pa., was at home in attendance at the funeral of the late Alexander D. Bueh-ler. '92. We were glad to greet again on the campus, recently, Mr. H. H. Jones, who has spent the past year in the Medical Depart-ment of Maryland University; also Mr. E. J. Cook, an ex-member of '92, who has been, during the past year, principal of Bel Air Academy. Mr. Cook expects to study law after taking a short trip to the World's Fair this summer. '93. Mr. M. C. Wright, formerly of the class of '93, in Gettysburg College, graduates this year in the regular classical course at Michi-gan University, Ann Arbor, Mich. '94. Mr. J. H. Fichthorn, who left Gettys-burg at the end of Freshman to enter Cornell, has been compelled to forego attending college, during the past term, from weakness of the eyes. '94. We were pleased, indeed, a few days ago, to once more greet Mr. R. E. Miller, who the past year has been taking private tutorship at home, under the able direction of Mr. F. E. Metsgar, '88. Mr. Miller expects to join his class again at the opening of next year. F-RATEKMITy /NOTES. PAUL W. KOLI.ER, Editor. PHI KAPPA PSI. Our symposium will be held on Wednesday, June 21st, at the Eagle Hotel. Bros. Clayball and Stitely, of Westminster, Md., helped to cheer our base-ball team on to victory during the recent game at that place. Bro. Keefer, Secretary of I. C. A. A., at-tended a meeting of that body, held at the Bingham House, Philadelphia, on May 20th. Bro. Hill, of town, paid our Chapter a visit recently. Bros. Turner, Keefer, Witman, and Russell are entered in the tennis tournament. PHI GAMMA DELTA. A new Chapter (V 7) of Phi Gamma Delta has been chartered at Trinity College. Bros. M. G. L. Rietz, '95, and Howard M. Plerr, '97, were initiated on Thursday, April 27th. We enjoyed a short visit lately from Bro. Fred. T. Howe, Ph. D.,of theBeta Mu (Johns Hopkins) Chapter, and editor of the Phi Gamma Delta Quarterly. " The Religious Element in Man " is the subject that has been assigned Bro. Blint, '90, for his Commencement thesis. Bro. Hoffcr, '94, represented us at the Pennsylvania State Convention of Phi Gamma Delta which met at the Wyandotte Hotel, South Bethlehem, Pa., May 4th and 5th. Measures are being taken for the establish-ment of an Alumni Chapter at Pittsburgh, Pa., and it is likely that a charter will be granted in the near future. Bro. David A. Buehler, '90, who at present is with the A. E. Foote wholesale scientific book firm, was in town to attend the funeral of his uncle, the late Alexander D. Buehler. PHI DELTA THETA. Bro. Cook, E. J., Principal of Bel Air Acad-emy, Md., was the guest of his brother over Sunday last. Bro. Maynard, '95, was initiated into the mystic brotherhood on the 20th inst. Bro. Gilroy, of Dickinson College, recently spent a few days in our midst as the guest of Pennsylvania Beta. Bro. Brallier will have the honor of being the Latin Salutatorian at the coming Com-mencement exercises of the class of '93. ALPHA TAU OMEGA. Bro. John W. Cable, Jr., '97, of Smithsburg, Md., was initiated April i8th, 1893. 7° THE COLLEGE MERCURY. Bro. Gco. A. Kyner, '89, attorney-at-law in Chambersburg, Pa., paid Gettysburg a fly-ing visit lately to see old friends. Bro. H. H. Jones, '92, who has been pur-suing a course of medicine at the University of Maryland, Baltimore, visited his Alma Mater on his way home. Bro. H. W. Jump, whom all will remember as the very able trainer of last year's success-ful foot-ball team at Gettysburg College, lately graduated from the medical department of the University of Pennsylvania. SIGMA ALPHA EPSILON. On the evening of the 10th inst, Pennsylva-nia Delta, the first chapter established north of the " Mason and Dixon line," was re-estab- Jished at our institution with the following charter members : John C. Grimes, '93 ; Geo. D. Danner and Jas. T. Povall, of the Fresh-man class, and Wm. R. McCartney, '97. Bro. Danner, '96, attended the Commence-ment exercises of the High School at his home, Manheim, Pa., on the nth and 12th of May. He presided over the annual meeting of the Alumni Association on the evening of the nth, held in the Reformed Church. Bro. Chas. G. Smith, '97, of Beaver Springs, Pa., was initiated on the 27th of May. Sigma Alpha Epsilon, of Gettysburg Col-lege, sends greeting to THE MERCURY. May it ever be a thorough representative of our in-stitution. Thanks to members of our sister fraternities for their congratulations. ATHLETieS. H. E. CLARE, Editor. THE present base-ball season opened April 29th with unprecedented interest. The team by its admirable playing has aroused general enthusiasm, each succeeding game raising the interest to a higher pitch. So far not a game has been lost, and the expecta-tions of the most ardent have been gratified. The sincere hope of THE MERCURY is that the season may close as auspiciously as it has opened, and from present indications we feel safe in saying that this hope will be realized. The first game of the season was played on the home grounds Saturday, April 29th, with Franklin and Marshall, but, owing to the in-clement weather, the teams were unable to play upon the grounds until 3 p. M., and as the visiting team was compelled to leave for the train at 3.30 P. M., the game was called in the second inning. Enough was seen to show what the home team could do, the score when the teams ceased playing being: Gettysburg, 11 ; Franklin and Marshall, o. On May 6th, the Indians of the Carlisle Training School played with our team on out-home grounds. The game was very close and interesting, especially during the first six inn-ings, neither side having scored a point. Then the tables turned, and the home team, by superb playing, scored six points and won the the game. Annexed is the score : GETTYSUUItG. INDIAN SCHOOL. Gies, c. f., . . Nicholas, i b., Kcefer, 3 b., . Hill.p Lcisenring, I. £, Tate, c, . . . Gilbert, 2 b., . , Hoffman, s. s., Erb.r.f.,. . . Totals, H. O. A. E. 3OOO Sh'na'do'h, 1 b., Toprock, 2 b., . Turkey,c. f., . . Lufkin, 1. f., . . Chief Eagle, r. f, Silas, s. s. and p., Taylor, 3 b., . . Eagle Feather, c, Nori, p. and s. s., H. O. A. E. O7O0 6 11 27 13 2 I Totals, 1 6 27 9 INNINGS. ■ Gettysburg, 00000041 1- Indian School o o o o o o o o 1- Summary—Earned runs, Gettysburg, 2 ; Indian School, 1. Three base hit, Turkey. Bases stolen, Gettysburg, 7; Indian School, 1. Base on balls, by Hill, 1 ; by Silas, 2 ; by Nori, 1. Hit by pitched ball, Toprock. Struck out, by Hill, 3; by Nori, 4; by Silas, 3. Passed ball. Eagle Feather. Time of game, 1.30. Umpires, Vastine and High Horse. Scorer, Keffer. All looked forward to May ioth with eager expectation, that being the time scheduled for our first game with Dickinson College. The expected day came and with it the game, but it proved to be so one-sided an affair that we were disappointed. From beginning to end Dickinson wasn't " in it." Himes made a miserable excuse for pitching, the home team knocking him all over the field to the intense delight of the spectators. The only playing done by the visiting team was in the field. Hill pitched a superb game, strik-ing out eight men. He amused himself with the visitors, three times hitting their bats, thereby giving them their three hits. When the last man was put out in the ninth inning, the spectators fairly rent the air with their cheering. .The crestfallen visitors slowly wended their way to the train that was to carry them away from the scene of defeat, while the dolefully tolling bell sent forth its THE COLLEGE MERCURY. 7% melancholy reverberations. Following is the score: GF.TTYSHURG. Gies, c. f., . . . • 3 Nicholas, 1 b., . . 2 Keefer, 3 b 3 Hill, p., ■ • ■ ■ 3 Richardson, r. f, . o Leisenring, 1. f., . 1 Gilbert, 2 b.t . . . 1 Hoffman, s. s., . .2 Tate, c, 2 Totals, . 17 16 27 13 2 DICKINSON. R. H. O. A. B. Himes, p., . o o o 4 o Davis, 1. f., . 1 1 2 o o Gilroy, 2 b., .01642 Curry, 3 b., . . - o 1 2 30 Bowman, c, .002 4 a Goodall, ib o on o 1 Lantz, c. f., . o o 3 1 1 Cramer, r. f., . . . o o 1 o c Makely, s. s., . .000 1 3 Totals, .1 3 27 17 7 Gettysburg, 4 J ° « « 3 2 2 3—'7 Dickinson, 1 o o o o o o o o— 1 Summary—Earned runs, Gettysburg, 9; Dickinson, 1. Two base hits, Hill, Nicholas, Hoffman. Bases stolen, Gettysburg, 14; Dickin-son, 2. Double play, Hill and Nicholas. Bases on balls, by Hill, 3; by 'Himes, 3. Hit by pitched ball, Gies and Tate. Struck out by Himes, 1 ; by Hill, 8. Passed balls, Bowman, 2. Time of game, 1.45. Umpires, Vastine and Vail. Scorer, Keffer. Another victory was added to our list, May 13th. After a drive of twenty-three miles over rough roads, our team met the Western Maryland College team upon their grounds at Westminster, Md., and defeated them. The game was close and interesting. Fine work was done on both sides, especially by the batteries and the Gettysburg fielders. Although the Gettysburg boys were somewhat exhausted by the long drive, they kept up their record to the end. The score was not as high as it would have been had the conditions been more equal. Following is the score: GETTYSBURG. Gies, c. f., . . . Nicholas, ib., . Keefer, 3 b., . . Hill, p., . Richardson, r. f., Leisenring, I. f., Gilbert, 2 b., . . Hoffman, s. s., . Tale, c R. H. O. A. E. WESTERN MARYLAND. K. H. O. Sellman, p., .001 Danner, 2 b., . . . o 2 2 Kurgeson, c, . . . o 1 4 Lewis, s. s., . . . o c 1 Gilbert, 1 b., . . . o o 9 Stull, 1. f. o o 3 Story, c. f. 1 o 4 Keen, r. f., . . . . o 3 1 Miller, 3 b., . . . o 1 2 score of 23 Totals, . 4 5 27 11 1 Totals,.i 7 27 11 6 | INNINGS. Gettysburg 10030000 0—4 1 Western Maryland o 1 o o o o o o o—1 | Summary—Earned runs, Gettysburg, 2; Western Maryland, 1. | Bases stolen, Gettysburg, 8 ; Western Maryland, 4. Double plays, Gies, Keefer, and Gilbert : Hoffman and Nicholas. Bases on balls, I by Sellman, 2. Hit by pitched ball. Hill. Struck out by Hill, 7; by Sellman, 3. Passed balls, Furgeson, 2. Time of game, 1.50. Umpires, Vastine and White. Scorer, Keffer. The game of May 20th with New Windsor College, on our home grounds, proved to be a very one-sided contest. Mr. Whitehill wasn't " in it" with Gettysburg's Hill. The game became rather monotonous toward the end. The home team did good playing. More need not be said—the score speaks for itself: Gettysburg, 27 ; New Windsor, 2. Much base-ball skill is developing in Prep., an example of which we had on Saturday, May 20th, when the Sub-Freshman team de-feated the Freshman team by a to 9. On Saturday, May 27th, the Sub-Freshman were again victorious. This time they de-feated the Sophomores by a score of 15 to 9. Their skill and coolness is to be commended, and Gettysburg need not tremble for her laurels for the next few years. The return game with Dickinson,.scheduled for May 24th, has been postponed to a future date. The return game that was to be played with Franklin and Marshall has been declared off on account of their team disbanding. At no time in the history of the college has so much interest been awakened in tennis. Every one seems to be infected with the fever. The absorbing topic in tennis circles is the tournament to be held during Commence-ment week. The entries for " doubles " are closed with thirty-six names. The " singles " are still open, but will be closed shortly. Practice is now in order for the preliminaries, which will be held in a week or two. At present the outlook for the tournament is very favorable, and if nothing unexpected occurs, it will be one of the most pleasant features of Commencement week. Base-ball and tennis have not entirely over-shadowed the interest in foot-ball. The appli-cants for next year's team practice weekly. Some new and promising material has been developed since last fall, and we look forward to a strong team for next year. Arrangements are being made for the Field Sports to be held during Commencement week. The sports will consist of dashes, races, jumping, kicking, throwing, etc. Mana-ger Nicklas, '94, is doing all in his power to make the affair a great success. We hope that his efforts will not be in vain. Keefer, '95, represented Gettysburg College at the annual athletic games held at Philadel-phia, May 20th, under the auspices of the Inter-Collegiate State Athletic Association. TOW/N AND SEMI/NTVRy. ROSCOE C. WRIGHT, Editor. SEMINARY. THE annual meeting of the Bible Society of Gettysburg was held April 29th. Dr. Hay was re-elected President. 72 THE COLLEGE MERCURY. Mr. Foster U. Gift, of the Junior class, will act as English Assistant to Dr. Wenner, of New York, during the coming summer vaca-tion. Rev. Ellis B. Burgess has accepted a call to Avenmore, Pa. He will enter upon his work in June. Appropriate Ascension Day services were held in the Seminary chapel, May l ith. Ad-dresses were made by Drs. Hay, Wolf, and Richard. Rev. W. Eichmann, of Westphalia, Ger-many, arrived here on the 29th of April. He studied theology five years in Germany, and came to Gettysburg to learn something about American church life. At the close of the term, he will go West to take a charge. We wish him success. Rev. C. H. Gruver has received a call from the Lutheran Church at Sparrow's Point, Md. Dr. Butler, of Washington, and Rev. H. R. Geiger, Ph. D., editor of the Lutheran Evange-list, visited the Seminary April 27th. Dr. George Scholl, Secretary of Foreign Missions, was with us April 23d. Dr. Hay delivered the address at the laying of the corner-stone of St. John's Lutheran Church, at Stcelton, April 30th. Mr. J. Braren, of Holstein, Germany, a member of the Middle class, expects to go West this summer to do mission work among the Germans of Nebraska. Drs. Valentine and Wolf are delegates to the General Synod. Rev. A. Stewart Hartman, Secretary of Home Missions, has appointed Mr. A. C. Stup as missionary for the summer vacation to Riverside, Cal., and Mr. A. A. King to Bangor, Pa. Messrs. Axe, Bergstresser, Hesse, Dunlap, and R. B. Wolf, have been appointed as colporteurs for the Pennsylvania Bible Society. On Sunday, May 21st, Rev. D. Frank Gar-land's church, in Baltimore, was dedicated. Dr. Richard preached the dedicatory sermon. Rev. F. S. Schultz has received a unanimous call to Morellville, a suburb of Johnstown, Pa. Dr. Richard entertained the Senior class of the Seminary at his home, Thursday evening, May 18th. A very enjoyable time is re-ported. Rev. Wolf, the missionary who recently returned from India, addressed the students, Sunday morning, May 21st, on "The kind of men needed in the foreign field to-day." The address was an excellent one, timely, and full of many important suggestions. Rev. Wolf intends to remain in this country about three months. TOWN. April 30th was the one hundredth anniver-sary of the independence of the Reformed Church in the United States, that body having separated from the church in Holland, April 30th, 1793. Rev. Barkley delivered an his-torical sermon in Trinity Reformed Church in the morning. Mrs. Harriet Brown Krauth, widow of Rev. Dr. C. P. Krauth, the first President of Gettys-burg College, died April 27th. S. S. Neely, Esq., has been appointed statis-tical agent of the State for the Agricultural Department. Arrangements are being made for the semi-annual encampment of the Department of Pennsylvania, G. A. R., at Gettysburg, July 15th to 21 st. Large delegations from the De-partments of New York, Maryland, and Dela-ware are expected. The New York monument in the National Cemetery will be dedicated July 3d, the anni-versary of the battle. That State has ap-propriated $50,000 for the transportation of the Governor and staff, members of the Legis-lature, and surviving veterans. THE COLLEGE MERCURY. n A distinguished party, consisting of General James Longstreet, General E. Porter Alexan-der, artillery leader of the Confederacy, General Mahone, of Va., Major-General O. O. Howard, of the U. S. Army, Generals Sickles and Tre-main, of New York, Governor Pattison and Auditor-General Gregg, of Pennsylvania, visited the battle-field April 28th-2C)th. On May 6th the oratorical contest between six members of the College Prohibition Club was held in the Court-House. This contest is preliminary to the State Inter-Collegiate Prohibition Contest, to be held at Harrisburg, June 6th, to which the winner will be sent. The winner at the State Contest will take part in the National Contest to take place at Chi-cago. The following is the list of the contest-ants, and the subjects of their respective orations: I. O. Moser, "Our Public School System ;" O. O. Leidich, " Monopolies ;•" M. Kemp, " The Effects of Prohibition on Na-tional Character;" L. F. Miller, " Arbitration vs. War;" W. D. Ernest, " The Curse of the Nineteenth Century;" C. E. Sanders, "Pro-hibition the Safeguard of our Social Fabric." The judges, Dr. Swartz, and Revs. Black and Good, decided that Mr. Sanders was the win-ner of the contest. THE MERCURY extends congratulations. Dr. Geo. E. Reed, President of Dickinson College, delivered the Memorial Day oration at Gettysburg. The electric railway company is meeting with much opposition. The pike companies brought suit, claiming that if the electric road was built it would interfere with traffic over their roads. This was settled by paying the pike companies $100. Recently the veterans have taken the matter in hand. Not wishing to see Devil's Den, Peach Orchard, Valley of Death, and other places of historic interest defaced by the blasting and filling in for the road-bed, they are petitioning the Secretary of War to prevent a further desecration of the battle-field. The railway company maintains that the new road will not mar the scenery at the foot of Round Top, and that the battle lines will remain intact. The War Depart-ment sent Major George B. Davis, Advocate General Judge of that department, to look over the proposed route. The decision of the Secretary of War will doubtless be based upon his report. Rev. Hugh Gilchrist has accepted a call to the Presbyterian Church. At the recent session of the State Medical Society it was decided to hold its next meet-ing at Gettysburg. We are again called upon to note the death of one intimately connected with the college. On Friday morning, May igth, Alexander D. Buehler died after a very short illness. Mr. Buehler succeeded his father as Treasurer and Trustee of Gettysburg College 37 years ago. During his long residence in Gettysburg he was identified with the Gas Company, the Adams County Fire Insurance Company, and the Water Company. Since 1867 he has been one of the proprietors of the Star and Sentinel. A large circle of friends will mourn his depar-ture. He bequeathed $2,000 to the college. On Thursday, May 18th, Hon. Chris. Magee, of Pittsburgh, and State Senators William Flinn, Walter Lyon, Wm. Penn Lloyd, Grant Herring, and Samuel Steele were here to look over the battle-field. Senator Flinn is the author of the bill giving electric roads the right of eminent domain. LITE-RTVRy SOCIETIES. WALDO D. MAYNARD, Editor. OWING to so many attractions out-doors, there is not so much interest manifested in society work as there should be. This is a matter to be regretted, for our work in the literary societies is of so much importance that 74 THE COLLEGE MERCURY. we cannot afford to neglect it. The time and labor required for preparation in this work is but comparatively little, so much the more is it needful then that we should not shirk our work when we are on the programme for per-formance. Let us then arouse ourselves to greater activity and make our society work of as much importance during the spring term as any other term of the year. With a little self-denial and restraint this can easily be done. Nearly all of the men in college now belong to the societies. This is very encouraging, but the members should keep at work until every man belongs to a society. PHRENA. NOTES. Phrena. has made valuable additions to its library, over 50 volumes of standard works having been purchased recently. The following will be the contestants in the Junior Oratorial Contest, to be held during Commencement week: Messrs. Lantz, Bush, Barndt, and Stahl. Mr. R. N. Stahle, '97, has been elected a member of Phrena. The following action has been taken by Phrena. upon the death of one of its members, Mr. Charles S. Wolf. WHEREAS, God, in His all-wise providence, has seen fit to remove from our midst Charles Stark Wolf, a true and faith-ful member of Phrenakosmian Literary Society; and WHEREAS, In this sudden departure from a life, rich with promise, we deeply mourn our great loss of one who has always been a loyal Phrena.; therefore, be it Resolved, That in his untimely death we have lost an active worker, an ardent supporter, and a congenial asso-ciate ; and also Resolved, That though his seat be vacant, and we shall meet him no more here, we have the assuring hope and belief that our loss is his infinite gain ; and Resolved, That though we are saddened by the loss of our associate, recognizing that His ways are not our ways, we bow in humble submission to Him who doeth all things well; and also Resolved, That a copy of these resolutions be presented to the family of the deceased; that they be recorded in the minute-book of the society ; and that they be printed in the college journals, church and town papers. VIRGIL R. SAYLAR, FLAVIUS HILTON, EDGAR SUTHERLAND, GELLERT ALLEMAN, ROSCOE C. WRIGHT. PHILO. NOTES. Philo. has finished its course in the discussion of authors. The society was very successful in this new undertaking. The hall was crowded every evening, while this plan was pursued, by the people from town as well as by the students. The following noted authors were some of those considered : Tennyson, George Eliot, Oliver Wendell Holmes. Fifty volumes of standard works have been added to the library, and a committee has been appointed to re-catalogue the books in the library. The following have recently been elected members of Philo.: Messrs. Ibach, '94; Wiest, Madara, Hoffman, Feldman, '95 ; Shaar and Heindel, '96; Smyser, Lutz, Culp, McCartney, Misses Tipton and Hess, '97. Oliver Wendell Holmes and Mrs. H. B. Nixon were elected honorary members. On Friday, May 26th, Philo. Society elected new officers to attend to her business. The officers elected were as follows : President, D. W. Van Camp ; Vice-President, W. A. Kump ; Recording Secretary, G. Z. Stup; Treasurer' W. B. Duttera ; Critics, J. F. Seebach, F. H. Bloomhardt, R. W Mottern ; Janitor, H. D. Newcomer. Philo. will hold its preliminary to the Junior Oratorial Contest on June 9th. A maiden fair of Boston town, Whose hose were azure as her eyes, Who'd ranged the scale of all the fads, Woke in my heart the god of sighs; She loved me, and I thought to hear Some erudite endearing name, But no, the learned darling called Me " lovie-dovie," just the same. —Life. ADVERTISEMENTS. Wanamaker's. Sporting goods of every sort. Sporting wear of every sort—Coats, Trousers, Caps and such a gathering of Shoes for every indoor or outdoor game as was never before seen in America. And Wanamaker prices—as low as anybody's, very likely lower than any-where else. ATALANTA was the swiftest girl of antiquity. The myth has come true to-day in a Wheel. Our ATALANTA is a Bicycle as fast, as strong, as simple as any on the market; faster, stronger, simpler, safer, better than most of the "first-class" machines. And lighter—weight Z°V\ l°s- But the best part is the price—$120 for a bang-up $150 Bicycle ! JOHN WANAMAKER. PROFESSIONAL CARDS. SEND FOR CATALOGUE OF NEAR. BALTIMORE, IVID, This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Sesson, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M., Principal, LUTHERVILLE, MD. CH^LlES S. DU^iCR^, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltimore Street, GETTYSBURG, PA. CHRS. E. STAflLtE, '87, ATTORNEY-AT-LAW, Baltimore Street, GETTYSBURG, PA. DR. CHAS. B, STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. ftWber's Drag Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. matest Styles ii} Hats, Shoes, AND Gents' Furnishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes. A. D. BUEHLER&CO., Headquarters for B©©^s a^d Brags, Stationery and Blank Books. LOWEST CASH PRICES- VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute .Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, Heuu York. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jeujelpy Stove fot» Souvenir * Spoons, . Sword * PTVins, &c. DKEKA Fine Stationery and Engraving House, 1121 Chestnut St., Philadelphia. J^pari-rnS a SPecraTty. COLLEGE INVITATIONS CLASS STATIONERY SOCIETY STATIONERY PROGRAMMES, BADGES WEDDING INVITATIONS VISITING CARDS BANQUET MENUS DIPLOMAS AND MEDALS Post Office Corner, Centre Square, STEEL PLATE ENGRAVING FOR FRATERNITIES, CLASSES AND COLLEGE ANNUALS. All work is executed in the establishment under the personal supervis-ion of Mr. Dreka, and only in the best manner. Unequaled facilities and long practical experience enable us to produce the newest styles and most artistic t fleets, while our reputation is a guarantee of the quality of the productions of this house. ADVERTISEMENTS. Vll R. H. REININGER, Merchant % Tailor. * & X *c THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. NEXT DOOR TO POST OFFICE, UP-STAIRS. CENTRAL SQUARE. PETE THORNE, Shaving $ Hair Cutting Parlors. Pl-RST eLASS 7VRTISTS. CENTRAL SQUARE. AJVIOS EC^EHT, DEALER IN FLEMMING & TROXEL, Billiard AND Pool 'Rooms. BALTIMORE STREET. Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, Pocket Books, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. SPECIflli TO STUDENTS. Fine Tailoring. JOSEPH JACOBS, Merchant Tailor, Shambersburg Street, (Mow Eagle Hotel) GETTYSBURG, PA. Red Front Cigar Store R. H. RUPP, Proprietor. flo. 8 Baltimore St., Gettysburg. The place for a fine Cigar or a good chew. Solid Havana filler, 5 for 25c. An elegant article. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. j V111 ADVERTISEMENTS. ESTABLISHED 1876. PE/NKOSE MgE-RS, \Y/dTCHndKER ™ jEWELER. Liarge Stock of LUatehes,Cloeks, Jeuuelpy, etc., on Hand. That Man is Out GETTYSBURG SOUVENIR SPOONS COLLEGE SOUVENIR WHO BUYS HIS BASE BALL, . BICYCLE, . . LAWN TENNIS -^2-3 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R.STINE & SONS CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. 1 IP-OUTING, ELSEWHERE . THAN AT . YACHTING AND BOATING SUPPLIES, A. Q. SPALDING & BROS. CHICAGO, NEW YORK, PHILADELPHIA, loS Mnclison St. 243 l'.roatlwny, 1032 Chestnut St. MERCHANT TAILORING DmTLEflELD LlVERT. Rear of Washington House, Opposite W, M. R. R. Depot. GETTYSBURG, PA. ^~ All Kinds of Teams. Good Riding Horses. A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, PA. :o:- The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

Transcript of an oral history interview with David Zobeck conducted by Sarah Yahm at the Sullivan Museum and History Center on February 10, 2015, as part of the Norwich Voices oral history project. The bulk of the interview focuses on Zobeck's experiences as an an instructor of the Transcendental Meditation technique, both at Norwich University and elsewhere. ; 1 David Zobeck, NU Instructor, Oral History Interview February 10, 2015 Interviewed by Sarah Yahm SARAH YAHM: So, I'm here with Dave Zobeck at Norwich, in our little studio at the Sullivan Museum. It is February 10th, 2015, which I know because tomorrow is my birthday. DAVE ZOBECK: Well, happy birthday tomorrow, in advance. SY: Thank you. I wasn't fishing for that or anything. DZ: No, not at all. SY: (laughs) And we're about to do an oral history interview. And so, question one is where were you born? DZ: I was born in Pueblo, Colorado, which happens to be a steel mill town. And it is the largest steel mill west of the Mississippi. And it's a town with wonderful mixed ethnicity. So, my neighborhood was from Yugoslavia, from Ljubljana in Yugoslavia, in Slovenia. And there's about a 12 or 13 block, square block area near the -- right on top of the steel mill. And then, on the other side of the bridge, there's a good-size Italian community. And now Latinos, mostly Mexicans, dominate the city's population. There's an African American population as well, Jewish and Greek. So, it's kind of like a little Pittsburgh. Little bit of everything. And I love it. It was a marvelous experience. I'm one of eight children, so we were good and Catholic. SY: What's your birth order? DZ: My -- I'm the sixth out of eight. So, I have a younger brother and a younger sister, yeah. SY: Number six. DZ: Yes. SY: You're, like, in the messy middle, right? DZ: Yes, kinda sorta, yeah. But, yeah, it was -- so, it's a marvelous experience growing up in that city. And really paid dividends, being exposed to all the different ethnicities. And, you know, we have pictures of -- when we were on our baseball team, it kind of looked like something out of the United Nations, you know? Little bit of everything. And we were cursed in several different languages when we won games, and it was marvelous. It was good experience. SY: Were there turf wars or was it [pretty immigrant?] -- DZ: No, no, not at all. It was very integrated. And especially my neighborhood, it was truly the statement about it takes a community to raise a child. I mean, the families looked out for each other and -- very much so. SY: Were your parents immigrants, too? DZ: My father -- my grandparents were. My father was born in this country. And my dad -- the house that I grew up in is the house that my father grew up in. So, my grandmother bought the house after my grandfather died in a -- extraordinary accident at work where he was killed with -- by a train. And my father was standing there, watching. And so, they bought the house, and my grandmother was raising the rest of the children. They had five children, and then she was also -- it was a boarding -- she was -- like a boarding house for steel mill workers. So, she would cook for them and so on and so forth, and that would help pay the rent and so on, so forth, so -- SY: And was that happening when you were a kid? 2 DZ: No, no, that was when my father was six years old. So -- SY: Oh, so she raised him alone? DZ: She raised them alone, yes. So, you know, it's a neighborhood and a community of extremely excellent work ethic. And if you're not work-- I mean, there was no welfare, just out of pride. Not that there wasn't a need for it. But no one would accept that. SY: Union town? DZ: Yes, and -- but they -- just was not going to happen. And everyone was -- you know, very -- oh, the yards were really well kept. The kids were clean, the -- you know, there was little to no crime other than orneriness. You know, lot of patriotism. Lot of guys went to war, and -- during World War II and then during Vietnam, my generation. So, it was a very beautiful experience because, you know, we were raised Catholic. The mass was in Slovenian for the older folks that didn't speak English. And then, you know, all the festivities and holidays -- and some of my friends who were Greek and Italian and Mexican and -- you know, when they had the festivals and -- everybody went and mixed, and it was great. It was a -- it's a marvelous place to grow up, but very -- definitely very blue collar. And all the children in my family worked their way through college. And that was the joy of my father, to see everyone with a college degree, of course, and all of our children and his grandchildren and great-grandchildren have -- everyone that could have graduated from college -- like, 48 of us or something like that, total, with nieces and nephews have graduated from college. And we expect success. We're going to make that. So, it was a really beautiful -- yeah, I'm very fortunate. SY: So, growing up, was the expectation that you would work in the steel mill or that you would get out? DZ: Oh, my family didn't work at the steel mill. My father didn't want that. He wanted us to do something different and -- not that it was a negative thing, but -- SY: He had seen his father die in a work-related accident. DZ: He did, and -- but he worked in a clothing store for a long time and was the manager of a clothing store. And then it burned down. And because he had assisted a customer who was extremely well off in -- fitting him with a suit, my father was excellent at doing that. And he was cleaning up the store one night after hours and he looked in the dressing room where this man was trying on his clothes, and he saw a paper bag and it was filled with money. And so, he knew who that belonged to. So, my father never drove a car. We didn't own a car. And my mother and father never drove a car their entire lives. Got on the bus and it took him, you know, an hour or so to get across town. And he knocked on the door, presented this bag of money to this gentleman. And, of course, he offered my father a reward, and that wasn't going to happen. And he got back on the bus, got home. Well, after the store burned down, my father was scrambling, looking for a job and "What are we going to do?" He has eight kids, and phone rings one day and it's this gentleman who left his money in the store. And he said, "I understand that the store burned down and you might be looking for work." He said, "If you call this number at the Pueblo ordnance depot," it's an Army depot, "they might be able to direct you some employment." So, my father called, and sure enough connected him to a job. So, he worked there for another, you know, 25 years as a federal government employee and was able to continue to support us and that sort of thing. So, you know, there -- it was a beautiful story, but I don't look back on it -- I don't feel -- we don't feel sorry for ourselves. It wasn't a poor us -- you know, we were poor, but it -- we were not at the 3 same time. I mean, we were rich with my parents and my brothers and sisters. And it was always a fun place for friends to come to the house, because they knew my mother would love them, and we would have a good time. And we were all athletic, we liked to play. And, you know, thank God, with all -- as rowdy as we were, there were no broken bones in the family or any sort of major illnesses. And so, in that regard, it was a -- we were real fortunate. But I'm extremely fortunate, so -- I had a marvelous upbringing. Marvelous. Yeah, no complaints. SY: So, well, I have two questions. DZ: Sure. SY: First of all, when you're a little kid and you're this kid running around on the streets, right, playing outside -- DZ: Sure. SY: -- what'd you want to be when you grew up? What were your dreams and visions? And also, what did you play? Do you remember if you had imaginary games that you played? DZ: Well, first of all, the games -- we played every sport imaginable. And one of the reasons is that, you know, we didn't go skiing because we didn't have the money or the transportation. But we did have a shotgun in the house, so my brother and I went hunting, you know? We would hunt ducks and geese and pheasants and, you know, quail and rabbit and -- not deer. We didn't have a rifle, but -- and we would eat everything that we shot. It was pretty good. So, that was one of the things that we did. The other thing -- I mean, we just dreamt of -- one of the things I wanted to be when I was younger was I wanted to be a professional baseball player. I always thought that I would be "in the show," you know? And I'm sure every young boy in that neighborhood who took up a glove and a ball and a bat had the same thing. I mean, we always had the same -- we thought we would all be on the same team. I mean, there was so much community spirit. And then, my younger brother was drafted several times and was very magical in his talents. And so, he was better than I was. He was younger. And that was my dream, that he -- then it, my dream, kind of shifted from myself doing that to him. So, I was helping him do everything he could to do that, because that was our dream. And in his senior year in college, unfortunately, he was injured and didn't get to make it. And that was a -- at that time, of course, it was a tragic event for both of us, you know? We saw this dream go by. But I think, at one point, I thought, early on -- I thought I might be a priest. And there was always this idea that the oldest -- I mean, one of the boys in every family would become a priest. And so, I thought it was me, and I enjoyed that thought. It was kind of cool. I just loved the parish priest. He was from Slovenia, and he was just -- he had such a heart of gold. He liked to help everyone, and I liked that feeling of helping everyone, and then the idea of saying mass and that was kind of cool. And these Catholic nuns, some of them were much better than others, of course. But there was one that was particularly interesting, and she was from our neighborhood. She grew up in our neighborhood, so she knew our culture and everything. So, she was -- she really took me under her wing, as she did all the children. But I just thought that was going to be something I would do, and even continue to think that when I was in the Air Force later on. I thought, as I was getting out of the Air Force, that I might become a Catholic priest. SY: Really? DZ: I thought so. I had the idea that I just wanted to do something extraordinary. And I thought maybe I would -- I talked to this priest when I was stationed in Torrejón Air Base 4 in Spain, in Madrid, Spain. And I told him that I wanted to become a priest. I thought I wanted -- I just wanted to talk to him about it. I wasn't 100 percent sure. And so, you know, we had these different chats from time to time, and then finally concluded that I could do priestly work because isn't everyone a priest? Isn't everyone a rabbi? Isn't everyone a minister? Can't you do that without having to wear the cloth and do that? So, he said, "You know, I think you'd be a wonderful father, and you would have that opportunity to do many things as well as help people." And so, it was a real cool experience. It wasn't a letdown. It was just, I think, a good part of my vision of doing things greater -- that I knew I didn't have to be one particular thing to do everything that I wanted to do. So -- SY: You're certainly doing pastoral work now. DZ: Well, you know, the interesting thing is, right after I got out of the Air Force, I had -- and I know you're probably going to -- I'm probably ahead of schedule here, but as far as -- SY: Chaos is my middle name. (laughter) Linearity? Whatever. DZ: OK. (laughter) Yeah, "so what if I have these questions that you're answering before I ask them?" SY: Oh, no, no, no. I write them down -- DZ: I'm teasing. SY: I never look at them. DZ: Yeah. SY: I just have them. DZ: Yeah, yeah, no that's good. SY: [For?] just in case. DZ: Good reference. SY: Yeah. DZ: But when I was finishing my last -- I was in the Air Force for four years. And when I finished my last -- the four years, last part of the four years, I was stationed in Torrejón Air Base in Spain, in Madrid, Spain. And I had already learned to meditate when I was in Tucson, Arizona, couple of years prior. And I got into some advanced courses, and I really enjoyed -- my friend and I started running, and then we started doing some camping, and we started watching what we were eating. And there was no -- there were very few guidelines at that time. We just started thinking about -- there has to be something to the quality of food that you put in your system, and how it helps your system perform. And, you know, kind of like the type of fuel or -- that you put in your vehicle. So, we thought we were just on the cutting edge, you know, with that thinking. And then, we would go camping and hiking, and we would just do the extreme stuff, like go -- we're going to go to the top of this mountain, we're going to camp out, and then we're going to come back. And this is what we do on the weekend when we're stationed in Tucson. And it was -- beautiful place to be. So, we would run together and [just?] that sort of thing. And one day, the -- there was an advertisement in the base activity center. And it said there's a yoga class. So, he said, "Let's go. Let's go check it out." So, this woman was talking about yoga and how it would benefit you. And we said, you know, why not? What do we have to lose? Nothing. So -- SY: Now, what year is this? What -- DZ: It was 1972. SY: OK, so this is the beginning or it -- 5 DZ: Yeah. SY: Yeah, OK. DZ: Nineteen seventy-two. Beginning of my four years. SY: [And you're?] -- DZ: Actually '71, I got in. But in '72, I was stationed in Tucson. SY: So, if you were in the Air Force, right -- DZ: Yes. SY: -- and yoga at this point is, like, firmly the bastion of, like, hippie stuff. DZ: Total hippie stuff, there's no question about it. SY: So, I'm having trouble picturing this guy in the Air Force being, like, "Sure, I'll go to yoga!" DZ: Well, it wasn't just "sure, I'll go to yoga." I said, "Let's check this out, you know, before we do that." And then she was talking about -- what caught our attention was she was talking about the benefits it had. And we were in that mode of how do we make our nervous systems function at a higher level? And so, we're running, and we got this runner's high. That's what the mode of, you know, the day was. You're going to get your runner's high, and we felt that. And then, we went hiking, and we would run up in the mountains in the higher levels and just say, you know, this is really cool. And all this healthy stuff. And we didn't drink and we didn't do pot. I've never smoked a cigarette in my life or even drank a cup of coffee. But I just thought there has to be some high and some way to get that inside of you. There has to be more inside than outside. What I see that grows out of the earth -- and people smoke pot and do all that sort -- that's good for them or whatever. They think that's good for them and that's their choice, no problem. But has to be the same or more inside. I have to be able to go inside and get to that place. Because when we would camp, we would look out and see the sky, and it would be -- and we'd see all these -- [well, you know?], in Flagstaff, Arizona, for example, we would look, and as far as -- I mean, it was just beautiful. And we would [say?] -- as far as we can see and then beyond what we can see still is space. So, it has to be the same thing inside. It has to be as far as we can go and beyond where we can go. It has to continually be space, so it has to be a reflection -- the outside has to be a reflection of the inside. And so, this woman started talking about yoga and "this position will create this flow in your circulation and will bring awareness and alertness to your mind," because she was talking to us in kind of a scientific way. And then we would start twisting around and doing things and -- you know, I didn't buy into all of it, for sure. It's a little too much. But we were doing that, and then -- we did that for about -- I don't know, about a month straight, and we would go to these classes three or four times a week. And we liked it. It was neat. And then, you know, lo and behold, here's this picture of Maharishi Mahesh Yogi in the community center on base. And it said there's a lecture on Transcendental Meditation. So, he said, "Hey, let's go to that one." I said, "Are you sure?" And he goes, "Yeah, let's go." I said, "All right, what do we have to lose? Let's go," right? So, we sat there. So, in comes this guy who was a Marine Corps veteran, and he had had two tours in Vietnam. And he sat down, and we -- there were about four of us, I think, that showed up. And, you know, introduced himself and was very casual, and start talking about meditation. And then he said, "My story is that I served two tours in Vietnam." So, that caught our attention. And he said, "When I got back, I knew there was something more. I was looking for something more." And he said, "So, I got back to Tucson, then I just 6 went to California. And I cruised around in the mountains, and I stayed on my own and I just kind of let this stress go out of my system. And then I start doing some thinking in this silence." And he said, "What I wanted to do was become a meditation teacher." So, he said, "When I came back to Tucson, I gathered my things and found out that there was a course in India where I could go and study with Maharishi Mahesh Yogi." He said, "So, I did it." So, he said, "When I went there" -- he said, "I had -- keep in mind, I hadn't listened to the radio, I hadn't watched TV, I haven't been in circulation in society for two or three years. So, I just went there to study. I was just going to be by myself and listen to this guy and then come back and teach people, because that's what I wanted to do." When he got there, he said there were people from -- international group. They were from all over the world. And so, he said Maharishi would come out and talk about meditation and different concepts of consciousness. And, in the evening, then he would retire. He would go into his room. And so, it was a young crowd, and they would hang out, kind of on the shore of the Ganges. And they would cook and, you know, associate with each other and sing and so on, so forth. So, he said there were these guys that were -- these four guys, and they had guitars. And they would sit around and they would make up poems and songs about people on the course. And one of the women on the course was named Prudence. And she was extremely shy. She was the sister of an actress, Mia Farrow. So -- and Mia was there. And so, he didn't know anybody. Keep that in mind. Just as innocent as you can imagine this so far. I know you're grinning and you know what's going on. So, anyway, Prudence, who I met a few years ago -- she's a marvelous human being and just a dear, dear person -- she would go to her room, because she was extremely shy. Extremely shy. And so, they kind of wanted the -- these guys kind of wanted to draw her out, so they made up a song. So, they went to her door and they knocked on her door, and they sing, "Dear Prudence, why don't you come out and play? Dear Prudence," yeah. And, you know, she didn't come out, and then eventually she did. And she would -- she was still very shy. And so, they were making up different songs about different situations. And so, they started to talk to my friend. And so, they called him G.I. Joe, because he had these fatigue pants on. And he didn't have his -- you know, he was -- you could wear your fatigue pants, just -- it didn't say Marine Corps, didn't say sergeant or anything like that. So, he had that. And he didn't really care how he looked, and he was just there for the knowledge. And so, they start making up a song about GI Joe. They called him GI Joe and that sort of thing and so, you know, hey, that was kind of cool, you know? So, anyway, he became a teacher. He came back from India. He was going to his first lecture and he turns on his radio in his little jalopy that he was driving, and what comes across the radio was, "Jojo was a man from Tucson, Arizona. He smoked some California grass. Get back, Jojo. Get back to where you once belonged." Get back to the USSR. And he said, "I've heard that song before." And someone said, "Yeah, those are the Beatles." He said, "Really?" And then he -- start telling stories about, you know, John Lennon. He said he had these multi-colored glasses on and he had, you know, long hair, and he used to wear these necklaces. And he was really bright, and how he would have conversations with Maharishi. And Paul McCartney, of course. And then Prudence later on was married, and she had a son and she named him Paul. And so, they're still really good friends. And he told stories about that. But it wasn't about them, the idea that he liked -- that he related to me that was intriguing is that this man had some knowledge. Maharishi had some knowledge to take 7 you within yourself. And it wasn't about him, it was just about the knowledge that he had received from previous masters, and he passed it on. And now, this guy could teach this information. And that was really intriguing to him. So, we started, and it was everything that it was cranked up to be. I'd started with no expectation. I thought -- same thing I did with yoga. Like, if this is going to work, it's going to work. I'll do exactly how they say to do it, and I'll get the results. So, we did. And my friend Scott Nichols and I started on the same day, and since that time I've been meditating regular, and I haven't missed one time since I started. I think it is everything that it's cranked up to be. And what inspired me to become a teacher was just the idea that I felt really good already. I didn't -- I wasn't in any dire straits to learn a technique that would pull me out of some stressful situation in my life. SY: So, you weren't -- you were seeking, but you weren't hungry. Doesn't -- DZ: Not [at?] -- well, you know, the thing is, I was hungry, but I wasn't desperate. SY: [Yeah?]. DZ: And I think I've always been a seeker of how to get better things in life. My own natural intensity pushes me to say I want to be the best I can be, I want every day to be the best day. What is this? You know, I want to see that. I don't want to get in dire straits to wait until I need something. What happens if you take it when you're already functioning, you know, fairly well? Can you get better? Can you get to the next level? And that's kind of the attitude I took with it. And when we began to meditate, it was just marvelous. I had better running times, I slept better. I performed better on tests. I had a lot more stamina. I was more organized. And, you know, it just opened up a whole new vision in my life. And I thought it was already really good. So, when I did that for a couple years, I thought when I got out, here's an opportunity to become a teacher. So, when I was in Spain, the Spanish TM [Transcendental Meditation] teacher in Madrid was a director of the Spanish organization, TM organization, and they were just going to start a teacher training course. And he said, "You'd be a fool to go back to the States. There's thousands of teachers, and everyone's taught everyone else, you know?" He said, "If you stay here, you can teach lots of people, because there's only going to be eight new teachers in the whole country." So, I love Spain, it was where I wanted to go since I was in fourth grade and drew a map of my favorite country other than United States. It was Spain. And I remember my father and I worked on this thing. We had glitter in the river and we had -- for the forest, we'd stopped up these little twigs. And it was on this big yellow piece of -- I can remember it clearly, and I was so excited. And then, when I got a chance to go there, it was marvelous. And I started to study Spanish on the base through the University of Maryland. I took five courses in a row for credit. And then I would just go downtown and practice. So, it came to me like riding a bike. I mean, it just -- it made sense to me. And I was in the country, and I would go down after class, and I would go to Madrid. And on the weekends, I would go to the train station and take a train to some little tiny pueblo someplace, just by myself to force myself to speak Spanish. And I would practice with the Spanish Air Force guys who shared the base with us, and go visit their families on weekends and stuff. And I went to the TM Center and did advanced courses. And I became pretty proficient in Spanish, so I became a teacher with the Spanish natives and did it all in Spanish. Eight months in the first two phases of a teacher training course. And [in the?] third phase, we went to [Avoriaz?], France, and studied with Maharishi, in person. So, I was their translator. And that's who made me a 8 teacher of TM. So, you kind of -- you follow exactly what he asks to do to make sure that the technique is done right. And it's effective, so it's not about you. It's about following what the masters did, and exactly in that same form. So, it was very, very challenging. But when I began to teach my first course, I went back to the base, Torrejón, and I taught 20 of my friends how to meditate, because they would -- they'd been wanting to meditate because they saw me meditate. And sometimes, they would just like to come in the room and sit quietly. And I didn't do anything. I don't sit in the lotus or go "om" or anything crazy. I just sit quietly in a chair, and that's really no big deal. So, that's how that began. So, I got a chance to travel around the country, and I taught about -- and then was lecturing in Spanish, of course. Probably taught about 900 people and -- for that whole year. And then, I came back to my hometown. And I was gone for about three years by that time. Hadn't seen my family in three years. And while I was sitting in the back of the -- on the back porch, my mother was ironing and -- you know, I was the only one -- the only sibling left in the house. Everyone else was married and out of the house. And my mother and father were there. So, this is my first time in my life I had a chance to be one on one with them. And it was marvelous, because I was certainly older then, and they didn't have all these other things going on. And, you know, my father was retired. And it was just one on one with my mother and father, like being an only child for a period of time. And it was glorious. I mean, my mother and father are just saintly. They're just magnificent human beings. I idolize them. The phone rings during a conversation. I pick up the phone, and there is a woman on the other end, and she asks me my name. "Are you Dave Zobeck?" "Yes." "Do you teach Transcendental Meditation?" "Yes." "Would you like to teach in the Colorado State Penitentiary, TM?" I said, "Yes." She said -- I said, "How did you get my name? I mean, I've only been home a week." She said, "I'll tell you later, so -- but tomorrow, I'm going to show up in front of your house. Give me your address. You're going to follow me to the penitentiary. We're going to talk to the warden at the maximum security penitentiary, and I'm going to try to convince him that we need this, because we have so much violence and we need something. And I'm sure this will work." "OK." So, we went down there, we talked to him. He put us on hold and he said, you know, "That sounds great." We hit it off right away. He was a Latino guy. He had a little Spanish accent, we begin to speak Spanish, he -- then, that kind of melted the barriers. And on the way back from the maximum -- oh, on the way out of the penitentiary or out of our meeting at the maximum security penitentiary, Tia, the guard, had to go to work. So, she was dressed in her uniform, of course. And she said -- she turned to me and she shook my hand. She said, "Good job, white boy." I said, "Great, there you go. That's good." And that was cool, I mean, you know? That was -- I had no problem with that. SY: No, you were in. DZ: I felt very comfortable with that, and I grew up in that kind of atmosphere. In the service, of course, same thing, and I loved it. And on the way home -- it was 50 miles away from my home in Pueblo. It was in Canyon City, and I stopped at the medium security penitentiary, just on a whim, and I thought I'm going to see if the program director's in. And so, I went down and I stopped at the guard shack, and I told them I had an appointment with the program director, which was a little on the untrue side. And he said, "Go right down and they'll help you out." So, I drove my vehicle down there and they patted me down and escorted me to the -- a bench outside of this office and said, 9 "You'll have to wait here. He has someone in his office." And so, I was waiting in my little coat and tie, and there was an inmate and he was swabbing the deck. He was cleaning, mopping up. And, of course, he's there with his number on one side and his last name on the other side. And he looks at me, and he says, "Hey, what are you doing? Are you a lawyer?" I said, "No, are you?" And he goes, "No." He goes, "I like that answer." He goes, "What are you doing, man?" I said, "Well, I'm here to see if the medium security personnel are open to the idea of a meditation class." He said, "What kind of meditation? Transcendental Meditation?" I said, "Yeah." He said, "Do you know George Ellis?" I said, "Yeah, I know George Ellis. George Ellis is a meditation teacher." He said, "How do you know George?" I said, "Two weeks ago, I met him in France." He said, "What'd you think?" I said, "I like George. He's a small guy, big ego." I said, "I like him." He goes, "Yep, that's George." He said, "Well, he taught me in Folsom Penitentiary. So, I do Transcendental Meditation." He said, "I'll tell you what. Here's what you do. You wait 'til you see Mr. Marshall, the programs director. When you come out, I'll have 20 of the toughest blomp-blomp-blomp-blomp-blomp guys here in the penitentiary, and we're going to start." I said, "Is that how it works?" He said, "That's how it works." I said, "OK." Sure enough, Mr. Marshall came to the door and he said, "I can see you now. Well, what are you here for?" So, I start talking to him. We had a marvelous talk. We talked about John Deere tractor, we talk about hunting deer. We talked about fishing, we talked about baseball. We talked about the stress he has in prison, his family. Yeah. And I said -- I was talking a little bit even about meditation. He said, "That sounds really interesting." He said, "I think I might like to try that." Well, he and I walked out. When we walk out, sure enough, 20 guys, inmates, are standing right in front of the door. And they already have their names signed up on a piece of paper. And they have Mr. Marshall's name as being the employee sponsor. So, they go, "Mr. Marshall? Here's what we're going to do." He said, "Now, boys, just a minute." Said, "We've got to check this out. This isn't how it works." And so, long story and fast forward, had it all checked out, and we did -- they didn't have any money, but they said, you know, "We're going to start." So, I said I would raise some money and we would get this done. So, I kind of went around the different TM centers around in Colorado and kind of [moved?] some money for sponsors. But I made the inmates pay $50. So, they were making 25 cents a day. But I said, "You're going to have to invest in it, because if you're [giving to it -- given it?], you may not do it." "Well, we don't have that kind of money." "Well, you'll find it." Now, what I did find out was, for marijuana in the penitentiary, if someone had three joints of marijuana in a matchbox -- that's what they call it, a matchbox -- it was $75. And someone would smuggle that in, and it would risk them getting a felony, and they would -- but it was worth it to them, so they did it. So, I said, in my first introductory lecture -- there were 75 inmates in this closed -- there were no windows in this closed room, and they could smoke at the time, of course. And I walk in and, you know, all the whistling began and all the catcalls and all the, you know, those kinds of things. And as they were talking, I finally -- it was too much noise, and I said, "Just a second. You know, I came here to talk about meditation. And those of you who are not interested, you have two options. You can go out this door or you can go out this door." Then it got very quiet. Course, there were a few other kinds of ways we said that in prison lingo. And they liked it, they clapped, it got very quiet. You could hear a pin drop. And afterwards, I told them what TM was, and whoever wanted to start, here's the 10 rules. And they clapped, and then we started our class. So, I taught TM for four years in the Colorado State Penitentiary. And the community sponsored -- you know, they would sponsor an inmate. And so, I didn't make any money. It wasn't a money-making thing, but I traveled back and forth from my hometown, which was 50 miles away, when I was -- I was enrolled as a student to finish my bachelor's degree with the GI Bill. And then I moved 167 miles away to go to grad school, and I would commute on the weekends down to the penitentiary. And then, you know, like, Friday, I would go -- drive down to the penitentiary. I'd work till 9:00, I'd go and stay at my mother and father's house, 50 miles away. Then I'd come back that Saturday morning, spend the entire day there from 8:00 to 8:00. Go back Saturday night, come back to the penitentiary Sunday morning and work till noon and then drive back to grad school. And it was a joy, what I learned. All the things I learned while I was there, because I was not a guard. I was not part of the system. They took me under their wing. They told me how all the crimes happened. (laughs) They educated me. And I felt that that was a real intriguing place to be. They were teaching me. And I wasn't, like, taking them into my homes or, you know, they were going to come and stay with me when I got -- it wasn't that sort of thing. It was just, like, "Here's what I do. And then, if you do this, you maybe have a better chance with a clear mind to not return, because your thinking will be different." But I didn't tell them how to live their lives or to behave, because that doesn't work after they've done 20 years and stuff. So, it was definitely a group of the alpha dogs in the penitentiary that were the heavyweights. And the violence level started to be reduced by a lot, because at one point I had 50 out of 500 meditating. And when the guys would meditate during the day -- they had to be locked down three times a day so they could be counted to make sure that everyone's there. So, three times a day, they had to go back to the cell and lock down, and the guard would go by the cell and count every single one of them. Well, during the count, it was about 30 minutes. So, the guys decided to meditate during that 30 minutes. Well, traditionally, it's really loud, because the guys have a chance just to yell and scream, and there's nothing they could -- what are they going to do, put them in prison? (laughs) So -- and these guys would meditate, and they were the heavyweights. Pretty soon, they start telling everybody, "When we do count, you shut up." (laughs) So, it started getting real quiet in all the different cell blocks. So, the guards were going, "Wait a minute, something is really unusual. What's happening? Because there's a change in these guys." So, every day, I would come in and I'd be in my little sport coat, and I would -- they would call the -- Mr. Zobeck's meditation class in the psychology room. And the guys would come in and I'd say, "Hey, how you doing?" Blah-blah-blah. So, at one point, the captain -- one of the captains came to me and said, "Get in my office," in a real stern tone. You know, right in front of the inmates. And the inmates went, "Oooh!" You know, like, "Uh-oh!" SY: "He's in trouble!" DZ: Yeah, exactly, you know? So, I went in the office and I sat down. And there was another inmate by his side, and he was talking to me in a very stern voice and it was kind of puzzling in the beginning, of course. And he said, "Do you" -- he said, "Young man, do you know that it's a felony to bring cocaine in a state penitentiary?" I said, "Sounds good to me. That sounds about right. Yeah, I do. That sounds -- yeah." I, like -- and then he said, "Well, you could be doing time with the rest of these guys, just like the guys you're trying to help and -- if you don't watch your step." And I said, "Whoa, whoa, whoa." 11 Then it occurred to me, I said, "You're talking about me bringing in cocaine? Oh." I said, "Captain, let me just give you a quick bio. I've never had a cigarette in my life. I don't drink. I've never had a cup of coffee. If you want to get your sniff dog and take him in my vehicle right now, I'll sign release papers. You could do a strip search, I'll give you a urine sample, a blood sample, whatever you would like to do. And, you know, we could do that in front of the inmates. I'll do whatever -- just so the evidence is clear. And if you don't find anything, I'll teach you meditation, because you're really stressed out. But good things are happening. (laughter) You know, when violence level goes down, that's actually a good thing." So, after that, when the -- when we were there for about a year, the in-- SY: Wait, wait, but so how did that resolve? That whole cocaine thing, how did that rumor start? DZ: He just -- it started because, you know, they -- the only reason that they would see that there were inmates being calm was when there were some drugs in the facility. SY: Of course, cocaine would not be a drug that would calm them down. (laughs) DZ: Well, but you know what? When they're maniacal -- if they're addicts, that would be a nice little fix. And there were several addicts in there. So, when they're coked up, they're a little bit different than when they're -- yeah. SY: So, he thought you were bringing in drugs because -- DZ: Yes, because I -- SY: -- the change in behavior was so dramatic. DZ: Yeah, and I was always happy. And that -- so, he knew that I had to be coked up, on coke, because I was always happy. And so, anyway -- but I saw a connection. The inmate that was sitting next to him was a convicted sex offender. I didn't know that at the time. And I didn't know the social aspects of the prison and sex offenders. What happened was, he came to learn TM. And I said, "Yeah, you could learn." But the inmates in the class told him, "Uh-uh. You're not coming with us, because if you sit with us, then that means we approve of who you are, and that ain't happening." So, I didn't realize that dynamic had transpired. And so, he was trying to upset the applecart and get this kicked out totally by putting this "I use cocaine" thing on me. And they would kick me out, and there goes the program and he'd get some revenge. SY: Right. DZ: So, I figured that out later on, and that aspect came to me. But, at any rate -- and then, after that, many guards saw what was happening, and they would come to me individually, like, privately and look around to see if there was anybody looking at us talking and say, "Here's my number. Call me at home." And I would call them at home, and said, "I want to start." So, I would drive to their homes, talk to them, their wives, and their kids and teach them. And then they said, "What we want is privacy, that you don't tell anyone, because if the guards -- other guards see us, then we're associating with an inmate program. If inmates see us, then, you know, we're -- it's a pretty negative situation." And so, at any rate -- and after -- of course, after four years -- and I was in grad school, then I was married, and I just couldn't continue. It was too long a deal. So, we had a very positive parting. But it was a wonderful experience, and it worked. The only thing I regret is I didn't keep real good -- great tabs on all the changes that occurred. I wasn't into the research end of it, and I regret that but -- 12 SY: Yeah. Any -- do you have any anecdotes of, like, transformations that happened with individual -- did you keep in touch with any of the inmates or -- DZ: They all kept in touch with me. I still have -- at one point, one of the most positive things, I think, is that -- well, I had one of the guys that was in there -- and he finished 20 years. He was in there for murder. And that's not good, and I'm not condoning any crime that any of these guys -- they're all wrong and they all -- SY: Yeah, of course. DZ: -- earned -- SY: Yeah. DZ: -- and earned the -- SY: Yeah, yeah. DZ: -- earned their time in prison. He got out and he spent one whole year in a monastery, on his parole. And the Jesuit brothers in Granby, Colorado, in a monastery, took him in, and he was in silence for a whole year. And he really enjoyed that, and it really made a huge difference. I keep in touch with him. Another one of the inmates who graduated, I -- got out and then finished the course. Became, like, an agent for a few professional athletes, some professional musicians. There's one right now who -- well, I'll tell you a personal connection, it was interesting. One of the guys got out, and he was from the city -- he grew up in the city in Colorado that I went to grad school in. It was Greeley, Colorado, at the University of Northern Colorado. And he said, "I understand" -- he said, "You said you're going to go to grad school in Greeley." I said, "Yeah." He said, "Could you look up my dad?" "Sure." So, he gave me the address, didn't tell me any story about his dad or anything. Didn't tell me anything about his father. I knock on the door, Mr. Smith comes to the door. I introduce myself, I said, "Hi, my name is Dave Zobeck, I teach meditation at the prison, and I met your son, Ted in the prison." And so, he starts cursing his son. "Ah," you know, he goes, "he's the cause of my divorce, because of his drugs and all that stuff. I hope he rots in hell," you know? And, OK, well, I said, "Well, I didn't know that part of it." I said, "So, like, you know, step away from the shotgun. I'm going to go back to my car," you know? Then he goes -- then he says, "Well," he said, "that's not your fault." Said, "Well, come on in." And fast forward, we became good friends. And he was an older guy, he just needed somebody to talk to. When I got back to the prison, I got in touch with Mr. Ted Smith and I said, "You got to tell me the whole story next time. You didn't tell me that." He said, "Yeah." I said, "Well, put your father on your visiting list, and I want him to come and talk to you. And I'm going to try to convince him to -- and he wants to talk to you. And you've got to drop that, you just have to talk to him." And so, anyway, they did. So, after I finished the four years -- and so, that went really well. But Mr. Smith would come and visit me a lot. I mean, sometimes uninvited. And I needed to study and he would just knock on the door and he would sit down, and he'd want to tell me his life story. And so -- and, you know, I accommodated most of the time, and sometimes I just couldn't do it. But I hadn't seen him for about two weeks. And in the meantime, I got a job at the Sheriff's Department in Greeley, Colorado. The Weld County Sheriff's Department. And I was a counselor in the jail, running this rehab program. I was sitting in my office, the phone rings. And this is when I was finished teaching TM in the prison. The phone rings, and it's Ted, the inmate who introduced me to his father. And we start talking. "How you doing?" "Good, I have a job, everything's going well." He said, "But my dad died." And I hadn't seen him in two 13 weeks. He said, "It was just sudden. He died and we're having the funeral. Would you and your wife come to the funeral?" I said, "Of course we will," you know? And he said, "I just need some support [there?]. I don't have any family." "Of course." So, you know, my wife and I went to the funeral, and then we had him over for dinner, because he wasn't any threat to us. I mean, he wasn't, like, you know. So, anyway, we had him to dinner. So, during dinner, he said, "My father really liked you, and he really appreciated you did all that work for free." He said, "He wanted you to have the house." I said, "Now, wait a minute. Time out. Have the house? I'm not going to have the house." He goes, "Well, we'll make it good for you," because he said, "I shouldn't have the house," because his drug guys would move in and he would just -- and it's a mess for him, and he was about 100 miles away. And he said, "I'd just rather have the money and move on. I'm ready to move on." So, he gave us, like -- it was just incredibly inexpensive. So, he said, "For your hard work in the prison for four years, this is your reward." So, we -- I've got the G.I. Bill, bought this house, and it was our first little house. And, you know, we raised our first little girl in it for a few years, and then we moved to another one and we used that as a rental house. But that was probably the most powerful anecdote that -- but some of the guys were -- I've lost track. You know, several of them, I know, had died. And, you know, it's not unusual that someone who's been in prison awhile has the stress factor along with them. But I didn't see, you know -- and some (inaudible) [00:45:22] I'm sure reoffended. I didn't keep that close track. But it was a marvelous experience. And, yeah, it introduced me to the field that I stayed in, the criminal justice field. I got interested in that. SY: OK, so -- DZ: I liked the adrenalin flow. SY: -- what was your master's in? DZ: My master's was in psychology, agency counseling. So, I did a lot of rehab work in the jails after that and ran a halfway house and that sort of thing, so -- and as a probation officer, when I was a probation officer, I did a lot of one-on-one kind of therapeutic kinds of things, and interventions in the community and that sort of thing. So, I really -- growing up in the neighborhood where I was, working in the penitentiary, and then getting that exposure and then applying that life experience to a career was a real blessing, you know? So, yeah, and I didn't teach TM when I was a probation officer, because that was a conflict of interest. I just recently started teaching since I've been here at Norwich. SY: So, I have a couple questions. DZ: OK. SY: First of all, do you know about Vermont's whole restorative justice model? DZ: Yes. SY: Yeah. DZ: Yes. SY: I was on a reparative board for awhile. It's pretty amazing. DZ: Yeah. I was certified as a trainer for restorative justice. SY: Oh, you were? DZ: Yes. SY: Yeah. 14 DZ: And Vermont had a prison here, and years ago, they had a TM program in the prison. And a woman by the name of Susan Gore, of Gore-Tex, who's from Vermont, had this project going and -- about the same time I was doing my project in Colorado. SY: Interesting. DZ: Yeah. SY: Doesn't exist anymore, does it? DZ: It doesn't what? SY: It doesn't exist anymore, does it? DZ: No. No, no. No. SY: So, that was one question I had to ask. And then, I'm just thinking about all these stories, and I'm thinking that you're in this unique position, right, where you can bridge these two worlds, right? So, I would imagine that you're different than most people teaching TM, certainly in the '70s, right? DZ: Yeah, absolutely. Absolutely. SY: And, you know, you're this guy who was in the service, right? So, you can, like, walk, you can be, like, respected for having this particular type of authority, right? You can tell them to take it or leave it -- DZ: Right, right, right. SY: -- in whatever crude terms you need to. DZ: Right, right, right. SY: Right? And have that sort of, like, gravitas, right? And then you're also able to teach TM. So, I -- is that something you've thought about? Like, how you sort of intersect these worlds? DZ: No, I just -- you know, I taught TM because that was the most wonderful opportunity I had at the present, and I got really into it. And then, when I came back to the states, what I was going to do was get my degree and possibly go back to Europe. And then, this project came along. And then, of course, in grad school I met my wife. And, you know, life happened in that regard. So, the next page in the next chapter was, you know, I have an opportunity to actually work in this field. And I had this previous kind of experience prior to that, and it wasn't for pay. But it was really on the front line, and the prison experience was real. I mean, there was a guy who was -- there was a lot of things that happened in the penitentiary, you know? Like murders and that sort of thing, and just being exposed to that. And I liked the adrenaline rush. I liked that there was an excitement and you had to be on your toes all the time. You had to be alert, and how to handle that, knowing that in a penitentiary, you're outnumbered if you're a guard. So, your best weapon is your mouth, and you could either get in trouble with it or you can calm people down. Because the inmates -- you live at the mercy of the inmates when there's 500 inmates. There's -- they don't walk around -- the guards don't walk around the penitentiary with guns for good reason, because somebody's going to take it away. So, it was kind of an idea of learning how -- it was -- it reminded me of a -- and I've never done this, but it was kind of like maybe being in the jungle, learning how to pet the lions, and still have all your fingers. These guys could kill me anytime. I mean, they were all -- and there was 20 of them. And out of the 20, 12 of them had been convicted of murder. And, you know, they weren't rehabilitated. But I have to give this one little story. So, what I do is I'd -- the first day with everyone that is taught, they learn with a teacher, one-on-one. They get the instruction. So, they receive a mantra, they receive the technique 15 how to use it properly, and then they meditate. They get it the first day, so you don't have to be a black belt in TM. You get -- you learn it right away. It's so simple, 10-year-olds learn. So, it's an effortless technique, which makes it really effective. You know, and it's certainly not a concentration technique or a contemplation technique and -- concentration takes a lot of effort and focus and mental activity, so it usually stays on a surface level. And contemplation is kind of -- you ask your mind to imagine a situation that -- you work yourself to get images or a value, like kindness or whatever it is, and imagine yourself in, for example, Costa Rica when you're actually in Vermont. But this is supposed to give you this relaxed feeling. Or imagine yourself, you know, the kindest person you can ever be. But it's thinking, and as long as you're thinking, you're on a surface level. So, TM is a little different than either one of those. It takes advantage of what's called the natural tendency of the mind. It sounds like a lot of woo-woo, but what it means is that if, you know, you and I are talking -- and I don't know what your favorite music is. What is your favorite music, type of music? SY: It's usually folk music of some variety. DZ: OK, so as you and I are talking, if one of your favorite tunes floats through the door, where would you imagine your attention might -- [yeah?]. SY: Sure, yeah. DZ: To the music. So, it's more charming. It's something more charming. So, what happens is that, in TM, when we -- when I teach a person to meditate, the natural tendency of the mind is to go to quieter levels of the mind where there -- it is more charming. There's more quietness, more silence. Now, how do you get there? So, the first day, I teach you a mantra, which is a word that has no meaning. Some mantras do mean -- there's thousands of mantras all over the world. Probably millions, I don't know. But the mantras that are used by TM are sound that has no meaning whatsoever. And sounds have certain effects on your nervous system. So, it's a soothing sound and I choose that for each person. Some people could have the same mantra, doesn't matter. But the technique, how to use it properly, is the other half of that knowledge. So, I teach that the first day. And by this soothing sound, and when it's used correctly, that directs the tension to finer levels of thinking and quieter levels of the mind, to a point where, you know, there is nothing but silence. And silence is different than quietness. Silence is -- in silence, there's no thought. So, the idea of Transcendental Meditation -- meditation being some form of thinking or prayer, and transcending going beyond that. So, you go beyond the level of thought to where there's silence. And that part is in every nervous system of every human being. So, transcending is that experience of silence. And so, 600 studies later -- show that, you know, the prefrontal cortex and all areas of the brain are affected in a real positive way. So, it creates a situation where there's -- it's called restful alertness. So, the restfulness is that -- it's a mental technique, but there's deep physical relaxation. So, the heart rate is reduced, the breath rate, the pulse rate. Even cortisol, which is a chemical in the body that measures stress is reduced almost to nothing. So, the physical part is there. But on the mental part, there's some awareness. So, it's not sleep, it's not dreaming, it's not being awake, it's not -- it's neither of those states of consciousness, but it's this pure awareness. So, when someone experiences this several times during a 20 minute period of meditation, which is the length of time that people meditate twice daily -- that that prefrontal cortex and all areas of the brain are affected positively, and there is some coherence in the brain. So, there is awareness. 16 There's alertness. And so, when you experience that and you finish, then you're refreshed. So, it reaches the level that's deeper than that of sleep. But it's not sleep, because sleep is measurable and your brain behaves a certain way during sleep. And the EEG that measures -- that does this research doesn't lie, doesn't make anything up. It says, hey, this is a different state of consciousness. So, we can tell when a person's sleeping by the function of the brainwaves. Then, when they begin to dream, there's some rapid eye movement, and you can tell there's a different function. I'm not being incredibly scientific, just -- right, just general. And when we're awake, like right now, there's a different -- so, scientists in another room looking at this screen could say that Sarah and Dave are sleeping, dreaming, and awake. And then, when we meditate, they're saying something different is happening. So, it's a fourth state of consciousness. So, being able to actually teach that to someone, knowing that it goes to what is a natural place in their own being, in their own mind and their own physiology, which is silent, and they get these deep results -- and when they come out and they're more alert and more relaxed, they're probably going to have better behavior. They're probably going to be more efficient in their activity. They're probably going to be more effective. So, when the violence level went down in the prison, it wasn't because Dave Zobeck said, "Be good." It was because we have 50 out of 500, and they're having more brain coherence, because every decision comes from the brain. It just made common sense to me that I didn't have to spew anything. I didn't have to tell them, "Eat -- be a vegetarian, think of Maharishi all day long. Quit your religion." Because that was convincing to me. I was Catholic, I didn't have to abandon my religion. I didn't have to become a vegetarian, because I'm not. I didn't have to walk around with a picture of Maharishi on me and think Maharishi thoughts, which -- and I met him. He's a marvelous human being. A marvelous human being. Incredible. I mean, he's a Hindu monk and I'm not. You know, I'm okay with that and it's not a big deal. So, to bring that knowledge into this field, knowing that in the field of corrections, with inmates and employees that work in that field, that -- high stress rates -- that police officers and people in law enforcement, corrections, they don't live to normal life expectancy because of stress. Not because of the bad guy. And then military, same thing. I mean, when -- sadly enough, when we have 13 -- minimum of 13 suicides per day, I find that -- I'm extremely patriotic, and these are our men and women, and these are people's -- course, now they're children -- that I have been with, and even if they're not -- that I don't know them, they're related and I understand that stress. I've never been in combat, so I don't understand that stress. But I tire of seeing our beautiful flag folded into a triangle and presented to a grieving family because the effects of their duty drove them to that place that they thought was better than living. And what am I going to do about it? I mean, you can only cry for so long. I want to do something about it. So, I think that this is a tool that may have an effect on that. And if someone can do that -- and I taught on this campus, I've taught a number of veterans that were -- have done a number of tours in different wars. And the results are phenomenal. And it is such a privilege for me to do that, it's such an honor for me to do that, to share that. So, to be here at Norwich is just -- this is -- SY: So, yeah, so how did you get -- DZ: -- ideal. SY: -- pulled back into this work? 17 DZ: Well, I retired from my work early, and I put in 28 years in the field. But I decided that I wanted to teach TM again. In order to do that, I had to do a recertification course, and I went to this recertification course and I met this guy there. He said, "I work for the David Lynch Foundation and I'd like you to work for me." I had no idea what that was. I said, "Oh, okay, that sounds good." And, you know, no big deal. And so, he contacted me later on and said, "You have a chance to go to Norwich and teach TM." And I thought that was England. I was all excited. I thought, cool, we're going to England. Break out -- "Hello." Break out the passport. (laughter) So, I came here, and the first day that I came -- it was kind of, like, an incredibly snowy day like today. I went to a meeting in the Plumley Armory, and I walked into the Nicholson Room and there were nine vets sitting around this table. And I had my little coat and tie on, of course, which is kind of the uniform of the day for TM teachers. That's what -- Maharishi would like people to look professional, so I did. And I had Peg Meyer and Shelby [Gile?] and the veterans, and they started introducing themselves around the table. And this man said his name, and he said that he had done some tours and gone through some troubled times. And so, I looked him in the eye across the table and I said, "Welcome home, brother." And he started to cry. And I got up and I went around the table. And he stood up and I gave him a big hug, and he was just crying. And I just said, "Welcome home." And he sat down, and we continued. And the woman next to me whispered -- she said, "Did you know him?" I said, "I've never seen him before in my life." And so, then we had a chance -- after that meeting, we told them about TM, and they were -- they could start. They didn't have to pay anything. Going to make an exception, because we had an agreement between our agency and Norwich. And then, I went and talked to the student body. I mean, there were about 200 [core or Corps?] members, and we got a group and we started the first study. I wasn't the researcher, but the researchers did -- took some measures before and after. And then, the results were great. Doctor -- or President Schneider got up in front of the students that were there and he said, you know, "Ladies and gentlemen, you have the opportunity to learn this." He said, "It's everything that they say it is. There's no obligation, and you can volunteer if you like. If you don't, that's okay." He said, "But I've checked it out. I've looked at the research," and he said, "that's the only thing that convinced me." He said, "Then I started it, and since I've been doing it, it's wonderful." You know? Not exactly his word, but that he started -- SY: So, the TM with people returning with PTS makes a lot of sense to me. And the TM with platoons beforehand also makes sense, but can? -- I feel like there's this elemental contradiction, right, which is no matter how resilient people are, in war they're going to be forced to see and do things that damage the psyche, right? DZ: Sure, sure. SY: So, I guess, how do you think about that? And how can -- do you believe that TM can, to some degree, change the nature of conflicts? DZ: Well, a couple of things. You know, it only works if you do it. And if a person's in a conflict -- I mean, I understand from a practical sense they're not going to call time out and go, "I got to meditate." But there are going to be some down times. There's going to be conflict that's going to cause that damage no matter what. If you do TM, you don't -- yeah, do TM. What do you do about it when you have it? And this is something that I like in this regard, because they could do it by themselves, and it's an extra tool. If they want to talk to a psychologist, that's great. If they want to take some medication, that's 18 great. Whatever. They can do this by themselves. The veterans that I taught said, "I wish I would have had this when I was in combat, because there were times when I was just losing my mind and I didn't know what to do. And I had time on my hands. I wish I could've sat down and done this." So, in a practical sense, we're giving them tools to use when they can -- if they're in a conflict or if they're not actively doing anything, they have some downtime, to relieve that stress, to maybe -- we don't have any data yet that says TM prevents PTS. I would never say that. Maybe lessen the effects, or even when they get back they have a tool immediately to use. Because what we know is that alcohol, drugs, you know, the different behaviors that break out -- violence, you know, it's fight or flight kind of time when someone has post-traumatic stress. They -- you lash out or they'll walk away from things, and they're not the same person when they return, because what's happened is the brain is damaged. So, the hope is that we can give them this tool to maybe get them strong before they get into the conflict. And if they're kind of doing this workout for the brain, being more flexible to stress that's incoming, they won't react as badly or as poorly as they did if they didn't have the tool. So, what we're doing is -- it's kind of like that analogy of, you know, there's this crack team that rescues people jumping in the river, and they're going down the tubes. And they can pull out every single guy in the river, and every single woman in the river. They can -- they're really good at it. Then someone gets the wise idea and says, "Why don't we catch them where they're jumping in? You know, we can prevent something." So, this is a preventative program. So, we get the vets that have -- coming back, they're on campus. We also get those who are going to be commissioned and go into the service. And I have, you know, over -- probably about 100, and I get text messages from several of them that say, "I meditated before I flew today. I was clear as a bell." Or, "I finished Army Ranger training, and if not -- but for TM, I wouldn't have made it." And so, I see that there's some results. And, you know, I'm not a meditation cop. I don't make them do it. I give them the tool, and that's what the president said. We're going to give them a tool that is proven and see if that makes the difference. SY: No, that's very interesting. So, OK, so Norwich is founded on this idea of the citizen soldier, right? DZ: Mm-hmm. SY: And I think that means a lot of different things to a lot of different people, right? But part of it that I find compelling is the idea that you're creating soldiers who are thinkers, right? Who are -- they follow orders, but they also to some degree come to their own conclusions, right? So, I'm wondering if you feel like TM can create better, more ethical warriors, if it has a moral effect, perhaps, in some way? DZ: Well, I mean, if -- the idea that -- that's a good question. The idea is that -- I think a person's morals don't necessarily come from meditation. But I think when a person has a clearer mind, they make less mistakes, and they're probably apt to err on the positive. So, you know, wouldn't it be nice if we were talking about, ideally, a situation where one of these young men or women become a general and they're big decision makers, and it comes down to doing that -- [make?] a decision to -- is this war -- is it -- are there other alternatives? That clear mind would make the very best decision that that person could possibly make to benefit the most people around them. Of course, that's the hope of every time, so -- but there's no -- I think when people begin to meditate, the hope is -- I had one of my -- so, one of the guys who's a soldier now, he said, "I want you to teach all 19 of my platoon, because we're going to be more in touch with each other, and we're going to be more effective." And, you know, the hope is someday there will not be any wars. How -- you're talking about ethical with regard to during a war, ethical with regard to preventing war, or in what regard are you thinking about? SY: All of the above. DZ: I see. SY: All of the above. I mean, so, yes, so ethical in terms of preventing a war, if it could be prevented. But also, I'm just thinking about -- you know, we've had some unfortunate situations in the past decade of -- you know, that are coming to light more and more, like soldiers -- you know, I mean, I think of Abu Ghraib. I think of other situations like that, and I wonder if a practice like this could help a soldier in a sort of context like that. Be, like, "Yeah, I'm not doing that." DZ: Right. SY: Or, "I'm going to blow the whistle on that." Or, "That doesn't" -- do you know what I'm saying? DZ: Yeah, yeah, OK. That's a good direction. One of the things that I would submit that -- I don't have evidence in every single case, but I would submit that those types of decisions are made from a stressed mind. And same thing with crime. I mean, look at the example in prison. When these guys are doing that, none of them -- they rarely if ever got written up for any violations. And it's not because those rules were not there at all, they didn't understand the rules. It was because their reasoning was influenced by the amount of stress that they had. So, I would guess that when -- the people who did that in Abu Ghraib, and it wasn't every single one of them -- made that decision. That's not a relaxed place. That's an incredibly stressed place. And I would guess that those decisions come from stressed minds. So, I think that what could happen -- if I had the magic wand, I would teach every one of those guys. And, you know, there would be a difference in the -- a physiological change. And again, it sounds very ideal. But break out the EEG machine. And that doesn't measure left-wing granola conspiracies. That measures how the human brain functions in each individual. And when done correctly, there is a positive effect. And I would say that would be where the influence would go. And I see the same thing with, you know, stressed cops, stressed whatever. When I was on the street as a probation officer and we'd chasing the bad guys, I'd come home and there'd be all sorts of stress, of course. But I would meditate, and then I wouldn't bring that stress into my house, you know? And I think that that's the hope. So, I think it's a tool that is -- needs to be looked at, because scientifically it's proven. So, I do think it would have an influence in that regard. Do I think it would have been perfect and no violation? I'm not saying that. I'm saying does it make a difference if they would do it? I think it would increase the chances of positive behavior by a long shot. That's my opinion, absolutely. And so, if you look at that and you look at the idea of where wars come from -- I mean, people making decisions to go to war -- I don't think that's a relaxed nervous system. SY: No, and people that -- DZ: On either side. SY: Right. When people feel like caged animals, they act like caged animals, right? DZ: They're going to lash out, I would guess. I mean, in some cases. And rare -- and bless the guy who doesn't or the woman who doesn't, but it's rare. But I think that -- you know, the same thing -- well, anyway, so that's my opinion on that one. 20 SY: So, one last question -- DZ: Sure. SY: -- because I know I'm getting tired, mostly because these fluorescent lights are awful. Do you have this (inaudible) [01:09:52] (laughs) DZ: They're terrible, aren't they? SY: They're just the worst. DZ: Bam. SY: Ah, thank you! DZ: See? SY: Feel much better. DZ: See, now we're relaxed. SY: Look at that. DZ: We're roaming out. SY: Look at that. DZ: Come on. SY: Things changed. DZ: I mean, come on, hello. SY: Woo! It was, like, my eyes -- DZ: (laughs) Bzzz! SY: -- were like dilating in and out. (laughter) And I was, like, am I here? What's going on? DZ: Who am I? What am I? SY: So yeah. So, actually, I was talking to Sarah Henrich before and I was like, "What do you want to ask Dave Zobeck? What do you want to know?" And she said, "What's your big picture vision?" You could – if you were running the show, you were, you know, I don't know, leader of the world, right? What would you do in terms of TM? DZ: Of the world or for Norwich? The world -- SY: Or of Norwich or -- DZ: Well, here's the deal. I think -- what I think I would do -- I mean, in the world sense at it boils down to Norwich as well. I think you need to get it in the education system. I think this needs to be a class that's offered for credit, that this is -- that you can do maybe some measurements before you get in the class, and at the end of the semester, after X amount of meditations, you can do that. And I think every class would begin with meditation and then follow with some knowledge about development of consciousness, changes in brains, that -- some real scientific kinds of things. And that should be a part of every person's curriculum. I think it belongs in the curriculum. I think this tool belongs with civilians, it belongs to Corps people, it belongs to administrators -- and I have taught a number of administrators here that swear by it. So, if it works, let's do it. So, we have to have this type of knowledge of other subject matters. And I've taught that. I've taught sociology and psychology and that sort of thing and it was -- it's marvelous. You have to have that. It's a good, good bit of information. But the knowledge of the self is so powerful and timeless. These books are outdated five years after I teach the subject matter. Development of consciousness and going within never is outdated as long as you're alive. And that is eternal knowledge. And that's the difference in my satisfaction of teaching TM and teaching these other subjects. I love teaching. When I teach someone how to go and experience and that -- to find this place in their own nervous system -- and then, when they're finished, they feel better and their affect is more positive 21 on other people, because it's good to be around people that are very positive. And they're going to be the decision makers of the future. It's way too common-sensical to do. It makes sense, and there's no -- I don't understand a reason not to. And so, that's what I think the ideal situation -- there are school systems in California, entire school systems that use it. They call it quiet time. They start their day -- the entire school, with the teachers -- they have a bell that rings over the PA system. They start their day with 10 minutes of meditation, they go about their business. At the end, at three o'clock when they're finished, the entire school system sits down, including the teachers. They do 10 minutes of meditation. No violence in the hall, no afterschool violence. They've saved San Francisco millions of dollars -- SY: Of course it's San Francisco. DZ: -- because of shootings and so on and so forth. And the kids are progressing for the first time through middle school, high school, and they're going on to college. The data is there. There's no -- there's nothing -- and they're still Protestants, they're still Jews, they're still Catholics, they're -- they haven't changed. They're still meat eaters. They're citizens that understand how they can contribute better as a citizen to their country, to their city, their community when they're using more of their full potential. This is the tool, and it's proven. And I think it -- you know, move the obstacles out of the way, get to what works. And the sooner we do that, I think we can see results all over the place. Even in cities where there are crime rates and there's X amount of people who are doing TM, there's a difference in the crime level. So, you know, I think it's a tool. So, I think, to answer, you know, that question is -- very directly is put it in the school system. Without a doubt, it should be taught like any other subject matter. The knowledge of self is as important as the knowledge of other topics. And so, I would recommend that. And I'm hoping, eventually down the road at Norwich, it does get in the curriculum somehow, some way, you know? SY: Actually, when I was teaching middle school, we had something -- it wasn't TM, but it was sort of a mindfulness chunk of the week. DZ: Yeah. SY: It was -- it didn't quite work, I think because it was, like, a group activity, right? It wasn't something that, like -- I think with middle school girls in particular -- it was an all-girls school -- they need to close their eyes to, like, step out of the social context in order to be able to access themselves. But when there were -- it was more sort of, like, movement based and they could still see each other, they, like, weren't able to get rid of their self-consciousness. DZ: And to go inside. SY: And to go inside, yeah. DZ: Well, you know, every technique has their own benefits, and I'm not going to knock that. But this is a -- again, if you're going to anyone -- any institution's going to invest money, go to something that's proven. I mean, 600 studies later, and no one's fighting that they're bad studies. There's not one. SY: Do you think that if you hadn't -- if that Marine hadn't come and spoken at that -- at your Air Force base that you would have discovered TM? Or do you think your life would have taken another trajectory? DZ: I think probably -- I think people are on a path to probably discover what they discover. He was just the -- he was the person who -- like, I would -- with some others that just was 22 -- delivered the package that day that I had asked for in some way, shape, or form. I was always looking -- SY: And you were ready for it. DZ: Yeah, I -- and in kind of, like, that Chinese thing when the student is ready, the teacher appears. SY: Right, right, right, you're -- DZ: And I think I was -- we were doing other kinds of things and that came along, and that was just -- that was another thing. But it was the coup de grace. I mean, it made my exercise better, you know, my sleep better and my studies better. So, I saw the benefit immediately, and there's no reason to stop, so I haven't. And so far, there's some tremendous results here at Norwich, and the students like it. And, you know, there's some support. And it'll go as long as it's supposed to, you know? So -- SY: It also seems like, at Norwich, it's also to some degree changed the culture between the cadre and the rooks, right? And I know that people talked about less yelling and, like, a sort of, like, different relationship between -- a kinder relationship, potentially. DZ: Well, the thing is, the first two years when we had the group study that was done at Alumni Hall, we had one platoon that was, you know, taught, and their cadre. And they would meditate together for the first two years. Different platoons, of course. And then we had the control group that didn't learn and then finally learned in the spring when they got recognized. So, we had that -- so, in that specific platoon, they didn't need to yell because these men and women, young men and women, were alert enough the first time around. And they, you know, were less stressed, and they could respond right away. So then, the cadre didn't have to yell, because they got it right the first time. And I know the cadre personally, and they yelled. I mean, it's part of the culture. But it was really good. Now the group is different, because it's opened up to the general population. So, some of the rooks are meditating and they're meditating in the room, but their cadre don't and their other roommate doesn't. Or it's a smattering of -- you know, I taught 116 people last semester, and not all of them were rooks. So, there's still the culture of yelling and screaming, of course. But I think, you know, we've opened it up to the public this time around. But in that regard, when you have everybody with a clearer mind and you have a group of people with a clear mind -- in fact, they sit down and get a clear mind before they start their day and go forward. TM is a preparation for activity. With a clear mind, your activity's going to be more efficient. It's real simple. So, that's how it -- work, and I think Norwich is on the cutting edge of all of this, because they're the first academy to move forward with all this. SY: It's pretty exciting. DZ: It is. I think it's great. SY: It really is. DZ: Yeah. SY: So, OK, any last thoughts? DZ: No, I think it's good. SY: I still want to know why you joined the Air Force. DZ: Oh, well, you know, I mean, my two brothers, older brothers, were in the Air Force. We grew up in Colorado. The Air Force Academy is there. We were always fans of the football team, and we had visited the academy. We were all Air Force guys. And they did it, and I just followed suit. And, you know, it was during the war and I just thought, 23 you know, was a good time to serve. And I joined and -- certainly didn't go to Vietnam. I was a Vietnam era veteran, but I just thought it was a good thing to do. I liked it, and I didn't make a career out of it. I had -- opportunity to go to officer's school, and thought I could progress faster doing studies on my own. And, in fact, that was the case. But the Air Force changed my life. I mean, it got me out of the small town, and I saw the world. And when I lived in Europe, I visited all sorts of different countries, and visited my family in Yugoslavia. I would never have done that without the Air Force. So, I am deeply grateful for that experience. It was -- it's a life -- it was a life-changing situation. Became a TM teacher, taught -- you know, learned another language. So, very, very grateful, the opportunity that was presented, and then got my education -- I mean, finished my education when I got back with the GI Bill and bought a house. And there's so many things. So, it fit, you know? And I really didn't have the brains to figure that out, what I was going to do when I got in. I just said, hey, I'm going to do this and see what happens. SY: You were, what, 18? DZ: I was 20. SY: Twenty. DZ: Yeah, yeah, so -- SY: Yeah. DZ: -- but it was beautiful, I -- so, it was good situation. Very grateful. SY: And you liked the physical challenge, too, right? DZ: I liked it. And the Air Force isn't, certainly, as physically -- challenge as, like, the Marine Corps or the Army. And my Marine friends and my Army soldier friends all agree. SY: I heard (laughter) the joke the other day that -- of the Chair Force. DZ: Yeah. Oh, yeah. Oh, yeah. SY: That was the joke that I heard, yeah. (laughs) DZ: But, you know, I take it in all good humor. SY: Yeah. DZ: And I admire them and am very grateful for all their service as well. So, it just -- we're -- I like to be part of the team. And being part of Norwich team and being accepted here and being part of the culture is really good. But, you know, in the beginning, it was very much, you know, weird and strange and odd, which I can understand. I understand that. But once we start looking at the science and the practical application and who I was and -- I wasn't into some of the strange things that are stereotypically associated -- SY: Well, again, you're this bridge. DZ: Yeah, yeah. SY: You're this, like -- DZ: Yeah. SY: -- amalgam that works, right? (laughter) Bringing meditation into these, like, more sort of, like, macho worlds -- DZ: Yeah, yeah. SY: -- like a prison or like the military or -- DZ: And, you know, what I find is that, you know, these young men and women -- Norwich -- the students here are just -- they absolutely amaze me. I mean, at the end of the sentence, they call me sir as opposed to other things that I was called when I worked in the criminal justice system, the combinations of family and different kinds of things were just very 24 creative. (laughter) But they are so motivated, and to add this tool to their -- already their intensity is really nice, because it's like a tune-up twice a day. So, it's going to make them even more effective. So, I say, as a decision-maker, when you become an officer, if that were my son or daughter, I would hope to goodness that you would have a clear mind when you're making decisions when lives are at stake. And clear minds make less mistakes. And your troops -- and you may not even have to go to war. You could be that formidable, that we don't want you as an opponent. We can -- let's have this chat. And so, who knows down the road? But we'll see. Greater minds than mind will make those decisions. But my biggest -- my hope is that they can get it in the curriculum and get it going and have somebody do that. And there's a few young people here who are interested in becoming teachers, and that would be really magnificent. There's a staff member who's interested in becoming a teacher. I would like that. It would be organic in nature, and then I could go onto whatever else I'm supposed to do and -- (laughter) SY: Right, whatever happens to be next. DZ: That's right. SY: Right? DZ: That's right. SY: And -- END OF AUDIO FILE

Transcript of an oral history interview with Maurice Homer Smith, conducted by Jennifer Payne at Colonel Smith's home in Northfield, Vermont, on July 30, 2013, as part of the Norwich Voices oral history project of the Sullivan Museum and History Center. Maurice "Moe" Smith was a member of the Norwich University Class of 1934 from Morrisville and Hyde Park, Vermont. After graduating from Norwich University, he taught school in Barton, Vermont, for a couple of years before joining the Army and serving in the military from 1940 to 1956. He later returned to Norwich University as an employee, working many different jobs over eighteen years. At the time of this interview, he was Norwich University's oldest living alumnus at age 102. ; Page 1 Colonel Maurice Smith, NU 1934, Oral History Interview July 30, 2013 112 Winter Street, Northfield VT 05663 Interviewed by Jennifer K. Payne Transcribed by Lindsay J. Gosack, February 4, 2014 Edited by C.T. Haywood, '12, January 13, 2015 Jennifer Payne (JP): This is Jennifer Payne with Maurice Homer Smith. The date is Tuesday, July 30, 2013, and we're at his home at 112 Winter Street in Northfield, VT. So let me start with some of the basic questions. I know we've gone over some of this, but this is just for the people who will hear it for the first time. Um, which class, what are you, what is your Norwich class? Maurice Homer Smith (MHS): 1934. JP: And, ah, your date of birth? MHS: 26 July, 1911. [sound of a door opening and closing in background] JP: Which makes you? MHS: 102 JP: 102 MHS: [Chuckles] I'm being interviewed here, FRIEND OF MHS: Go ahead! MHS: Can you stand by? MHS: Sit down. [Introducing someone] This is my buddy. We play cribbage together. [Friend chuckles] FRIEND OF MHS: We met. MHS: Huh? FRIEND OF MHS: I said we've met. JP: We have met. [Moe chuckles] MHS: Oh you have? Oh I did not know that. JP: Um so, um, do you have any other names you are known by? Page 2 MHS: Uh [slightly clears throat] well Moe is most of the names. I, in the, in the three years I was in Japan I was called Hank 'cause when they asked me what my middle name was, which is Homer, it's ugly. That was my father's first name. So I said Henry, so they called me Hank. And so even the official Commanding General Yokohama command wrote me a letter and they knew they called me Hank so he addressed it (this was official mail): Major Henry Smith [laughs and coughs]. JP: So where were you born, Moe? MHS: I was born in Hyde Park, Vermont. JP: Were you born at home? MHS: Yes, yes, I was born at home, in the home. I guess most people were in those days, yup. JP: Yeah. MHS: Morrisville now has a hospital, has Copley Hospital, and if it had it then I'd have been born there in the Copley, but they didn't have it then. JP: When you were at school, what was your major? MHS: In college, [sighs] it was language was one. I had [clears throat] really three majors. You normally don't have three majors, but my academic advisor, K.R.B. Flint, told me, said, "You've got the equivalent of three majors." So there's language, which was Spanish, language, I think social, uh, history, and political science. So I had three majors. He said, "you have enough credit in each one of those to declare a major." So I had three majors. JP: Wow MHS: Normally you have a major and two minors or some combination. But, he said, "You got three majors." [laughs] JP: What was your… I know you've had a number of different jobs, but what do you consider your occupation? MHS: Well, I would say most of my life was the Army. I went in the Army full time. I was on, day one, I was in Fort Knox, was activated on June 15, 1940. And that's when the Armored Force came into being. I was there four days before that and the—I was assigned to the 37th Calvary Regiment, cavalry regiment. So when I got down there my advisor said, "Calvary is out, Armor is in." So he said, "get yourself a place to live, you can't live on the post, we don't have room for you." So I went to Elizabethtown, Kentucky, which is about seventeen miles from the post. And, uh, [laughs] what was I about to say though? JP: Your occupation was in the military.Page 3 MHS: Yeah, was in the military. So I've been in the military, well, sixteen years. I went in in 1940 and came out in '56. JP: Wow. MHS: So it was sixteen years. So I was going, at twenty years, you can retire in twenty years on fifty percent, so that's what I was shooting for. And I was in Chicago at the time and I wanted to stay in. And I liked it, I liked my job, liked my work, liked the people. And my mother called up and said, "If you want to come home," which I didn't want to do, and said, "Your father will sell his shares of the drive in theaters to you." So she wanted me to come home, and so I came home after sixteen years in the Army. And but I didn't really want to. And so I bought out my father's share of the Green Mountain Drive-in Theaters Incorporated and drive-in theaters. The largest one in the state was in Newport and then one in Morrisville. And so that's what I did. And then, then I came down to Norwich, and so but I still owned the theaters, but I took the dividends. I didn't work, never did work at the theaters, didn't have to, so I just took my dividends. At that time I think we got $10,000 a year, which is pretty good money, separate. So I had five incomes: Social Security, Norwich, and I'm full time at Norwich, what was the job I said I had? And I had five jobs either way. And so I had a pretty, pretty nice income, so I was living high on the hog. Sent Bill to Northeastern, my son. He didn't do anything, and he is smart enough to do it, but he didn't. He didn't like it. He came back. He said one semester and said, "College isn't for me." So he went off in carpentry and did his own thing. And that's what he wanted to do, so. JP: Wow. So why didn't you want to leave the military? MHS: I didn't want to leave the military, because like I said I had sixteen years and at twenty years you get two and a half percent a year. So if I stayed in for twenty years, I would have gotten, I was a colonel, I would have gotten fifty percent of a colonel's full pay. The maximum is 75%. You could stay in long enough to get 100%, but it stops at 75%. And I would have gotten four more years. I wanted to stay in, I did not want to get out, but mother wanted me to get out and so I did. But I, I…Chicago was my last duty station and so I think I made a mistake, but it doesn't make any difference. I probably made more money by getting out than I did by staying in, so [chuckles]. JP: So it was the money, it was the income, the plan, yeah. So you were born in Hyde Park and you moved to Morrisville as a youngster? MHS: One year, I asked my mother when we moved, she said, "you were about a year old when you [moved]." Hyde Park is only about three miles from Morrisville. I was born at Hyde Park and a year later, so I grew up in Morrisville. And graduated from Peoples. JP: Academy? MHS: Academy. JP: Yeah, how did you know, in high school, that you wanted to go to Norwich? Page 4 MHS: Well, I did not have any college picked out and my brother was at Norwich, and my folks were paying the way and they said, "You're going to go to Norwich." So I never questioned it because my brother was here already ahead of me. He was two years older than I was and he was already here at Norwich. And they said, "You are going to go to college, you're going to go to Norwich." My brother had two colleges he wanted to go to. One was Georgia Tech and the other one was University of Alabama, and the folks said, "You aren't going to either one of them. You're going to go to Norwich." So my brother was here and my—the three of us, only five of my graduating class at Peoples, and three of us came to Norwich. And so I guess I was destined [laughs] to be a, a graduate of Norwich. JP: So your brother's, your brother's name was…? MHS: Phillip. JP: Phillip. And he was class of…? MHS: He was, well he would have been, he took a, he was four years ahead of me but he took a PG course in high school so he lost a year there. He was really two years ahead of me. He was two years older than me so two years ahead of me. And we both went to, he went to Norwich too, my brother did. But he didn't graduate. We'd have the quiet hours from 7:30 [P.M.] to 9:30 [P.M.], and at 9:30 we could, all hell would break loose in the barracks. The whistles would blow and we would get dragged into our holes, and dragged into your hole, we would get in our rooms and it was quieted down and during study hours it was very quiet and, uh, I don't know what brought that on. What were we talking about? JP: Your brother, your brother being ahead of you at Norwich. MHS: Yeah, he was two years ahead of me. And but he didn't graduate. But during study hours, what he was doing was playing cards. What I did was studying. I said—I was really driven to study. I said, "If I don't study, if I don't succeed, I'm going to be carrying a lunch basket to work. And if there is anything I don't want to do, it is carrying a Goddamn lunch basket, a lunch box." And you will if you don't succeed so I was driven to, for success, and I was, and I graduated number three in my class. [Laughs] I was driven I had a desire to do it I said, "I can't fail, I just got to do it." I dug in. So my brother was playing cards and I was studying, so he didn't graduate he, well I won't say he failed out but I used to do his Spanish. We took a Spanish class together and he would be playing cards and I was studying during all that time. I said, "Phil, I got maybe ten sentences all translated so you can copy them off if you want to learn this." Same Spanish class together. [laughs] JP: Was he playing poker or what? MHS: Oh yeah he was playing any kinds of cards. Probably poker or anything like that. In the barracks, quiet. It was very quiet you couldn't talk above a whisper and if you did like whoever was on guard could hear you out in the hallway, you were placed on report and given demerits. You had, allowed 9, were given 9 merits and for every demerit, like I guess walking on the grass I guess was 2 demerits. And so you could, so of all the years my brother was working towards, Page 5 all the time he was there shoveling horse manure on the Sabine Field and things like that, walking tours or either working tours off, punishment tours. And I only, I was a corporal. I only—one month I went over, I had 10. So I slept in, I mean I couldn't sign out for home, I normally sign out for noon so I just stayed in my room till 2:00, from one till two to get rid of that 1 tour and then I went home that weekend. And that was the difference between my brother and me. He was, my brother was in CMC, Close Military Confinement. And that's 10 demerits, 20 tours and 30 days Close Military Confinement. And that's pretty rough on a cadet. And a lot of them quit when they get that. You have to do something really bad. My brother was, he was a, he broke his collarbone. Harmon was leading a charge in the stable; my brother was riding a horse named Ham, H-A-M. And they were racing, and the horse stumbled and my brother went over, pitched over his head there and it was a mad rash. They made Pathè News, Norwich did, Pathè News. So my brother went over the, stumbled Ham, and landed and broke his collarbone. So he was in the hospital and on the post, the post hospital there. And he went to the sign out, he didn't sign out, he went to the movies and he got a good, that's a no-no. So he got caught, got 10-20-30, 10 demerits, 20 tours, and 30 days Close Military Confinement. It's pretty pretty rugged. So he was in a jam most of the time and I wasn't. I said I was a corporal and all sophomores are corporals, juniors are sergeants if you are made, you are sergeants, and the seniors are officers. That is the way it works up there now, I think, even now. Was in my day. Everybody was a corporal that was made, you were either a private or a corporal. I do not know what percentage probably 20% maybe, or 15%, were non-commissioned officers. So all sophomores, you cannot be over a corporal. A junior, you can be different classifications of different sergeants. And as a senior, then you are a non-commissioned officer in the militia, not the army, in the militia. So that's how it works. JP: What does Close Military Confinement consist of? What did that mean? MHS: Well you're like a prisoner, it's like being in prison. And when you go to meals you have to, there is a pass book on the floor, there would be a desk there and you would have to sign out for your meals and sign in for your meals, just like a prisoner. And you were a prisoner. And you have to copy where you are at all times and have to check in and it's pretty rough, it's pretty rough. And you can't speak to anybody, and the cadets can't speak to you. You are ignored, completely ignored. And I had one when I was up on the staff and his father was a superintendent of schools in southern Vermont. Quite a big shot. And he got on CMC, Close Military Confinement, and I'll tell you, he said, "It's no fun being ignored by the people you can't speak that way and they can't speak to you, like a prisoner." And it is, I guess, pretty rugged. He said, "I just kinda laugh smiling about it." He said, "It's nothing to laugh about it," I said, "that's pretty rough stuff." [laughs] JP: Do you have other siblings? Brothers or sisters? MHS: No, just the, well I had a sister, three years old, and we were close 'cause I was seven, my brother was nine. And so I was there enough to my sister. So I paid attention to my sister, my brother didn't, he was nine when she was three and she got appendicitis and died. She had appendicitis for a week, her face was flushed and everything and the doctors didn't know what was wrong with her! So they had a consultation of doctors, of 3 doctors. So at the consultation one of the doctors said, "I think she has got appendicitis," and that's what she had. So they put Page 6 her in the car, my father took her to Burlington, over the rough roads. The roads weren't like they are now, they were gravel roads, and he complained, my father, about hitting all the bumps and everything. And well they were too late, the peritonitis set in, she took her. JP: So what did your parents do, you said that he had a theater, did they have a theater when you were growing up? MHS: No no, that came later in life. That was when I was in the Army. And I get out in 1956, yeah 1956, well that's right I came down here. No. JP: So when you grew up what did they do? MHS: Well, I taught high school in the Northeast Kingdom as the, who was it they called it that, one of the, they called it Northeast Kingdom it stuck. And so, what were you about to say?1 JP: Oh, just asking what it was like when you were growing up. MHS: Well, I, ask me that again. JP: What did your parents do when you were growing up? MHS: Well, of course my mother was housewife, my father was real estate, real estate. And he'd sell it either on a commission, like someone would have a farm and turn it over to my father and father would find a buyer for it, he would get commission like 5% or 8% of the sale. And so that's what my father did. Real estate. JP: So, your parents helped you to decide to go to Norwich and you liked it? MHS: They didn't, they told me where I was gonna go. I told you my brother wanted to go to Georgia Tech and Alabama, one of those two. And they said, "No, you're gonna go to Norwich." I guess they figured he needed the discipline, the military, the discipline. And when I went, I was only, in Peoples, there was only 30 in my class, 25 girls and 5 boys. So 3 of us, 3 of the 5 boys all went to Norwich. JP: Wow, that's a pretty high percentage. MHS: Yes it is! [laughs] JP: So who was your roommate at Norwich? MHS: My roommate was, well that time, four in a room. So the—it's a big right room and I lived in Jackman Hall, was the dormitory. And the people I graduated—White, June White, Ross Grey, and I graduated from Peoples. So we were there and the fourth one was Bob Washburn, and he was from Massachusetts.2 1 Attributed to George D. Aiken (1892-1984) Vermont governor and senator. 2 MHS might be referring to Leon Morris White and Charles Russell Graves of Morrisville, VT. Page 7 JP: So the people you went to high school with your roommates. MHS: Yeah, yeah. They were. Yeah. JP: Oh that's great. And how did you decide which fraternity to join? MHS: Well I didn't have to make it, my brother was ahead of me, and he was a Sigma Alpha Epsilon, and so I was just automatically. I guess I did get a bed at one of the fraternities and but I could go—I wanted to go S.A.E. anyway. So I was just automatic, I mean, you have to accept the brother if he wants to go. And so I was S.A.E. And S.A.E. is the largest fraternity, in my day, in the country. And they had I think, I think the number was twenty-eight, I think throughout all the whole United States there were twenty-eight universities that had S.A.E. and the next one was Kappa Sigma they had twenty-five chapters. S.A.E. had the most in the nation, had twenty-eight chapters. JP: Wow, and do you remember the song that you sang for Sigma Alpha Epsilon? MHS: Oh yeah. JP: Would you mind singing it? MHS: [Singing] Oh sing for Sigma Alpha Epsilon, (lets see) Oh sing for Sigma Alpha Epsilon, and to Minerva (that's not a good key). Oh sing, Oh sing for Sigma Alpha Epsilon and to Minerva who will lead us on! And to Phi Alpha with her guiding light. To royal sons who fight, fight, fight, fight, fight! And when some day we will tell our sons, about the very best fraternity, oh sing for Sigma Alpha Epsilon, our dear old S.A.E. [laughs] JP: [laughs] That is wonderful; would you like a drink of water? Are you okay? MHS: Yeah I am okay, sometimes your voice is clear but now it's not. JP: That was great. MHS: So sometimes in bed I'll sing, and I'll just sing myself to sleep. I'll hum, and it's pretty good. And this is one of my off days [laughs]. My voice isn't in the singing mode. JP: [laughs] It was wonderful! That was terrific. Do you remember your uniform at Norwich? MHS: Yes, yes. JP: What was it like? MHS: I had my picture in the yearbook when I was a corporal and yes, we had the War Whoop was the yearbook, and I was in there because I was a corporal. And all the non-commissioned officers get special caption, a picture of you and well that's, well I was a corporal. All, well most Page 8 the people, most of them were privates, but the few, I don't know what, 20, 25 or 30% of them are non-commissioned officers and all. Corporal is the highest you can go as a sophomore. If you are appointed, sophomores are corporals, that is all. Sergeants are juniors, and commissioned officers are seniors. So I was a corporal, and a sergeant, and a second lieutenant in A Troop. We were troops then, A Troop, cavalry, horse cavalry. JP: Tell me about the horse cavalry. MHS: Well we had, I don't know how many horses we had. The stables are still up there, the original stables. We would have to, once a week, just like your classroom schedule would meet Monday, Wednesday and Friday or Tuesday, Thursday, and Saturday, it was on there. So once a week we had to go out to riding hall, the riding house, they're still down there, think the riding— no the stables, the riding hall is gone. You would go to this riding hall and do all these different formations inside. By the right hand, Hooo! By the left hand, Hooo! [laughs] and that sort of thing. JP: Did you learn how to ride a horse at Norwich or did you know before? MHS: No, I had a pony of my own at home. So I was, I know the head of the horse to the tail of the horse. People came up from Massachusetts and didn't know what a horse was, but I did. I had a saddle horse for two years before I went to Norwich so I was a veteran [laughs]. Most of the people were, didn't know one end of the horse from the other! JP: Do you know what breed the horses were that you had? MHS: Well no, but they were well trained. When you first went for drill, for close order drill, number one, one, two, three, four in a column. For example, so we would be in a line, and they would say, "Fours left, Hooo!" And you, first they would say to you, "Column fours, be one, be in a line. Column one, two, three, four. Column fours turn your head to the right in your line, and now one, two, three," and I would say, "Four, one, two, three, four." The next row, one, goes "One, two, three, four." And the next one, "two, three, four." So when you were in the line, they'll say, like we are marching for chapel they'll say, "Fours left, Hooo!" And we, everybody, the number one would pivot and the other went around and we went around in a column. There was nothing to it, a piece of cake. JP: It must have looked wonderful. MHS: Yes, it was good, it was a, it got the job done. JP: Did you drive a car on campus? MHS: I had a car my senior year. Yes I had a Buick Coupe. You had to be a senior. Underclassmen could not have a car, but that was a senior privilege. You could have a car, so my dad [telephone rings in background for a few minutes] had a Buick Coupe that he gave me. So I had a car which was nice. Because we could go from the barracks to downtown which was, Norwich was about a mile. We would pile in, go down to the movies, then come back. It came in Page 9 kinda handy. And when we got home weekends, we didn't think of hitchhiking, I had a car right there. So with four from Morrisville we would pile in the car and go to Morrisville [laughs]. JP: That must have been grand. MHS: It was good. You had to be a senior to have a car. JP: Now I noticed in the War Whoop that you were an expert swordsman, an expert pistol, and an expert rifle shot. MHS: I was. I think I was a marksman as a rifle, sharp-shooter as a pistol, and an expert in the saber. And the saber course was be these dummies, would be men, you would come galloping down, like a column, and you'd just, you would lunge forward. I said "Geesh, I'll probably break my arm, but well I'll do it because it was what we were supposed to do." Worked like a piece of cake. So it was on a pivot, like a row, and so we go galloping down, we gallop past, take the saber, and jam the dummy and follow it right around. And when we went past it, we would pull it back. And it worked like. JP: Was it a real sword? MHS: Huh? JP: Was it a real sword? MHS: A real? JP: Was it a real sword or like a wooden sword? MHS: Oh oh, it was real, I mean it was-- JP: It was sharp. MHS: Yeah, it was, you got a medal for it. I said I was a marksman with a rifle, a sharp-shooter, a higher class, as a pistol, and an expert in the saber, in the saber course. JP: And you all learned those things at Norwich? Or did you practice as a kid? MHS: At Norwich, yeah. JP: So they taught you all that, they taught you how to be all that. MHS: Yep, learned it at Norwich. You got it at Norwich. So I had on my tunic, I had those medals, three different kinds of medals on my tunic. JP: Very good. So what was it like to be a Rook, I know you've talked about being a senior, but what was it like to be a Rook?Page 10 MHS: Ooh boy was that bad. It really was. You were not supposed to haze, but it was, it was mild hazing, mild hazing. For example, they would say, "alright get the rooks on the floor like a row boat, you are rowing a boat." It was hazing, you were not supposed to haze, but they did. About two weeks, the first game of the season was Dartmouth we always played at Hanover. They never came here, but we went, the whole Corps marched at Dartmouth. We would march, line up on the street there, and then march onto the field. The whole Corps for the game. We were there for two games. We did that with Dartmouth for the first game of the season, and we did it in the state series. Middlebury, Vermont, Saint Michaels, and Norwich. And we'd marched. If we played Middlebury, we would march at Middlebury. Middlebury, I think there, most everybody came here. I know we went there. The whole Corps went to Coast Guard. Had a special train for the whole Corps. The whole Corps went down to New London, Connecticut to play the Coast Guard Academy in football. JP: On a special train? MHS: Yep, a special train yep. JP: That's always been a big rivalry for the Coast Guard. MHS: Yes, it has always been a good rivalry we have had with the Coast Guard. We always had, we have a nice, nice relationship with the Coast Guard. JP: Now you were quite a jumper. MHS: Yes I was. In the pole vault particularly. Well when I went there, in high school we had track and the coach, Coach Baker was my chemistry professor but he was also the track coach.3 And I went out for track, and I had the no form. It was just jump over, jump over any way you can get there, it was no form. He called it no form. He said, "I'll teach you the eastern roll or the western roll." He told me exactly how they went. So [he asked], "Which one do you think you will like to go on." And I said, "Let's try the eastern roll." That is: you don't come charging really fast, you've got to take a little hop, then take six or eight steps so it comes out just right. You know exactly where, and you go to the bar, you kick up like this, over the bar. With this foot, you twist it around so that the bar hits your body instead of your butt. You aren't dragging your butt, and knocking it off with your butt. So you kick up, with the eastern roll, and then do that, and twist your body right around and the bar passes your body. You want to get your butt out of the way. So I was a high jumper and in the pole vault, I did the 12 feet. The standards only went up to 12 feet and I guess they didn't think that anybody could do it, but I did. So I was the, and the broad jump. So every year, from freshman to senior, I got a little more as a sophomore, more as a junior, and more as a senior. I kept going up. So I was quite the track star. JP: You were, you were. MHS: And P.D. Baker was my chemistry professor and he was like a father to me. A wonderful, wonderful man. So he taught me all those things. He knew how they went. I stopped to think 3Perley Dustin Baker, NU 1920 (1897-1995), was dean from 1950-1957, worked from 1920-1962. Page 11 about it, I said, I think if I had chosen, he said, "you can have your choice." He explained how it was and I think if I had taken the western roll, I think I could have probably gotten, I just got a feeling, I could have probably gotten one or two more inches higher with the western roll. But he taught me the roll anyway. I liked P. D. Baker. He was dean there, and it might have been later, anyway, he was like a father figure to me. I guess that about covers it doesn't it? JP: That's great, what did you do for entertainment? MHS: Well we had, I was an S.A.E., as I told you it was the largest fraternity in the country. It had more chapters than any other college [fraternity], of all the colleges. We would have Freshmen Week, which would be around January. Classes were suspended and we would have 3 days, 3 days, on the weekend for just parties, dancing, and doing anything you wanted to do. It was dancing mostly and you would get your date there. And you would look around downtown get a rate or rent if they couldn't travel, if they were out in like Massachusetts. Then the cadet would get a room for their date, for like Freshmen Week or Junior Week were the two big weeks. Freshmen Week and Junior Week. Freshmen Week was around January, Junior Week would be around May I think. So I had, I had a girl, Cotting her name was, Emma Cotting, and I had her down for the weekend. And of course a lot of them, I would say probably about a fourth of the cadets had dates on those big weekends. The others didn't have them. Either they couldn't afford it or didn't do it for one reason or the other. But I did, I had a date down. And she lived right there during those three days, probably like Friday, Saturday, and Sunday or something like that for Junior Week, for Freshmen Week and for Junior Week in May and Freshmen Week was in January I think. And all the classes were off, and the parties were in. I remember I had some money, and I get through the fraternity and they made us, something, your boaters, not the boaters in something. We didn't want them in. So I went down there, this was during Prohibition, picked up a pint of whiskey and I paid $4.00 for it. I got to thinking, I said, "My God, I can't really afford four dollars." That would be quite a few trips to the theater, pay for a lot of the theaters. So I bought it for four dollars, I didn't have a date and so one of the cadets who did have a date said, "I'll give you $3.75 for it, and I said "Sold." So I lost twenty-five cents but I could go to more movies [laughs]. JP: So movies were a big thing? MHS: They were downtown, you had to get downtown. JP: So where did one procure liquor during Prohibition? MHS: Well I didn't ask, we just, we got it through the fraternities. The fraternities would, you would sign up for it and they, somebody would get a bootlegger or something and they got good liquor. Probably went up to Canada I presume, probably and got it. So I said, $4.00 for a pint, or half a pint, or a pint and I, like I said, I said "I can't afford that. I would rather spend the money on movies." So I sold it for $3.75, sold my pint for somebody that had a date. It was worth it. I remember we used to go to Lake Eden, during the summer time. Lake Eden was 2 hours, 17 miles I guess, 15 miles. And Eight Guide Dunbar, a wonderful band, 8 piece orches—geez, they were everywhere, they were from St. Johnsbury, Eight Guide Dunbar. We would go there every week, Lake Eden, to dance. The men would go up separately; the girls would go up separately. Page 12 Almost everybody took a date. The girls would get up there by bus or any way they could get there. And they would sit on one side of the room, and the men would stand up in the back. When they would wind up the music then we would go over and we'd pick out somebody or for dancing on the floor. I remember I was dancing with this girl, probably could have been my date, I don't know, I was dancing with this girl. Anyway, and a lot of stags went up there. So I would see this girl, and she would shake her head no, too. I said the next dance? No. The second dance? [laughs] While we were dancing, you have these singles. So like I said, the girls got there by bus or I don't know. They got there, they got there anyway. [laughs] JP: What kind of dances did you do? Do you remember? MHS: Most of them were, in those days we used to Jump the Hop. We did a lot of turning around. We would dance around or we would dance, dance, and we would dip. Or at Lake Eden we actually jumped. We would have your partner jump right in the air, jump, jump. It looked good from the outside. I said, gee that looks like great fun, so I learned how to do it and we would jump. Just jump with the steps rather than glide. Supposedly we would jump and twist in the air. It was good. JP: And you were a good jumper. MHS: We thought we were hot stuff! [laughs] JP: Do you remember any slang? MHS: Any what? JP: Any slang? Did you guys use slang? MHS: Slang? JP: Slang. MHS: S-L-A-N-G? Slang. JP: Correct. MHS: Oh, yeah I guess we did. The people from Massachusetts used to rip on the Vermonters for the way we, for the slang, for the way we talked. And the New Yorkers talked different, the Massachusetts talked broader. Vermont talks a lot flat, flat and hickish really, and Massachusetts were a little different and New York was different than them, just a little bit as a group you know. The rest of the states, you could tell, you could almost tell a state a man was from, whether he was from New York, Massachusetts or Vermont by just talking to them. And of course we were hicks. Of course, the Vermonters, we would usually take a ripping from the cadets from Massachusetts for the hickish way we talked. We probably did talk like hicks. [laughs]Page 13 JP: Did they call you hicks or anything else? MHS: No, not that I know of. But we, well they might have, might have called us hicks. If they did, they were right. We were hicks. [laughs] We wouldn't deny it. JP: Now was Mike Popowski one of your roommates? MHS: Yes, Mike was a—when you're—all sophomores, if you are promoted in the Corps. I think about probably 25% maybe are promoted, maybe not quite that maybe 20% are promoted. So you are supposed to live, not officers live with officers, if you are officers. Privates, senior privates, lived together. Juniors were sophomores were sergeants, and sophomores were corporals, juniors were sergeants, and seniors were officers. Now what did you ask? JP: About Michael Popowski. MHS: Oh, oh, well so well my room— I was an exception. I came to Norwich as a private. I had been there only one week. The very first week I was called into the commandant's office. You're promoted at the commissioning ceremony in the spring when, before you break up. You have a promotion parade and I wasn't on the list. Well when I got back, the first week of school I was called into the commandant's office and was promoted right there. And of course a corporal had to get his stripes sewn on. All sophomores are corporals, privates, and privates. You are a corporal, you are a non-commissioned officers, juniors are sergeants, and seniors are officers. First lieutenants through, well my day the highest rank was a major, was the highest rank. Later on they became a colonel was the highest in the Corps. But in my day it was a major, one major. Then there would be about four or five captains. It would be A Company, B Company, C Company, and Headquarters Company. They were commanded by a senior, by a captain, a senior cadet captain. They would have a captain of the company, command the company. A first lieutenant would be the second in command. Then you have your, like I was in A Troop, and we would have two, two second lieutenants. I was one of the second lieutenants as an A Troop when I was a cadet there. JP: Was Harmon the commandant when you were there? MHS: Harmon was a commandant my first year and then it was his last year there. My sophomore, junior, senior year was a, Harmon was the, my sophomore year. And, who was it? I can't remember his name now, I'll have to remember it, but my sophomore, junior, senior year, it was a new man that came in. They are Regular Army people. That was a duty. They are Regular Army, and it was a duty assignment. And, let's see, Harmon was a, well he was a captain when I came in there and he yeah, he was, he controlled the—the Army furnishes officers for each, each company, for the whole Corps I think there was 17 officers. We could appoint 17 officers, cadet officers. And they're appointed by a, well, a commission. I don't know as a group, I don't know who picks them out. I never did understand who picked them out. Well I was a corporal as a sophomore, and that's all. You are either a private or a corporal. Sergeants, you are either a private or a sergeant if you are made. And a senior, you are either a private or an officer. In other words, a company would have one captain, one first lieutenant, and two second lieutenants. Now I was in A Troop, so A Troop was in Jackman Hall. We had a captain, a first lieutenant, and two Page 14 second lieutenants in the company. Or then there was a, they didn't call them companies. They called them companies later on— we called them troops. We were a troop, troopers, cavalry. Cavalry called them troops. Infantry called them companies. So my freshman year we were troopers. Now they changed it to companies in the Corps. JP: So did you go on the ROTC Hike of 1932? MHS: Did I do what? JP: Did you did the ROTC Hike of 1932? MHS: The, um, no. The uh, that was the one year they did not have it. But the year before they had the summer hike, and I think the year after. But my year they had to cancel it so we went to Fort Ethan Allen. Before you would arrive in the post, [then] ride horses from the post to Fort Ethan Allen. Well this year, they could they were tight on money or something so they, we did not have that summer ride. I think ours was the only class that didn't. I think the class after us did. So we drove to the fort on automobiles and our parents dropped us off. But all the classes before and after us, they rode. They took this secured route from Norwich to Fort Ethan Allen. But my year we didn't take it, we drove in cars and rode our horses when we got there [laughs]. Or whatever it was we did, I don't know what we did. JP: So when you left Norwich, and you graduated, and you went in to the military? You went straight in? MHS: No, not immediately. I think it was only, it was hard to get in. As I remember only two people in my class got a Regular Army commission. You went into the Regular Army when the rest of us went into the Reserves. So for 95% went into the Reserves, we were reserve officers. We went down every two weeks out of, we didn't get a chance to go on active duty. So we didn't actually get our commissions. We didn't see much active duty. JP: What did you do after you graduated? MHS: Well I taught high school up in Northeast Kingdom in Barton. I taught there for four or five years. Well from '34 through '39, and then in '40 I went into the Army. JP: What caused you to go into the Army in 1940? MHS: Well, I, thank you [someone passes Col. Smith a drink]. Well I wanted to get in, you couldn't get in. It was good pay. So in 1940 apparentlyWashington got some money together and so those who wanted to could volunteer for active duty. That was 1940. So I jumped, and it was good pay. It was a lot better than teaching high school. I started at $900 at Barton, Northeast Kingdom, $900, then $1,000, $1,100, and then $1,200. I got a hundred dollar bump each year so my fourth year of teaching I got $1,200. When I went into the Army, I got a hell of lot more than that. When I was getting $1,200 I was getting $4,500 to $5,000, I got about four times as much in the Army. So I went in the Army, and the activation of the Armored Force. My order said the Page 15 37 th Calvary Regiment. When I put in for active duty they came through. When I got there and reported to the officer in charge, the Regular Army officer in charge, who was a lieutenant colonel I think he was, he said well. I said, "Mine said that I was assigned to a cavalry unit." He said, "Cavalry is out. Armor is in." So on the activation the Armored Force came into being on the 15 of June, 1940. The 1st Armored was at Knox, the 2nd Armored was at Benning. I was the 1st Armored Division on the first day of the activation of the Armored Force. On the ground level. JP: Ground floor. MHS: I was assigned to a, well, reconnaissance company. The recon company, the recon battalion, A Troop. A Company was armored cars. B Company was scout cars, C Company was tanks, which I was assigned to C Company. And D Company was half-tracks. Everyone had their own division type of vehicles and we all had cycles, motorcycles. That's what I was in. I remember we had old horse sheds that had no horses, and that's where we kept the tanks. So when we went to pick up our tanks they said, "Alright, anybody that has ever driven a tank, step forward or turn your name in." You were here to pick up some tanks. There was just a few handful had driven a tank, and so I was not one, but some of the old Army people had driven a tank. So they got enough tanks. They came out of a depot somewhere and so the people who had driven tanks stepped forward and drove the tanks into the motor park which were really converted horse stables. They were, now [instead of] horses there were tanks in there. Same place but different vehicle [chuckles]. JP: What kind of motorcycles did you ride? MHS: What kind of what? JP: Motorcycles. MHS: Oh, I think we had the Indian motorcycle, I think. It was Indian. And well they had the, the first ones we had, oh God it was a pleasure to ride. They were down, you sit right down, you had controls, sit right down. Well I'll be goddamned if they didn't give those up. They got the new ones and they are up in the air. Well Jesus, it's like learning to ride all over again. On those low ones you just sit right down, sheesh, you could just feel it, you melted right into the cycle on the road. You melted. Now you sitting up here and by god, I never did like them. They were hard, and if you got off balance, you would go down, you would fall down on the ground. Then you would have to get up shame-facedly and pick up your cycle and mount it again [laughs]. I remember one exercise we had, we were out in the field and we come riding into this spot and dismount. And somebody on the team would throw you a Tommy gun, through the air. I don't know where it would come from, but they would throw it to you, and you would have to catch it in the air, the Tommy gun. You would blast a couple [gun noises], it would rise up [gun noises], bring it down, you would take 3 or 4 shots and it rises on you. You do not try to hold it down. You know it is going to, so you do it, you let up on the trigger, then get out 3 or 4 more rounds. Page 16 Then it gets to ride up. Just the force of it forces the Tommy gun up. Then we, when we would finish that I would take the rifle and the submachine gun and toss it to the instructor, jump on the motorcycle, and you are gone [chuckles]. That was a test, I mean, I guess all the officers went through it. It was fun, it was fun. I liked it. It was good. JP: What other weapons did you carry? MHS: We didn't carry anything. We, uh, I'll tell you, in Germany General Harmon had the Constabulary. So when I went outside in Heidelberg and yellow, we had yellow shoelaces. We were special. Constabulary was a special group of soldiers. And we were hot stuff, I guess, under Harmon. And was everybody assigned, a quite few. Well I made the cavalry in Germany and uh, is that it? Does that answer? JP: So you were part of Ironsides? And did you take part in any combat action? MHS: Um, you mean real combat? Or, or, we had maneuvers and it was just like combat. I mean it was, it was. Well you are in a war! I remember I was in the recon battalion, reconnaissance battalion. We were deployed down on the line in a big field. We were there, nothing was happening. We were up front cause— we reconnaissance battalion is the forward most unit of a division, of an armored division, is the reconnaissance battalion. And I was a recon battalion. They lead the entire division. The reconnaissance battalion, and I was in recon bat. So we got here on this field here, nothing was happening and we were just holding there, waiting for something to happen. All of a sudden all hell broke loose and tanks just covered that field. I stood there and said, "My god, it was a maneuver." And that field was covered with tanks! I guess, I never saw so much tanks in my life! And I, uh, "Holy Jesus what am I seeing?" I was really captivated by it, I was a, it was a maneuver, it was maneuvers. JP: And where was this? MHS: Jesus. Well I can't remember. I was the 1st Armored and the 1st Armored was at [Fort] Knox. The 4th Armored, I think, was Drum, Fort Drum. 10th Armored was, I was the 1st, 4th, and 10th Armored as they were building up the divisions. They would send the cadre, a pit crew, to form a new division. They were forming new divisions. So I started out in the Armored, the 1st Armored, the very first beginning, the 1st Armored was in Fort Knox where I was. The 2nd Armored was activated on the same day. The first day of the activation of the Armored Force was the 15 of June, 1940. The 2nd Armored was at [Fort] Benning. Then they grew, so they had 18 armored divisions. They have cadre as a shell for the making of all the key positions of a unit. Then they send in recruit fillers, to fill it up to full strength. That's how they would increase. They had an outline, just an outline of key people who would be assigned as the cadre staff. I was the 1st Armored but I was picked as a cadre for 4th Armored Division. So it's a shell of the officers and non-commissioned officers and then the fillers come in and fill it up. And they go on and do it that way with the 18 armored divisions I think. So I was the 1st, 4th, and 10th Armored Divisions. Page 17 JP: So you were stateside. Were you overseas? MHS: Oh yeah, yes I was. That's, that's something. I went, I was overseas. Where the hell was I? Jesus. Goddamn [whispered with frustration]. I was overseas. Europe? FRIEND OF MHS: Moe, What did you train on tanks in Hawaii? You were a trainer, what did you train people [on]? MHS: My job there was to train Marines on the tank mounted flame-thrower. Hell, that was it. That was a school. Each Marine Division had one tank company or battalion, I can't remember which. They would send a whole unit of Marines over to—I was the head of the school at Kolekole Pass, that's where the Japanese flew in, over that cut in the mountains when they bombed Pearl Harbor. And uh, where was I now? FRIEND OF MHS: You were training Marines. MHS: Yeah, I was training Marines and we would set up trebles on the guns, on the flamethrowers. The flamethrowers were co-actually mounted. You would have a 76 sticking on the tank a big rifle, a big, long tube, a 76. And co-actually mounted to that was a flamethrower right beside it, or below it. So you could have your fire power. You're in the tank, you would have the ammunition in the tank. It was underneath the turret floor for your stored ammunition. So they were independent. They could fire, I can't remember how many, rounds of 76 you could fire or you could use the flamethrower. Either one. And we would make our own napalm. It is like a sawdust, soap, chips, I guess like soap. It's like sawdust, looks like sawdust. You can't get it, even a drop of water, or it breaks it down. So you have to be careful that the drums are dry and you had this napalm, that's the sawdust-like stuff, and mix it up, and it's rubbery. And you reach in there and pull it out like that and hold it and let it go a little snap back to base. It was heavy, it was elastic, like elastic. Now that's your flamethrower stuff. And it has to be that way so you can back off your tank, and that thing we couldn't throw a flame and it works out. They would, I wouldn't happen to be with the unit at that time. But the Japanese would hole up in these caves, so we'd get these flamethrowers and since it was almost impossible to dig out, 'cause the side was like a mountain, all rocks. They were inside with peepholes and everything. Hard to dig those people out. So we get these flamethrowers in there and course they had the aperture, they had it open so they could fire. And we would put the flamethrower and probably shoot it, probably, a couple hundred yards. If it was mixed just right, just right, it was like rubber, like rubber, and you could back your tank off and we would, they would, it had to be that particular action. But then they would fire these flamethrowers in these apertures, or whatever you call them, the rock where they fired. And they would put the flamethrowers in there and burn up the oxygen and those Japanese would be dead. D.E.D. Dead [laugh]. And not a mark on them, they wouldn't have a mark on them, but they'd be dead. It would burn up the oxygen in the air in these caves and kill them all. Just, just, just asphyxiated. JP: Where were you during, where were you when Pearl Harbor occurred? Page 18 MHS: I was in Hawaii. I was in Hawaii and I had a school there. I was the head of the school. Head of school on the tank mounted flamethrower and as I said, we work with; we made mostly Marines, training Marines. Those Marines, I couldn't sing their praises enough, the, the [fades out] FRIEND OF MHS: Moe, when Pearl Harbor was bombed, where were you located? Were you still in the States or were you elsewhere? MHS: No, no, no, when Pearl Harbor was, no, no. When Pearl Harbor was bombed I was in Hawaii with the, with the tank mounted flamethrower - FRIEND OF MHS: So you were training Marines. MHS: training Marines. When the peace came they dropped the bomb and so they gave us 48 hours. We had these big, these 55 gallon drums. We had like a mountain of them, just a heap of them. Gasoline rations for the states they sent it to us to burn up in the flamethrowers or whatever it was. It was hard to get gas for use here for the civilians during the war. So we, when the armistice, when they dropped that bomb they sued immediately for peace, so they gave us 48 hours to clear the range. So we had a veritable mountain of 55 gallon drums, long and high, filled with this napalm. And we opened those drums just as fast as we could open them. And we had a veritable pond of that napalm, that rubberized stuff there, and we would back a tank off, put a flamethrower on it and you would have thought the whole island was going up in flames. I mean it was some fire, I'll tell ya. That was the Kolekole Pass. It was a plateau. It was a low cut in the mountains, I said when the Japanese bombed Pearl Harbor they came through that pass and I had been there at that time. They flew right over where I had my school. FRIEND OF MHS: So what did you do in Japan? When you went to Japan after the war? MHS: Let's see, I was, Oh! Here is a funny thing. I was, I was an obs-, obscure, obscure major. I'd been there 3 days. Nobody knew me. Hell, there probably a thousand, probably hundreds and hundreds of majors there. It was all in the Far East Command under General MacArthur's Far East, Far East Command. And I'd been there just 3 days and my name came up to be on the General Staff. And I said, "How in hell can I be made? They don't know me!" I said, "I'm the new man here! I am one of hundreds and hundreds of majors and they picked me out. There was a feather in my bonnet and God was with me. God appointed me. God had something to do with that." Three days I was on the General Staff. Seemed pretty good. It was about 18 or 17, we'd have a staff meeting every day. I would be there and it was under, we had reports that came into me and I had a guy in my division that wrote them up and all I had to do was sign them. So I signed them as if they were my reports because I was the head of the division. So, so I signed it, I signed it. I didn't change a word. Call McCarthy, I signed it, sent it up to G3 with my signature. G3 took my name off, put their name on it and sent it up to GHQ Far East Command, General MacArthur's headquarters. It went through all those chains, everybody put their name on it, and I didn't do a thing. I just, tt was all prepared, I never, in all the time I was there, only Page 19 one time there was a paragraph in there that was way off, and I took that out. I said, "By god that's not going to go into the report, that's for goddamned sure." So I took that out. When I said that was my report, when they get it, it was their report to GHQ they passed the line. It was a, I didn't do anything, no really, all I did was look at the reports and send them on up. I did not do anything. But I, it was important because it went to GHQ and the GHQ, when they got through with them, sent the reports to Washington. JP: And after the war what did you do? MHS: After the war I, well I was in Chicago Headquarters, Fifth Army. My mother called up and said, "If you want to come home, your father will sell his shares of the drive-in theaters to you." And I really didn't want to come out, I liked Chicago and I liked my job. I just, I had a good job, and I did not want to leave. I had it made. I had 16 years. All I needed was 4 more years to retire at 50%. Well, mother said, "Your father will sell," So I said, "Well I guess she wants me to get out," so I get out. I really did not want to go, but I got out after 16 years and went home, and bought out my father's shares of the Green Mountain Drive-in Theaters. There was a theater in Morrisville and the largest in the state was in Newport. And we got half. The trade was Canadian trade. They would come down because they did not have any, any, Canada could not have 'em. It was state law, they could not for quite a while, they couldn't have drive-in theaters. So we had a sell out every night and that was a, that was a good payment, but of course we didn't make as much money in those days as they do today. I got $10,000 a year sitting on my butt and doing nothing. [laughs] JP: When did you meet Isabel? When and where did you meet your wife? MHS: I met her before I went into the Army. For 4, 4 or 5 years from '35 to '40, I taught high school in Barton in the Northeast Kingdom. And I taught, coached, I coached and taught for four or five years, I can't remember. 1935 to 1940, and then in '40 I went into the 1st Armored Division at [Fort] Knox. JP: But how did you meet her? Where did you meet her? MHS: Oh my wife? Well we were teaching, teaching school. JP: She was a teacher. MHS: Right. And Issy [Isabel] was home economics, home economics. She graduated from uh, I can't remember the name of the school now. I did know that it was in Massachusetts. She had her degree from a school in Massachusetts. I know where it is but it doesn't come to mind right now what it was. So that's where I met Issy. So Issy was a, we were both teaching school there and we both, we got married. We skipped out one New Year's Eve and got married, came back, didn't tell anybody about it because we weren't supposed to be married, I guess. And we weren't supposed to be I guess. I don't know how they could keep a teacher from, from they could take a Page 20 married teacher or a single teacher. But either way, we got married and didn't tell anybody. Then, then we got out in 1940 and went into the Army. JP: So she couldn't tell she was married because they didn't want women who were married to be teaching. That's why you didn't? Was that it? MHS: I don't know. I don't know. I could never could figure out why didn't want, why they didn't want it. Never could figure that out. But they didn't, anyway, for some reason or another. So then we went to, that's when we were stateside, I was, we were teaching in Barton. So we got married, dropped out of teaching, and I went into the 1st Armored Division at Fort Knox in 1940. JP: Yeah? FRIEND OF MHS: Did you talk about how we ended up at Norwich? JP: No. I'm curious as to how you got from post-World War I [interviewer said one meant two], to Korea and then to Norwich. How did you get to Norwich? And what did you do in Korea? I know those are big questions. MHS: I was in the, ah, I, I, I got out of the Army. Oh! I got out of the Army to buy the theaters, that's why I got out of the Army. Mother said, "If you want to come home, your father will sell you [the theaters]." I didn't want to do it but I did. I got out of the Army and went home and bought out my father's share of the drive in theaters. So I was sitting one day when I got the Norwich Bulletin. I don't know what it's called now. It's a bulletin. It said they are looking for somebody for the commandant's office. It said, "apply to Colonel Black." I said, "Bull, bull, bullshit," I said "I'll jump in my Cadillac and go down and let them see me. I can see them and they can see me." And I did, and I was told by Black that I was one of the, there was only one other, a year later, putting in for my same job and I got it. So I report in as, to Black. Black went up to Harmon and said, "We got a man here on our plea for an assistant commandant." And he said, "He's a Norwich man." And Harmon goes. "Well sign him up and give him three days to get in and get down here." So I was home, I had to clean up and move and everything. So I did and I came down here and reported in in 1940, 1940 1st Armored Division. FRIEND OF MHS: No you started at Norwich in 1950, didn't you? MHS: I started at Norwich… [trails off] FRIEND OF MHS: '56? '54? MHS: In 1940… FRIEND OF MHS: You were in for sixteen years. It would be '56. MHS: Oh yeah. Uh huh. Page 21 JP: You worked seventeen jobs at Norwich for eighteen years, right? MHS: Yeah, yes, yeah. I was— oh here is a funny thing, but it's not really very funny either. One day we had the—I was registrar. I was the first registrar in Norwich history. And Bob Guinn, I knew him, he was a professor when I was cadet. And he wrote the history of Norwich and he said that, "Smith was the first registrar in Norwich history." See before they had the registrar duties, but they partialed all them out amongst different faculty. So they get them all together for the first time and I was the first. And this is in the history. I was first full time registrar in Norwich history. And that was in 1940, yeah 1940, wasn't it? FRIEND OF MHS: It couldn't have been '40, that's when you went into the Army. Sixteen years after that would have been '56 MHS: This was 19… [trails off]… this was, uh, '56 yeah. '56. Yeah '55. '56 was the first year I came to Norwich. Yeah '55-'56 was my first year at Norwich. JP: So, you, you were working on a master's at Columbia before you— MHS: I was uh, yes. I started in and that was, that was a funny thing. I went to one section at Columbia and Columbia had a new deal. It used to be you go to 5 years or 4 years and a thesis. You go to 4 summer sessions and then write a thesis and that was it. Or 5 years without a thesis. Then they finally said, they cut it out and said, all right, you can go 4 years, you can get it in 4 years without a thesis. So I was working towards a Master's Degree at Columbia when I, when I ah. So I got to the next summer, I was waiting to see if I was going to get called into the Army, that was in '39. See if we were called into the Army, I said, I have to make up a decision because after the 4th of July if you go to Columbia, you don't get any credits. You have to be on or before the 4th of July for a full, for the full term. You can miss 2 or 3 days but that was all. And after the 4th of July you could go if you wanted to, but you wouldn't get credit for the Master's Degree. So, where was I now? JP: What was your major? What were you getting a master's degree in at Columbia? What were you studying? MHS: Probably education, I'd imagine. Education. I remember, I remember two of my professors—one was a woman, Doctor Spesicka at Columbia. The other was Doctor Hunt. The one that was the most popular one, he had a theater. We had small classes, 7 or 8 of in the class, but there was this one big class and he was the big, we had it in the theater, about 2 or 3 hundred were in his class. And I can't remember his name! But I remember Spesicka and Hunt. And Issy was there and I took her to class with her one time, when I was working for a master's degree. But it helped, because ah 4, 4 sessions, there used to be 5 and they cut it down to 4. So I was waiting, I said, "Gee I don't want to lose out all around," and I was biting my fingernails wondering whether to – what was it? To decide whether I was going to do something or go back to Columbia? Can't remember what it was. My choice was go to Columbia or Army I guess it Page 22 was. And I said, "I got to make up my mind before the 4 th of July," and it went by. And anyway I went to Columbia anyway, and I got a full year at Columbia. JP: You've had a lot of experience in education. A lot of life experiences with teaching people things and - MHS: The courses that you take in education was dull, dull and meaningless in education. They did not carry any weight, there was no substance to it, education courses. I mean they were stupid, they were dumb. And you had to take 18 hours, you were supposed to have 18 hours to get a, I guess a degree. And ah, I took 2 or 3 courses, and they were stupid! A waste of time! There was a misnomer calling them education courses. They prepared you, they didn't prepare you for anything but took them because they were required and so I went just that one time, and then I went into the Army. I was debating between, I didn't want to lose out on the second term for Columbia, I was biting my fingernails, and I said, "Well it's too late now I have to take what I get," and then my orders came through for active duty. So I played that right. I was lucky [chuckles]. JP: Do you want to take a break now or are you okay? MHS: Oh I'm okay. FRIEND OF MHS: I gotta go along, Moe. Your checks are all set there you have to sign them. MHS: Oh uh, oh the bills. Yeah, okay… come tomorrow, will ya? Okay, you are learning something about me. [chuckles] FRIEND OF MHS: You should tell her all the stories you have about the different generals you have worked for. MHS: Oh yeah, that's right. I have worked for, here is a funny thing. General Newgarden4 had the 10th Armored Division. I was in his division, well he came to the Armored School, and I was, I was something in the Armored School. I was a big, kinda a big wheel. Big wheel. I was a department head and he, everyone, they go to class and then they have to take a 10 minute break and then they go back to class for 50 minutes then 10 minute break. He was a tactics guy, tactics class. So I came up to see him, he didn't know me, I said, "General Newgarden." I said, "You probably don't remember me," (cause he had a division, he didn't know all the people). I said, "I was in your 10th Armored Division!" I said. "I was under your command at one time." So we had a nice chat. I remember his stars were—a pep they call it, a little round thing that clips to your collar, it was gone. And I said, "Gosh I should have fixed that but I didn't." I said, I should have said something, what I should have said was, '"General, your general thing is askew, you lost your pep." And I'd take my pep, "Here take my pep I got another one." That's what I should have done but I didn't do it. I was kind of scared so I let him go with his U.S. dangled Major 4 Major General Paul Woolever Newgarden (1892-1944) Page 23 General. And we talked but he didn't know who I was, so I told him, I said "I was in your division." A lot of officers in a division, you don't get to know them all. FRIEND OF MHS: So you did a lot of, you were in charge of Army training for a lot of , a lot of your career. MHS: Oh yeah, and in Hawaii that's all I did do. And I was the head of the school. FRIEND OF MHS: Who were those, the Spaniards that came, or Spanish speaking group that came? MHS: Oh, well we'd have tourists from all over the country. Colombia, for example, sent two or three different groups at different times. But the colleges all around would send their handpicked people to study our system of education, which was, ah, you could see it! It wasn't that you read something in a textbook and then recite it, but you could see it. It was all hands education. We would take an engine apart and put it together again. Assemble it right on the floor so we, we had engine cells and we would set up engine troubles, trouble shooting, and then the class would come in. We had a little, we had this big dynamometer, a big dynamometer engine in the middle and little cells around there. And we divided, about six officers or noncommissioned officers to a cell and there would be an instructor in there. And depending on whether, maintenance 1, maintenance 2, trouble shooting, so forth and they'd go through that and that'd be one week at each section. And I had the trouble, trouble shooting for over 1 week. So there's 6, 8, I think 8, different sections and then they'd graduate either 6 to 8, they'd graduate after about 2 months. I didn't do it exactly because I can't remember but about 2 months. They would have it on their records that they were graduates of the Tactics Department. The Armored School was the Tank Department, armored cars, tanks, wheeled vehicles, and motorcycles. There were five divisions of the Armored School. It took every, every week, 100, every third class was an officer class. We had an enlisted class, an enlisted class, an officer's class. Enlisted class, enlisted class, an officer's class. So there are 1,200 students at all times in the Armored School. 1,200. So 100 would graduate, 100 would come in. And every third company was an officer's company, so it'd be 300 at any one time, be 300 officers and 900 enlisted men in the Armored School. I had the Trouble Shooting Division. We would have these engine cells, we'd set up troubles on the tank, tank wouldn't start and so they'd figure out why it wouldn't start. And for motorcycles, wheeled vehicles, tank, and halftracks. FRIEND OF MHS: So what happened when the Colombians came to visit? MHS: Well that was, that was a good thing. They, ah, they spoke in English. They came through and they could with just what they could see. I found after, they didn't know what the hell was going on. They didn't! We spoke English and while they could see something, but the instructor - Maintenance 1 or Maintenance 2 or whatever it was - would talk in English and they told me, they [the Colombians] didn't know what was going on. And when they got down to the engine task, I knew that in Spanish, because I took Spanishm, I majored in Spanish in college. So I had Page 24 a corporal, god he was good, he was good. So I had no English-Spanish/Spanish-English dictionary so I had my speech in Spanish. So this, and I had been, I majored in it so I knew quite a few of it but I needed some help in polishing up. So I called this corporal in, he was, god he was a whiz-bang, I'll tell you. So I said, "What's the, what's the word for troubleshooting?" And he said, "There is no word for troubleshooting. It's busca fias look for troubles, that's trouble shooting." And so he helped me with my speech and I memorized it, because I majored in it so I knew quite a bit of it and he filled in the gaps for me cause I had no dictionary. So when the, when the Colombians, when the Brazilians - particularly Eurico Dutra, Chief of Staff of the Brazilian Army - came around, they didn't, they told me, they didn't know what was going on. We just spoke in English. Well when they got up to my place, I delivered it in Spanish they went for their notebooks and started writing like mad. Of the 16 stations, mine was the only one that meant anything to them because they didn't know. My people didn't know Spanish and they'd deliver it in Spanish [means English] but it went over their heads so when I started my speech in Spanish, boy they whipped out their notebooks. I tell you they were writing furiously so it wasn't a complete failure [laughs]. It made me feel pretty good. JP: Thank you. MHS: Any other questions? [laughs] FRIEND OF MHS: Oh. Mike Popowski downtown, his father, what was his association with you? MHS: We were at Norwich together. [At] Norwich noncommissioned officers lived with noncommissioned officers, commissioned officers lived with commissioned officers, privates lived with privates. FRIEND OF MHS: So how did you know Popowski or Pop? What was his nickname? MHS: Well as a sophomore, at commencement the end of my freshman year, my name wasn't on, I was a private. Well I had been there just a week and I was called into the commandant's office the very first week of school and was promoted to, made a corporal. So I was already living with privates. Popowski was a private. There was four of us: Sullivan (an Irish man), Uthenwoldt (a German), and me (English), and Polish, Popowski. We were in Jackman Hall, A Troop, A Troop. We were troops then, now they are, later became companies. It was A Troop and uh… [trails off]5 FRIEND OF MHS: Now did you stay with Popowski all through your school? MHS: So I was a private up until the very first week of school. I wasn't promoted at commencement. So I had my roommates, so when I was promoted to corporal I think I was the only one rooming with privates. All the others were noncommissioned officers with 5 Michael Popowski, George Patrick Sullivan, both Class of 1934 and Fred William Uthenwoldt, jr., Class of 1935. Page 25 noncommissioned officers. And they would keep the privates with their group so they didn't break it up. So I stayed where I was, but I was a corporal. I guess I was the only corporal, noncommissioned officer, who was in with privates, and Popowski was a private. FRIEND OF MHS: So but did you stay with him when you became a junior or a senior? MHS: No, just my sophomore year. And then my junior year it was just two of us. Sullivan, Sullivan I guess it was. I roomed with him from New Hampshire, Berlin, New Hampshire, was my roommate from, to junior and senior year at Norwich. Troops. I can't remember if we were troops. I think they went from, I think my sophomore year they went from troops to companies. They used to be troops for cavalry, cavalry troops. Same number pretty much, and makeup, but they would call them troops. So the band leader, I would take reports, I would be the officer of the day, and I would say, "Report to reveille." And they'd say "A Company present and accounted for. B Company present and accounted for. C Company." And you would say, "Dismiss your troops," if you were the officer of the day. And they would dismiss their troops. Well the band leader, I can't remember his name now, he wanted to call them troops and they were companies. They went from troops to companies. Well he wanted, the Band Company, he wanted to call 'em troops. So when I go out to take a report I say, "Report!" for if you are on duty, if you are the officer on duty for the whole regiment. And then "A Company present and accounted for. B Company present and accounted for," so on and "Band Company present" and, uh so this guy I can't remember his name now said, called it troop, said "A Troop present and accounted for." Well I could have called him on it and say, "Hey look, we are companies now. You will report as a company not a troop." But said, "My god if he wants to call them a troop, I'm gonna let him call it a troop." So he was the only one in the regiment that called his Band Company a troop. Everybody else was a company, and I let it go. I said, "Hell, I don't give a damn if he wants to call his band a troop, I'll let him." Any other questions? FRIEND OF MHS: I can't think of any right off there, chief! MHS: Well, we'll… FRIEND OF MHS: We'll catch up tomorrow. JP: Thank you very much. FRIEND OF MHS: I'm Dick Brockway JP: Brockway, that's right, we met before. I've got a, I can leave a card if you want, I gave Moe a card. Thank you. MHS: You know that, that helped me, that Colombia deal, it was on my, on my record so I got some wonderful assignments. I was, I was on the Armored, I was an obscure major, and I do not know how many majors there were in the Far East Command. I mean hundreds of them, and in three days they picked me out to be on the General Staff. And I said, "By god, I said God is with Page 26 me, God made that appointment." I mean all these majors, and I was an unknown major and they put me on the General Staff. I never could figure that out. [Moe's friend says goodbye] JP: So let's see, you were in, third overseas assignment was the Japan Logistical Command after the war. You were on the Commander General's Staff and you wrote reports that went up to General MacArthur's Headquarters in Tokyo and then to Washington. MHS: It went through channels, through channels. JP: Through channels. So you worked… MHS: In the final, in the Far East Command, MacArthur, MacArthur's headquarters, he was in, so it went to MacArthur's headquarters because he was the Far East Command. He was command of all, all the post caps and stations in the area, Far East Command. MacArthur, and then to MacArthur, my report went to MacArthur's headquarters, Tokyo, and he sent them on to Washington and what they did with them I don't know. JP: So then you went to Chicago? You were in Chicago during Korea. MHS: Chicago was my last duty station. JP: Last duty station. MHS: I was in Chicago. Oh, Headquarters, Fifth Army. I got it in my hat. Headquarters, Fifth Army, and I lived uptown from Chicago. I wasn't down in the loop, I lived a few blocks north, but it was still Army Headquarters. So I was in Fifth Army Headquarters in Chicago. JP: And what did you do there? MHS: I was a, I was a - Command Reports, I managed Command Reports. In other words, feeder reports came into me and I'd give it to my Division Commander whose business it was to write a report. So he wrote up the reports for me. Ah. Month, weekly or monthly reports, I can't remember which, I can't remember if they were weekly or monthly. So they would come across my desk. He would, he was the head of the—I had 4 divisions, 3 or 4 divisions in my company. And his division was to write up what went on in the Fifth Army Area. So they came to me, and I'd read 'em and there was one time that I changed something. I took out a paragraph that didn't belong, I took it out. So they came to me, I signed it as if it were my report, and sent it on to the next echelon of maintenance. And he would read it, and then he would sign it, that means it was his report then, and then it would go on to GHQ, to General MacArthur. And somebody in Special Services, I was in Special Services, in Special Services in the Far East Command would sign it, and then it is his report! Then it went on to Washington. JP: So what was it like when you worked under Harmon at Norwich? Page 27 MHS: I was, it was pretty good. It started out pretty rough, I guess I told you that something was happened. JP: Yes you got in the elevator and it was slow but Colonel Black… MHS: It was good, it was good under Harmon. We went to the uh, we had something at White River Junction, Dartmouth, and uh, at White River Junction, Dartmouth. And I had a big Cadillac and Harmon, I had a carful in my Cadillac there, and I drove with the wives. We drove to White River somewhere, we drove to some headquarters. And uh, [pause] and we met, we had a meeting, a big meeting somewhere. I don't know if it was White River or if it was Dartmouth, could've been Dartmouth. We had a meeting and Harmon rode in. I had Harmon, Mrs. Harmon and the director of admissions and his wife. And I had Issy. Six of us and we went to this, this meeting for the Area Command or something. I can't remember what it was. And Harmon, he was, he could swear quite a bit and he was a, so he made a speech using pretty rough language. Well the Norwich wives knew he spoke that way, and they expected him to speak that way, but the people outside our command didn't, youknow They had their wives there, they were civilian college wives or something like that. And so Harmon said something using his salty language and they sucked in their breath, you know. He could be pretty salty. And Harmon, so on the way back Harmon knew he made a mistake, "Oh god," he said, "I could cut off my tongue for saying what I said." I said, "Well gee General Harmon," I said. "People know you, they expect you to talk that way. If you didn't, you wouldn't be General Harmon. They'd be disappointed." He said, "Yes, they weren't Norwich wives. They weren't all Norwich wives, means there are some Dartmouth wives in there and they're the ones who sucked in their breath at his language." And I had no reply to that, he was right! JP: So you heard quite a bit of salty language. MHS: Huh? JP: So you heard quite a bit of salty language [louder]. MHS: Oh, oh yes. He was a…I remember one time, we were right here, I think I may have told you already. Women were sitting in here, Mrs. Harmon was sitting right here, and maybe not in this chair but in this place. The men were out around here, was it the Norwich community? I guess it was, yeah, high ranking people, Norwich department heads. And so I looked at him and Leona was sitting here, and Harmon you could hear him, god he had a booming voice. And he said, I guess I told you, "I've thrown my leg over many a French lad!" And I said, "My gosh you can hear him!" How you could hear outside and over here, he had a booming voice. Leona sat there and didn't, she knew Harmon, she didn't flick an eyelash. And he didn't care if she did hear, and he was true. He was quite a, as you call it, cocksman? [laughs] JP: I guess when you live in the military and you work with people closely you get to know their personalities. You get to know their good sides and their bads. What is it about Norwich, you Page 28 seem to really love Norwich and the training and the education that you've got. What is it about Norwich, you think, that makes people so loyal and so attached to it? MHS: Well it's the esprit de corps. It's the spirit of the corps. It's the, it's a, now in my day only, I think 2 graduates were accepted into the Regular Army. The rest including me were reserve officers but two, every year, they would take two for the Regular Army commissions. And then I think they dropped that rule. I don't know when they did go about the Regular Army. Oh I know, the reserve officers, I think it was at [Fort] Knox, they had, we were a lot of reserve officers. So they had a special course, and it turned out not to be much, it was a week of special training for the small group that wanted to go into the Regular Army. So a few reserve officers went. I didn't, I wish I had. But it was a short course, it wasn't demanding at all. It was a piece of cake really, and those people who went to that get a Regular Army commission. I was in the whole time on a reserve Army commission. I could just as well done that, and I thought, I said it was gonna involve a lot of work and isn't probably worth it. What I thought, what I heard, it wasn't hard at all, it was a piece of cake really for that week there was nothing to it. You'd get your Regular Army commission. So I went through all those years as a reserve commission. But, got the same pay. Get promotions just the same as everybody else. JP: And you have lived across from Norwich after you retired. So you've been close to Norwich for, gosh… MHS: I was at Norwich for I think 16 years. JP: I think 18, 16 or 18. MHS: I will tell you one thing really gripping. I was registrar. It is recognized that the registrar's duties were fanned out, or under - when I came in it was all coordinated. I was the first registrar as such, full time registrar in Norwich history. Guinn who writes the history told me that. And now where were we? What did you say? JP: Oh, you said you were going to say something gripping about being a registrar. I said you had lived here a long time. MHS: I was the, I was the first registrar in Norwich history. And, well, Dean Perry, and I loved him. Registrar comes under the Dean, he was the Dean and Registrar is under the Dean.6 So the Dean was my boss. So he came in one day. I had the best office in Dewey Hall with a fireplace on it. It was for the Dean but the Dean didn't want it, he wanted to be off the beaten path 'cause he didn't want to be where people were going by his office. He wanted the privacy, so he took the office way down at the end of the hall and I had the spacious office as Registrar, fireplace and everything! Now where was I? 6Col. Lewis Ebenezer Perry, (1899-1963) died on June 7, 1963 on a Friday, at the Cadet Corps Commencement Parade on Sabine Field. Page 29 JP: A gripping story about being registrar. MHS: The Dean came into my office one day and I liked Dean Perry, I guess I loved him really. He was a wonderful, man wonderful man. [Takes sip of water] And he said, "Let's get down to the," he said, "C'mon," I guess I was a colonel, "Colonel," I might have been a lieutenant colonel. "C'mon and we'll go and go down for the alumni parade." I looked at my watch, and I was pretty busy there. And he said, "I know it's early," he said, "but I thought we'd take our time." I said "okay," it made sense to me. So we started out, he started to take his car. I thought, "What the hell is he taking his car for? Jeesh all we have to do is, Jackman Hall is just down the steps and you are there." But, I thought, "Well, we're early, that's why we are taking it." I said to myself, I was talking to myself. "Oh we're early that's why we are." And so we'd go down and take a step, and stop. Take another step, and stop. And we would talk. And what's he going so damn slowly floor. Then again I said, "Well we're early of course." Now there was a reason for us doing that. He didn't feel good, Well, I didn't know that. So two or three different things I didn't question, I said "Oh, well were early we don't have to hurry about anything." So we got down there and I thought, "I'm gonna have some fun today." The Academic Board is the all-powerful board. The Academic Board is the big thing, academic board, department heads mostly make up the Academic Board. So I said, "I'm gonna have some fun with these guys," 'cause I was a colonel, I was a full colonel and they were lieutenant colonels, the department heads were lieutenant colonels. Now they're colonels, but at that time they were lieutenant colonels and I was a colonel. So I said, "I'm gonna have some fun with these guys." So we had to, we were out on Sabine Field, standing back where the tank is, milling around. So we had to march on to the field and they had a seat for us right in the middle of Sa-Sabine Field, seats. So I was to march them down on. I was the Registrar, so I said, "I'm gonna have some fun with these guys." I said, "I'll treat them like recruits." I said, "Alright Academic Board," I said there to the all-powerful board and department heads. I said alright "Academic Board, fall in!" Like they were a bunch of Rookies. I said, "Fall in!" And they fell in, they fell in, they knew what I meant. So we marched in and "I said, 1, 2, 3, 4, 1, 2, 3, 4," but I didn't shout like "1! 2! 3!" Just timed it, 1, 2, 3, 4, so we would be on step but the rest of them aren't supposed to hear necessarily. So we marched on the field, I halted them, and I said, "Fall out" and they fell out and went to the seats. Well, we were, I looked out at the men and the wives were there in the, in the, in the seats, you know out in the stadium, you know, and I looked around and they were laughing. I said "Boy, the girls are having a wonderful time." The wives of the department heads and everything, they were laughing and having a nice afternoon, they were laughing and everything. Well this cadet came up, he got some award, a corporal, he got some award. And it was the awards parade and they had some special academic awards or whatever awards they were. The Dean was pinning them on, Dean Perry, he went out with me, I took him down. I mean I walked down with him. And so he was a, this corporal I guess came up and he was pinning an award on him at the awards parade. And he turned as if to go back, as if he is going to go up into the stands then he Page 30 whirled around again to get back to where he was and he went down in a heap. And I said "Oh God," and I was looking, before that happened I looked and said, "What's that on the back of the dean's neck." It looked like an hourglass of red. I said, "What the hell is that on the Dean's neck?" I said, well, I don't know. So Lillian, his wife, came down crying cause he, I guess he had a little heart trouble but he tried to do, skate, ice skate and everything to stay in shape and to exercise his heart, you know. I didn't realize that till later on. So she came down crying, after they had been sitting there laughing and having a wonderful time. And all of the sudden [snaps] the switch turned and now she was crying. We didn't know it, but he dropped dead, dead on the parade ground. So they got the ambulance, loaded him into the ambulance and took him down here I guess. And ah, so when they went on with the awards parade, finished the parade, I couldn't tell you what happened, I don't think anybody. To hell with this parade, they just took our minds off worrying about the Dean. So when the Public Relations Officer, I didn't know his name, came to the gate we all rushed over to see how the Dean was and he said, "Well he is dead." Oh my God, what a shock. I tell you that, that, that whole summer we went up to Maine, to Popham Beach, and I didn't have any fun at all, really, I couldn't get him off my mind. Oh God, it was terrible. I had a terrible summer. And I remember this time, I went first day registering for classes and everything and I went there, and all of a sudden I got involved, I was in the midst of organizing something, my position there had me organize. And I swear the Lord put his hand on me and said, "Son, forget it." That's how I figured it out, just like turning on the switch I went from a miserable summer thinking about the Dean, I couldn't get him off my mind, and I went there and still felt bad and then bingo, I rolled up my sleeves and went to work. The weight just dropped right off and I said, "My God, the Lord just answered my prayer, I'm healed, I am ready to go to work." It was that fast. And that is when I began to believe in God. And that's how that went. JP: What was the hourglass on his neck? You said there was an hourglass on his neck. MHS: Well I don't know what it was. It was—showed up from the stands. It was red like an hourglass and I said, "I don't know if anybody else noticed it, probably did." I noticed it when I was sitting back there with the Academic Board. And you see, I was on the Academic Board as Registrar, without a vote. Well I didn't give a goddamn whether I voted or not, but I was on the Academic Board without vote, because of my position as Registrar. And so I sat there and looking for anything in particular and I did see that on his neck, and it was bright red, like an hourglass, spider. What's that spider that has an hourglass and is poisonous? JP: Oh, it's a black widow. MHS: Yeah, looked like a black widow spider and I didn't think anything of it, but it showed up and I was kind of, I sat in back and uh, I could see that. Then I poo-pooed the idea, I said, "Oh that's, that's nothing." But then he dropped, of course we didn't know whether he fainted or what it was, he dropped dead, and that whole summer I was, spoiled my summer, spoiled my whole summer. Page 31 JP: Was it a spider on his neck? MHS: I don't know what that was. I don't know what it was. Bright red. And I said "What is that on his neck?" I wasn't going to ask that. Then he dropped, and course we didn't know he died, we thought he could have just fainted, you know, but he dropped dead. And when the Public Relations Officer came through after the parade, I couldn't tell you what went on the parade, I don't think anybody else did either, paid attention to the parade. But they had the awards parade, and then I remember everybody rushed to the gate because the Public Relations man went up the ambulance that picked up the Dean. He came back and we knew he'd have the story on the Dean. So we all rushed to him to see how the dean was, and he said, "He is dead." JP: Oh my goodness. MHS: And let's see. And I remember so plainly. I of course spoiled my summer. That first day I, so I rolled up my sleeves and went to work and it was, I said, "It left me. It stayed with me all summer and bang!" so I turned on a light switch, and I said, "I'm done, I'm through with it, it's done, it's over with it. And I won't grieve no more. I won't grieve anymore." And I didn't and I marveled at what happened because I was—had such a miserable summer and I guess it was just to work, but like turning on a light switch. I went feeling miserable to I said, "I'm healed now, God made that, made that for me," that's what I said [chuckles]. JP: That's nice, that's nice, is there anything else you want to add about Norwich or your service? MHS: I really can't think of, it was important that I almost quit before I started [chuckles]. And Black, Black was—the Corps played tricks on Black7because Black was deaf. He had a hearing thing. He was pretty deaf. He had this hearing thing, he was always twisting it in his ear, everyone knew he was deaf. So they played a trick on him. One time the band was down at the end of the parade so they decided that they wouldn't play it, take their instruments and make believe they were playing and he wouldn't know the difference. So he walks out of here the band appeared to be playing and they weren't and he figured it was his hearing piece and cadets will do those things, you know, when a weakness, they're good at springing in there. [chuckles] They're clever that way JP: They are resourceful. Did you, when you rode horse, at Norwich, in the cavalry training, did you ride Roman style? Did you stand? Did you guys do that thing where you stand on the two horses? MHS: No, they had, no we didn't do that trick riding. We had, it was scheduled like a class, but, or the classes was every other day, meets 3 times a week, this equitation, everybody had to, was 7 LTC John W. Black, USA (ret) Commandant from 1953-1957 Page 32 a class, you got credit for it or met once a week, and that was in the, I guess the riding hall is still down there. Or the stables are there, I guess, not the riding hall is gone, and what you say now? JP: Did you get thrown at all? Or did everyone get thrown? MHS: Oh [clears throat] No. Once we were, we had a night ride and my horse we ended up in a ditch and it just wide enough for a horse and I was—I straddled the horse and I could get out, my feet were pinned in the trench, you know. It was a deep, deep trench, and it was dug, it was a trench I don't know what the purpose of it was. And I kept my feet out because it was wet in there and I got out but my horse couldn't get out. And they got, I don't know how, they got out, I've gone, but they had probably had to dig to get a pathway out, he was wedged right in there and all you could see was his head, [chuckles] head and his rump, with little bit of his rump. And just room enough so he filled that trench right up, you see? So I didn't see what they went through to get him out, of course they finally got the horse out. Now what did you say? JP: Did you get thrown? But it sounds like everybody… MHS: One time I did. I didn't get thrown, but we were galloping toward the, toward the stables and it was a free-for-all and we were going wide open. Well I was riding a horse named Ham, H-A-M, he slipped and he fell, and it landed probably by—my feet were in my stirrups but landed on my leg, but it didn't hurt me. It was a body, you know, soft, just soft and it didn't hurt me at all, didn't even make me lame, it didn't hurt me at all. And I don't know how it did get to stab- going into the stables. And well I was dismounted, because the horse stumbled and fell, so I went with the horse. That was the only time I ever fell off. JP: But the horse fell, yeah, wow. [pauses] You've done a lot of interesting things from flame throwing to… MHS: Probably, you know if you talk long enough, one things leads to another, and you, maybe one or two of them, most important things I probably haven't even mentioned yet, but I, like anybody else, like you or anybody else, you have certain experiences. And if you go off to visit and you come home, your parents want to know what you did, or somebody wants to know what you did and you try to recollect what you did. Things that impressed you. And I said so many things can happen in the situation I was in. I can, one thing can lead to another, probably two or three funny things that happen that I can't remember right now. The art, I went to theater in Morrisville, we called it Bijou Theater and they'd, before the main figure, they needed a comedy, short comedy. One reel, a comedy or a news. So this time I was sitting in the theater the Pathè News came on. It was a Norwich scene, and I said, and I said, I was so surprised, I remember the scene, I said, "I was there!" I don't know if anybody heard me in the theater. And here I was in the theater and here was a scene "I was there! I was there, "I said, "My God, I was there!" It was Pathè News and it was a big news company, worldwide, Pathè News, and somebody like Pathè, P-A-T-H-E, and everybody knew what Pathè News was. And they'd have either that or a comedy. [inaudible] I don't think anybody heard me when I said, "I was there," but I was. Page 33 JP: Where was, what was Pathè News covering? Was it overseas? MHS: It was, it was, they showed the events of Norwich, showed them coming down a steep hill, very steep hill and they're, horses were fighting, you know, as they went. Horses are well-trained, and I guess they have they trust the rider, he knows what he's doing, and they do, they have to trust the rider, so they knew didn't throw anybody, they knew they had to get down, and they were scooting, sliding, they couldn't walk or down or they had to slide down, down they went, dutifully down the steep hill. And Pathè News, which was a big news in those days, it was the big news and they recorded that scene, so that's why I said, "I was there." [chuckles] I was surprised, small world. Well as you try to recollect things, one thing leads, leads to another. If you ask me something, I go off on a tangent and probably have some remarks, yeah [chuckles]. JP: So you worked at Norwich and then you then retired, what did you do after you retired from Norwich? MHS: Let's see now. I retired, oh, I was in, oh I retired from Norwich… JP: In '70….? MHS: Oh I was Norwich for, oh I retired from Norwich, oh I guess went to, let's see. I retired from Norwich, where was I? Where was I living? I was in Chicago when I came home, I was in Chicago and [pauses] oh well I guess I retired. I just retired. Yeah I just retired. JP: So you retired here? MHS: Yeah, I had several incomes. I had 5 incomes, I can't remember all of them—TIA-CREF, a pension, Norwich salary, working at Norwich. And I remember I had 5 incomes. I had a rental income, so I had 5 incomes. So I had a good income, and when I— JP: Did you travel with Issy? Did you and Issy travel to the places? MHS: Well I, when in the Army, yes. Issy went with me. Took about 5 months for a dependent wife down in Japan. A dependent could not go to Japan. They could go to Europe, because that was all settled, but in Japan that came later on. So the wife, so after the war was over in Japan, it took about 5 months to get your dependent wife over. So I was in Japan and Issy joined me in Japan. Well she had a, it was a Washburn, it was teaching school, teaching American schools, just teaching Americans in schools in Japan. No Japanese, American dependents, children. And Issy, they were waiting, Washburn, her husband, she worked in the school system and she knew Issy was a teacher so they desperately need teachers. So I [she] said, "Has Issy got here yet, when's she coming and everything?" So Issy got there 11:00 in the morning and 1:00 she was teaching school, American children [chuckles] and so what we did, we lived—Issy she had a GS-7, that's a federal rating, you know the ratings? And she was a GS-7, which is officer, I mean, so Issy on her own, if she wasn't married to me, well that job she could go to an officer's club. IfPage 34 she was GS-5, she couldn't, but with a GS-7 she could go on her title to an officer's club. So now what were? JP: Issy traveling and teaching in Japan MHS: Yeah. She taught a—I think a graded school, then she had a special class of Japanese. And I didn't think Japanese were very goodly people but by golly, Issy, well she was at the wheel, she had this meeting and she passed out certificates. They passed a certain field in education, she trained them—she was the head of the school system, of that particular school system. And so Issy ran that show and I'm pretty proud of her and by gosh and I sat there and they'd come get their diplomas and oh they were so pleased those Japanese to get their diploma, and I look at them and for the first time I saw a beautiful Japanese girl. Most of them aren't very pretty, but by golly they were that day, I said, "By God, what a beautiful, beautiful girl, they came by me." The Japanese you have to get used to them, they have kind of a flat look like somebody slammed the door on their face or something there they, I couldn't see a pretty one there, but after I'd been there awhile there were some pretty Japanese girls. We had a maid, we were allowed two but we only wanted one. We had a male, he was a handsome Japanese man, young man, but he was a really handsome guy. He wasn't dependable so we let him go, he didn't show up when he felt like it. So we fired him. All we wanted was one anyway, and our quarters was just where we wanted it [phone goes off]. Our quarters were on a block. You could look down south of the yard and see all the shipping in the port. Oh it was a beautiful thing, we were up high and we'd look down and we were, my office was right down at the customs, customs building port of entry in Japan. And we'd, we'd, many a time there would be a cloud, you couldn't see anything, and you'd drive about a quarter or half mile, quarter or half mile, you'd be riding that cloud, when you're in it, you couldn't see much, but it was like a heavy fog. Then you'd come out of it, come out of it there's the blows all laid out for it. It was the headquarters, it was the port of entry for Japan, for commercial shipping, commercial shipping. And I had an office down there. JP: You liked Japan? MHS: I was up on the bluff. Oh I had a real, it was quarters and 388. "Oh I want those quarters." Well what they do, they post them as they come available. I knew 388 had, of all of quarters up on the bluff, way up, looking down, I said, "That is the one I want." Well they'd post - be 5 or 6 housing be available - and when your name got to the top, you got a choice, you take second place, second choice of those say ten or dozen available. And if you didn't take it, you're holding up someone, then your name went down to the bottom of the list. So you, so you couldn't get top and stay in the top. If you didn't take something, holding up for something better, you went down the bottom. So they said you couldn't do that. So I, my number didn't come up and wasn't my time to choose yet and I said, "Oh geez I hope that number doesn't come up too soon." And so my number came up, a group of people for housing, you like to stay there, at such time that you can get housing for you, you had to be there a little while before you got housing, say 10 days or something like that to get housing and that's it, oh man I said, 'Oh God, I Page 35 hope that 388 is there, if isn't I'm screwed, 'cause that's the one I wanted,' and it hadn't been on the list at all, my name was on it, that's where my lame name come up, then you got to choose, and if you don't, then you get down the bottom of the list, so you got to choose, and 'Bam' me, 388, and 'Bam,' just I wanted so I was high on the bluff and I could look down at the shipping and the port, it was way up high on the bluff, oh God it was nice. JP: What port was it, what was the name of the port, do you remember? MHS: The port? JP: Yeah, what town was it? MHS: I think it was the main port of entry, had a big huge beautiful brick building. JP: Was it Tokyo? MHS: Yeah, no, no Yokohama, Tokyo was about 17 miles I think it didn't take long because it had a beautiful, I think, 2 way highway between Yokohama and Tokyo. So you can get to Yokohama, you can be in Yokohama, and you can be in Tokyo in 20 minutes, you couldn't drive very fast. It had this beautiful road but the—I think you're limited 25 miles an hour, and I got stopped once I thought I was staying, and the GI, GI's they wrote me up I guess for speeding, I think I was going probably 26 miles an hour, something like that, and I got a ticket from a GI but he was authorized to do it, he was an MP. JP: What did you drive, what kind of car were you driving? MHS: I had a, I had Buicks, I had a new Buick, I bought a new Buick and two weeks after I bought it, I got my call to report to, I was in New England, in Vermont, to get, Seattle I think it was, a certain time no San Francisco, be in San Francisco. Then when I got in San Francisco, then Roosevelt directed me to Seattle, I got to San Francisco, then for two or three days, then they sent me to Seattle, so I shipped out of, originally it said San Francisco, but they sent me to San Francisco, I waited then they sent me to Seattle and I shipped out of Seattle for Japan, does that answer your question? JP: That's good, so you liked Japan? MHS: Yeah, so my—your car follows you by about 2 weeks so they ship your car but you have to wait about 2 weeks, before your car catches up with you. So I did, so I had a new Buick and I traded every year for a new Buick with the Japanese people, they're nice people and what I did was I'd buy a new Buick after a year I turned it in and they'd give me another new Buick. No deprecation or anything, so I got 3 brand new Buicks at no cost, and when I got home, I sold it for what I paid for it, you couldn't raise the price on a new car. That was a Japanese law, you couldn't raise a price on a new car, you could on a used car. So what they would do is buy a new car, and if you didn't want put it up on the market, then they'd probably double the money, you Page 36 couldn't sell a new car beyond the market price. Well I wanted a, they had 4 Cadillacs, well I guess I was—I was outranked or something another, I didn't get the Cadillac anyways, they only had 4. So I said to the Japanese, I said, 'Don't you now wished now you sold me the Cadillac, because I said I would sold it back to you?' that's what I did with my new Buick. I said I sold it back to you, double your money, and said, 'Yes we could have.' That was—I was too late. [chuckles] Background voice: I'm sorry to interrupt, we're about to leave, and we're about to pull out of the garage. JP: Oh, sure, well, do you have anything else you want to add Moe? MHS: Not unless, you have any questions. JP: I just want to thank you, truly for giving me the time and all this wonderful information. MHS: I like to rehash old times and I have to stop to think, to, you forget these things, but I was, I remember I felt like, I said, 'God's with me and I was an unknown major, and I had been there 3 days, and I was named the General Staff and I said, 'Uh huh,' I said, 'there must be hundreds of majors that would give their ITs to be on the General Staff,' and I was a new major, and somebody God, somebody lead me to them or me, and after 3 days I got a job on the General Staff, and I thank God for that, I said, 'God had a hand in that.' [chuckles] JP: That's certainly true, well you must have been good, [both interrupt] MHS: Oh well, I don't know…