Suchergebnisse

Issue 52.2 of the Review for Religious, March/April 1993. ; re lig oIJS C~stian Heritages and: Contemporary Living MARCH-APRIL 1993 . VOLUME 52' ¯ NUMBER 2 Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone:314-535-3048 ¯ FAX: 314-535-0601 Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ 5001 Eastern Avenue ¯ P.O. Box 29260 ~.Vashington, D.C. 20017. POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Second-class postage paid at St. Louis, Missouri, and additional mailing offices. SUBSCRIPTION RATES Single copy $5 includes surface mailing costs. One-year subscription $ l 5 plus mailing costs. Two-year subscription $28 plus mailing costs. See inside back cover for more subscription information and mailing costs. 01993 Review for Religious for religious Editor Associate Editors Canonical Counsel Editor Assistant Editors Advisory Board David L. Fleming SJ Philip C. Fischer SJ Michael G. Harter SJ Elizabeth McDonough OP Jean Read Mary Ann Foppe Joann Wolski Corm PhD Mary Margaret Johanning SSND Iris Ann Ledden SSND Edmundo Rodriguez SJ Se~in Sammon FMS Wendy Wright PhD Suzanne Zuercher OSB Christian Heritages and Contemporary Living MARCH-APRIL 1993 " VOLUME 52 ¯ NUMBER 2 contents 166 feature Leadership, Authority, and Religious Government Mary Linscott SNDdeN clarifies the interrelati6nship of leader-ship, authority, and religious government in the development of religious life up to the present. 194 202 213 220 226 evangelizing The Meaning of Evangelization Today Janice McLaughlin MM suggests that in the light of her experi-ence in Africa evangelization involves us in a process of change and choices which turn us upside down. Broken African Pots and a Mission Spirituality Mario I. Aguilar SVD proposes that African pottery making pro-vides a model that fits our need for spiritual fulfillment and the j3resence of God in our lives. aging in christ A Spirituality of Aging Michael D. Moga SJ invites the elderly to explore a spirituality well suited for their final years. Soul Making and Life's Second Half Anne Brennan CSJ and Janice Brewi CSJ encourage people in mid-life and beyond to open themselves to the fullness of their inner lives. Life Review, Families, and Older Religious James J. Magee DSW offers a model of life review for older reli-gious to modify their own anxiety in the face of family issues and to help other family members also to work with the issues. 162 Review for Religious 236 238 241 living religiously Hope in Loneliness James Martin SJ searches the emptiness of loneliness and finds space for God and others. Thoughts from Death and Life Vera Gallagher RGS offers a personal reflection on dealing with a serious diagnosis of illness. May I Love You, Lord John Patrick Donnelly SJ provides the first English translation of a psalm-prayer composed by the fifteenth-century Dominican Girolamo Savonarola. 247 259 275 283 visioning religious life Galile£n Perspectives on Religious Life Anne Hennessy CSJ suggests that the sometimes blurred focus on the person and message of Jesus Christ can be helped by a Galilean perspective. Religious Life in Nigeria Today Mary Gerard Nwagwu gives a summary picture of the various forms and influences of consecrated life now common in Nigeria and their influence on society. I Have Kept Faith: Clare of Assisi Karen Karper PCPA highlights some incidents in Clare's spiritual growth and the approval of her religious rule of life. report U.S. Hispanic Catholics: Trends and Works 1992 Kenneth Davis OFM Cony reviews the various events and writings in the Catholic Hispanic experience. departments 164 Prisms 304 Canonical Counsel: Common Life 311 Book Reviews March-April 1993 163 prisms a~tican Council II is frequently described as a watershed event in the history of the Catholic Church. Certainly through our eyes now and even in its actual hap-pening the council was one of those precious creative moments which take place randomly, but consistently, in our human affairs. Just as consistently, creative moments are followed by a period of consolidation. A common example (perhaps too easily caricatured) from the history of religious life is the creative action of St. Francis of Assisi in calling forth his gospel-based mendicant group and the later consolidation efforts of Brother Elias to establish solidly this ideal in a lasting community form. Some would term the present period in the Roman Catholic milieu a period of consolidation. As evidence they would point to the promulgation of the Codes of Canon Law for both the Latin Church (replacing the first Code of 1917) and the Eastern Churches (the first for-mulation of a Code). The publication of the new Universal Catechism is another piece of evidence for a consolida-tion movement. With the 1994 Synod of Bishops sched-uled to consider consecrated life, there appears to be a completing of the review of all the groupings which make up the People of God. Consolidation periods lack the euphoria and excite-ment of the creative moments, but they are just as impor-tant if life is to keep its direction and to flourish. We may have a fear of consolidation movements because they seem to represent a rigidity and to forebode an age-long immutability. Others of us may too readily desire consol-idation as a way of returning to the way things were, of rejecting a certain period of time as an aberration. 164 Review for Religio~s Consolidation, after a period of creativity, is meant neither to set in stone the present reality nor to throw aside recent history and return to a fixated tradition. Consolidation is meant much more to be a plateau where gains and losses are assessed, directional lines reviewed and discerned anew, and energies replenished for the continued journey forward of this pilgrim people. Although we have frequently used the word transition to cap-ture these times for our church and for religious life, perhaps more pointedly we might now use the word consolidation. For example, the FORUS study published in our last issue provides religious life with a consolidation document. Religious groups would be using it without serious thought or reflection if they were to reject the legitimate and church-expected experiments of these past decades. Consolidation works only when there have been some creative moments preceding. Without creative moments, life--any life, religious or other--weakens and faces death. That continues to happen to lifeforms throughout our planet and, more pointedly, may be happening to some religious congregations at this time. On the other hand, without consoli-dation creative moments are only ephemeral and their energies dissipate to exhaustion. Consolidation is necessary for true growth and sure direction in continuing the movement so that we can focus our energies for the New Evangelization of our time. Consolidation remains just as necessary on the micro as on the macro stage, that is, in our everyday life as well as in the large-scale reflections which we have been making about religious con-gregations. Too often we can pass by the efforts necessary for a consolidation review in our own individual-lives and our living together. Why do we live the way we do, why do we do the works we do? How is this related to my and our love of Jesus Christ and what does it have to say about the evangelizing quality of my and our works? These simple questions are necessary as we look towards the solid future of religious life. David L. Fl.eming SJ Marcb-Atrril 1993 165 MARY LINSCOTT Leadership, Authority, and Religious Government feature More than twenty years ago, in 1969 and 1970, I attended two meetings in St. Louis which were a turning point in the history of the Conference of Major Superiors of Women in the United States. Various developments ensued, one of them being a change of name from Conference of Major Superiors of Women (CMSW) to Leadership Conference of Women Religious (LCWR). In this case the rose by another name did not immediately smell as sweet. The then Sacred Congregation for Religious and Secular Institutes (SCRIS), which had to approve the change, was reluctant to do so on the ground that it involved more than a matter of simple terminol-ogy. The Language and the Reality For the congregation, "major superiors" and "leader-ship" were not synonymous terms; the use of the one for Sister Mary Linscott SNDdeN is a former superior general of the Sisters of Notre Dame de Namur and a former president of the International Union of Superiors General (UISG). She has worked in the Congregation for Institutes of Consecrated Life and Societies of Apostolic Life (CICLSAL). This article is the somewhat shortened text of a talk which she gave in April 1992 to English-speaking superiors and councilors general in Rome and which appeared originally in UISG Bulletin 89. 166 Review for Religious the other could create confusion and even lead to changes of a more ~ubstantial kind, notwithstanding the likelihood that the sisters intended the words to denote the same reality. (We have to bear in mind that the change of name for the conference in the Uiaited States coincided with the reaction against authority which followed the special chapters of renewal and with the beginning of considerable modifications in the structures of religious gov-ernmerit. Moreover, the national conferences [or councils or unions] mandated by Perfectae Caritatis §23 and Ecclesiae Sanctae §42 and §43 were to be of major superiors, both for men and for women.) At all events, SCRIS felt that the substitution of "lead-ership" for "major superiors" could raise problems in an area where clarity was needed. Pc mission for the change came only after long reflection and on condition that the interpretation of the name was in accord with the provisions and intention of the Second Vatican Council. After twenty years the use of the word leadership in documents other than constitutions and directories has become quite widespread. We are used to headlines in our congregational pub-lications: "Province X Elects New Leadership" or "A Report from General Leadership." In some institutes "leadership group" has replaced "team" to denote sisters serving according to the con-stitutions at different levels of government. The usage seems to be mainly in the English-speaking world. Unless the word leaders is ~dopted without translation, as it is occasionally by French- or Spanish-speaking sisters, the concept which it expresses is usu-ally paraphrased or simply implied. For historical reasons the Italians avoid duce and the Germans fiibrer. The French always have responsable to fall back on. In English writing, however, there is a rather frequent use of leader and leadership. Over the years, what has happened to SCRIS's initial diffi-culty about religious institutes' use of the word leadership? A first remark ~hould be, I think, that the distinction of meaning made after 1970 still obtains. Leadership is a charism, a spiritual real-ity given freely by God to individuals for some special purpose in a community; authority in religious institutes is a canonico-juridi-cal as well as a spiritual reality. The two, therefore, are not syn-onymous and not interchangeable. Second, there has been a period in which popular writing and parlance about religious life have tended to avoid the word authority. Instead the term leadership was used but given much of the content that belongs to author- March-April 1993 167 Linscott ¯ Leadership, Authority, and Religious Government ity. This produced some confusion that weakened religious gov-ernment at all levels, but especially the local. In a third phase, more recently, we have had a certain clarification along this line: that, while leadership and religious authority are indeed different and distinct, they do not have to be in conflict, and in fact both are needed for good government. In this clarification some understandings have emerged which I will use for the purposes of this paper. With regard to leadership, wider and more immediate communications, the influence of the international institutes, and the cumulative effects of structural renewal have all helped to bring out the .concept of leadership as a personal gift in its own right. It is a charism expressed in per-sonal qualities which inspire respect, trust, following, sometimes enthusiasm. Since it depends on the qualities of a person, lead-ership is an enduring gift, not something assumed for a certain time and laid down at the end of a mandate. It is not conferred or limited by constitutions, and it cannot be legislated. It does not go with any given responsibility, and in itself it is no more account-able than any other charism. It derives, not from external cir-cumstances, but from inner sources, and it is linked much more with what a person is than with what she does. Leadership is found in many spheres other than government. It exists quite apart from authority. At the same time, the lengthening experience of renewal and the revision of the constitutions have pointed up the need for other elements besides leadership for the effective running of a religious congregation: functional government structures and clearly invested religious authority are essential. Religious author-ity, like that of the Lord from which it ultimately derives, involves a certain power, but it is power as service and for the sake of the mission. Such authority goes with the vow of obedience and is conferred for the achievement of the goals of the congregation: the spread of the gospel in and through the unity, growth, and service of the sisters. Necessary for the religious institute as a human organization, religious authority is also ecclesial in that it derives from constitutions approved by the church. Since it is attached to an office, it is an authority of status. It is given for a specified period to persons duly appointed or elected within the limits of the constitutions and church law. Religious authority has to be accountable. It is personal but not exercised in isola-tion. It can be legislated and must be provided for constitution- 168 Re~iew for Religious ally. It is assumed on a specified date and is laid down at the end of a mandate. It relates to what a person does and to what her responsibilities are, rather than to what she is in herself. Of itself it neither confers nor presupposes leadership, though leadership qualities are obviously desirable in a sister exercising authority. Government is a matter of duly chosen individuals inspiring, directing, and admin-istering with a.uthority the affairs of a con-gregation according to its spirit and sound traditions and according to church law and its own. Of itself government gives a lead, and in a religious congregation it is a con-crete expression of the charism acting to attain the congregation's purpose. I would say that these recent clarifications are helpful. Leadership, authority, and government are now seen as distinct from each other but closely .related in complementarity and all of them necessary for the healthy functioning of religious life. There are difficulties only when they are confused with each other, when one or other of them is not working properly, or when any of them tends to dominate the remaining two. I propose to look at the three elements in interrelation from two different angles. The first is historical. As phenomena in reli-gious life, leadership, authority, and government have come into being at different times in response to different needs, and in the course of history they have had different emphases. A look at their roots and evolution may help us to see better where we are at present with regard to them and may give us some ideas for future direction. The second angle is contemporary. Later in this article I will share with you what a surv4y of sixty approved con-stitutions seems to tell about leadership, authority, and govern-ment in congregations across the world today. The two angles will bring together the past and the present in view of the future. Where does religious government come from? The Phenomenon Where does religious government come from? Perfectae Caritatis §2a says: "Since the final norm of the religious life is the following of Christ as it is put before us fn the gospel, this must be taken by all institutes as the supreme rule" (see canon 662). It was the desire to follow Christ with greater liberty and to Marcb-/lpril 1993 169 Linscott ¯ Leadership, Authority, and Religious Government imitate him more closely that prompted men and women from very early times to practice, in various ways, the evangelical coun-sels (see PC §1) and thus live the gospel radically. As the great persecutions of the early church came to an end, many persons gave gospel witness by withdrawing into the desert and under-taking heroic acts of self-denial and penance as a substitute for martyrdom. Their life was a combat with the forces of evil, whose last stronghold was the wilderness. The call was often solitary, but among those who sought God in the desert there were inevitably some who were experienced and some who were begin-ners, renowned persons and those who were unknown, persons sought out for advice and guidance and those who still had a lot to learn. Without any structure, when there was as yet no orga-nization that required formal authority and government, a kind of leadership based on competence, personal qualities, and experience in the ways of the Lord brought into being some very personal relations between teachers and disciples. The earliest elements of religious leadership may be here: persons together seeking God's will and ways, with the gifts of the one at the service of the other and both persons helped towards the fullness of a Christian vocation. The living of the gospel was still the supreme goal and rule when, in the face of the decline of the desert type of life and because of the changes brought about by the barbarian invasions of western Europe and northern Africa, people grouped together in a more stable manner. Once there was grouping, some kind of agreement, however simple and loose, was necessary for order and peace. In this is the first seed of religious government. Humanly speaking, there would be leaders for the sake of unity if for no other reason. Once grouping was a stable way of life, the leader would usually be the one who founded the group, who accepted followers to form the group, and who contributed most to shaping its way of gospel living by example, prayer, teaching, and organization. It would be up to that person to ensure fidelity to the accepted way of life, to lead in the deepening of spiritual values, to give direction, to ensure viability. Everything would be geared to the gospel as the purpose of the group's existence, )nd the founder would lead in virtue of an authority of competence recognized by the members and by the church. This stable way of life affected the church both locally and universally. The stability of vows, the public witness of life, 170 Review for Religious required contacts with church authorities, especially the local bishop. There had to be the possibility of representation. Moreover, basic though the gospel was, no founder ever felt it sufficient simply to put the gospel text into the hands of his or her religious. The way of living out the gospel in any given congre-gation was expressed in a rule or constitutions usually drawn up by the founder and always approved by the church. The fact of liv-ing vowed life together, therefore, created human, ecclesial, and theological conditions that required the service of some member or members to the others in a way that fostered spiritual values, unity, fidelity to the founding bond and spirit, discernment of direction, links with the church, correction, spiritual and material provision, viability. Such responsibilities could not be undertaken without some kind of authority within the group itself. We there-fore find the elements of religious government coming into being as founders, who by the fact of founding showed qualities of lead-ership, accepted the responsibility of directing their religious fam-ily and each of its members towards the agreed-upon goal of the gospel by a service of authority recognized by the church. This service of authority was still needed in succeeding gen-erations, and for the same reasons as those which first prompted it. Once the founding generation was gone, however, the choice of members who would exercise authority was less obvious. It was not that there were no religious who had the competence, but rather that none had the unique claim of the founder. Loyalty, support, and obedience were given to the member who was duly elected or appointed to exercise authority, and with that there came into being an authority that could be apart from that of competence: an ex officio authority derived from role or status. The Evolution before the 19th Century All this needed considerable time to evolve, and it took on different patterns and structures according to the different charisms which it expressed. Moreover, it developed as new forms of religious life came into being to meet the needs of successive times. The first appearance of religious in the form of monks and monasteries was a spontaneous phenomenon in the church, a free action of the Holy Spirit, but by the 5th century their random multiplication had become such a problem that the Council of March-April 1993 171 Linscott ¯ Leadership, Authority, and Religious Government Chalcedon (451) established the requirement of episcopal per-mission for the founding of a monastery and made monks subject to bishops. It was recognized, however, that the community of monasticism required a certain independence in internal matters. Religious government, therefore, came to have two aspects, inter-nal and external, both involving authority. Over a long period the image of episcopal authority, which of its nature is hierarchical in the church, to some extent colored that of religious authority. Certainly the balance between the degree of freedom necessary for internal affairs and the submission to the bishop, which was equally necessary for the good of the local church, was a feature of canonical legislation for religious for centuries. The great founders and reformers somehow found ways to handle both the internal and external relations of religious government. Internally, St. Benedict, father of western monasticism, respected the whole community and united it around the abbot under the discipline of the Rule. Authority, leadership, and government came together harmoniously in his provisions. Externally, in centuries after his own, there were problems over necessary relations with bishops and civil rulers. When Benedict's work was refounded in the Cluniac and Cistercian reforms, Cluny managed to be subject neither to king nor to bishop. It was one of the first of a system of exemptions by which the evolution of religious life was handled. After the desert and the monasteries, both of which types of religious life continue today, a third period with new needs was that of the mendicants. Here the pattern of life was no longer the stability and close unity of the monastery, but instead the diverging travels of friars who went about preaching the good news, begging their way, and giving to the poor. They belonged to a more fluid community often located in a town that had been revitalized either by a growing medieval university or by the com-merce that followed the Crusades. In pursuit of the same gospel ideal as the monks and the desert dwellers, the mendicants orga-nized their lives differently. They did not have stability in Benedict's sense. Their forms of leadership and government had to suit their kind of public witness and the flexibility of their out-reach. The religious whose authority and responsibility for the whole group would parallel those of Benedict's abbot were sig-nificantly given different and suggestive names: guardian for the Franciscans and prior for the Dominicans. With the age of discovery and reform, new forms of religious 172 Review for Religious life, those of the apostolic orders, were the response of the Holy Spirit to the mission opportunities in newly discovered conti-nents and to the theological and educational needs nearer home. Religious life in the Latin church, still very much a European phenomenon, needed people like Francis Xavier, Jean de Br~beuf, and Junipero Serra to carry it to India, Japan, and the Americas. This out-reach in itself was a challenge to structures of government. The pio-neer missionaries were often at great distances from their original commu-nities. They were inevitably few, at least at the beginning, yet they were an important growing point of the institutes to which they belonged. They needed good leadership quali-ties themselves and a considerable del-egation of authority. The kind of religious government that was strong primarily at the local level did not really match their gift. There had to The Jesuits in their government heightened both leadership and authority and gave a new importance to what would henceforth become general-level administration. be support from a higher level where the overview of everything could unify the various local endeavors and thereby achieve a par-ticular witness to Christ. Not by coincidence is the general supe-rior of the Jesuits called the praepositus. Exempt from immediate episcopal control so as to be free for papal mandates, the succes-sors of St. Ignatius had to combine leadership by competence, which was vital, with the authority to inspire and administer a far-flung apostolic enterprise while strengthening the service given in pastoral, social, and academic fields in Europe. The Jesuits in their government heightened both leadership and authority and gave a new importance to what would henceforth become general-level administration. The Evolution after 1800 With the cataclysm of the French Revolution came various needs which were met by the most recent type of organized reli-gious life: institutes dedicated to works of the apostolate. Although by no means all of these are for sisters, the period since the Marcb-April 1993 173 Linscott ¯ Leadership, Authority, and Religious Government Napoleonic Concordat of 1802 has been marked by an extraor-dinarily high proportion of women's foundations. It is on these that I now focus. Very many institutes of sisters came into being as the response of the Spirit to the needs created by the industrial revolution, the successive waves of emigration from Europe to the new world, the opening up of Africa and Asia, and the series of revolutions which swept Europe from 1789 to 1848. They were founded not only to live the gospel themselves and to witness to it in a society that was mainly one of believers, as many previous religious had done, but also to be Christ the teacher or healer or shepherd or apostle of the Father, in ways specified by their founding gifts, in a society which was increasingly post-Christian and material-ist. Their vocation was apostolic, and the government they needed had to provide for apostolic mobility, with its requirement of cen-tralization as well for effectiveness at scattered locations as for unity and corporate direction throughout. They needed their own internal authority. As for leadership, it became clear as time went on that leadership gifts of many different kinds were required for the effective service of these institutes, particularly in areas of the apostolate which involved specialization. A new responsibility for sisters exercising authority was the fostering and harmonizing of these leadership gifts among the members for the unity of the whole and for better service in mission, even though in this case leadership was not related to government but to the apostolate. The governmental needs of the new institutes with regard to centralization and internal authority were not at first easily met. We have to remember that, during the century before 1901, sis-ters in institutes dedicated to apostolic works were technically not recognized by the church at all. It had been the ecumenical councils which determined and enunciated the church's provi-sions regarding religious life, and in the early 19th century the lat-est of these was still the Council of Trent. Trent had made a serious effort to tidy up a very complicated situation according to the signs of its own times. Three years after the close of the coun-cil, the decree Circa Pastoralis (1566) had stated the basic law of the church for religious, summarizing the canons of Lateran IV (1215), Lyons (1274), and Trent that referred to them. According to Circa Pa.storalis, religious were members of the church living a common life with solemn vows and cloister. All orders which were not exempt were subject to the local bishop. By 174 Review for Religious implication, therefore, members of groups which did not have solemn vows or which were not cloistered were not religious, and .they were subject to the local bishop without full internal reli-gious authority of their own because .they were not among the exempt orders. Institutes of sisters dedicated to apostolic work lived and served as religious, looked like religious, had the goals of religious, and gave the witness of religious while having sim-ple vows, little or no cloister, and a different way of living life in common from religious who were in accord with Circa Pastoralis. They needed an internal authority similar to that of the exempt congregations and for reasons like those of the apostolic orders. Actua.lly, the praxis of the church was ahead of its legislation in the 19th century, and both pontifical approval and the approval of several far-seeing bishops cleared the way for institutes of sisters. In 1900 Leo XIII, in Conditae a Christo, anticipated what was an evidently necessary change in church legislation~ He opened to religious groups with decrees of praise the formal right of cen-tralization under a superior general with real, personal authority throughout the institute. This recognized sisters in institutes ded-icated to works of the apostolate as re!igious in their own right: a third kind of entity with those conforming to Circa Pastorali's and with th~ exempt clerical orders. The recognition was' welcome, but it could not of itself erase the long experience of ambiguity, which was the only one that most institutes of sisters knew at first hand. Authority and gov-ernment were the issues on which the matter of recognition was solved, and both were associated with the image of the local bishop. Leo XIII followed up Conditae a Cbristo in 1901 with a set of norms which were a blueprint for the future Code of Canon Law (1917). The sisters updated their constitutions in the light of .,both documents; and, perhaps because in terms of religious life the autonomous government of institutes of sisters as a reality canon-ic~ lly recognized and supported was something relatively new, both a.uthority and government structures loomed large in the revisions. Great attention was given to new structures, especially those of provinces and general chapters; roles were spelled out in considerable detail. Time would bring out what this implied and how it would work out in practice. Of the three elements leader-ship, authority, and government, attention concentrated on the last two, which were concrete and could be legislated, even though the previous image many institutes had of them did not necessarily March-April 1993 175 Linscott ¯ Leadership, Authority, and Religious Government reflect their founding charism, but was colored by the rightly hierarchical character of the authority of the local bishop. Leadership was either taken for granted or channeled into apos-tolic enterprises. These sociological traits be~zame even more marked as the pressures of works and of professionalism came to bear on institutes in the mid 1950s. The Situation after Vatican II Less than fifty years after the Code of 1917 came the mandate of the Second Vatican Council to renew religious life according to the criteria of the gospel, the founding charism, and the signs of the times and to revise constitutions and directories in accord with this renewal. To make sure that the renewal actuaily took place, every institute was to celebrate a special general chapter within a period of two or three years. The chapter had excep-tional authority for this one occasion and was to be prepared with the widest possible involvement of all members of the institute. In the case of sisters dedicated to works of the apostolate, the timing of the conciliar mandate was critical. It came at a histor-ically ripe moment. The educational movement of the 1950s, the communications explosion of the 1960s, the influence of the human sciences, the authority crisis, and the development of fem-inism were only some of the elements which affected the way in which sisters tried to reexamine totally a life which they had taken very much for granted. They worked under pressure of time, with no precedent, technically unprepared, but with very much good-will. Inevitably, the sisters went first for adaptations: concrete changes which could be seen to be done and where change was clearly necessary. These involved structures and processes, plan-ning, participation, the Vatican Council's principles of subsidiar-ity and coresponsibility, the insdtute's style of life, and a review of apostolic works and resources. As sisters came to grips with these things, new leaders of a charismatic or natural kind--"born lead-ers"-- began to emerge. Their competence might be a particular professional field or an ability to communicate or the capacity to articulate well a personal vision for the future of the institute or a good grasp of dynamics. Whatever their gift, these leaders often came to the fore at the expense of leadership based on authority and experience of government. The membership of general chap- 176 Review for Religious ters from 1967 onwards was of a different composition from those which went before, and the influences on government and author-ity were consequently different. There was less experience of gov-ernment and more creativity; less hard information and more "dreaming" in the positive sense; less his-tory and more sociology; less theology and more impact from the human sci-ences. It all needed to be balanced out if it was to produce good religious govern-ment. A time of struggle, confusion, and emotion, however, is not the best time for balancing, and the difficult 1970s and early 1980s did not allow time to evaluate objectively what was happening. Nor was it possible to have the distance necessary for objectivity. The individualism of the period produced leaders in plenty, but not a similar number of sisters willing to accept responsibility. At the same time, various forms and degrees of resistance to authority made religious government very difficult. Expectations were not clear, and it was far easier to raise questions than to find constructive responses. All the while, people were aware that the overall num-bers of sisters were declining, that departures were frequent, that needs were multiplying and not being met, and that religious life was a microcosm of a church and world which were also in flux and seeking their way. In all this how did leadership, authority, and government fare? They were much-discussed topics in renewal, and it is in the con-text of renewal that we have to see them. Renewal involves inter-nal change. It causes us to interiorize and make our own--here and now, as individuals and as communities--the teaching of Jesus as it is lived in accordance with the charism of our religious insti-tute. Renewal affects beliefs, relationships, values, commitment, attitudes, and zeal. It determines how we live and serve, and it involves a conversion that is corporate as well as personal. Being basically interior and spiritual, renewal cannot be brought about simply by legislation. It needs the example and personal influ-ence of leadership, which i~ of its nature an agent of internal change. But leadership in religious renewal has to be enabling, Being basically interior and spiritual, renewal needs the example and personal influence of leadership, which is of its nature an agent of internal change. Marcb-April 1993 177 Linscott ¯ Leadership, Authority, and Religious Government helping sisters renew themselves and their institute by consis-tently proposing the gospel goal and ideal and by encouraging involvement, conviction, and commitment. Such enabling lead-ership is increasingly seen as necessary today. It is not in excess supply, for it requires an unusual blend of Christlike poverty of heart and inner freedom and at the same time strength, empa-thy, and clarity. It is ~ charism and, as such, cannot be conferred ex officio or be legislated as a predictable and controllable part of government. Yet without it even the most clear-cut exercise of legitimate authority does not succeed in changing fundamental attitudes and values, whatever it may do to outward forms. The very fact that leadership is neither predictable nor con-trollable from the point of view of legislation means that it needs a balance which can be predicted, controlled, and legislated. The balance is authority. In the years after the Second Vatican Council, the balance afforded by religious authority was significantly down-played, largely as reaction to the authoritarianism in the precon-ciliar years and also because of the trend towards greater participation. Pa~'ticipation, however, does not remove the need for authority, and authoritarianism is an abuse which can be reme-died without touching the principle o.f authority itself. If no chan-rlels of legitimate authority are provided, one of two things seems to happen: either (1) the group crumbles from within because there is no commonly acknowle.dged center, no one has respon-sibility at the corporate level, and each sister has to go her own way, interpreting her religious life to the best of her ability; or (2) some sister emerges as a leader without religious authority, either by fo.rce of con.viction or natural gifts or charism or plain per-sonal aggressiveness. In either case the important value of re!igious obedience gets lost. Yet it is through religious obedience that we understand religious authority, and it is the two of them together that create the unique relationship in which a properly autho-rized leader can enable sisters to grow, not in passivity and not in external adaptation only, but in an active collaboration which make~ for joy and greater fullness of life. Religious government, therefore, needs both leaders.hip and authority and needs them together. Authority wi'thout leadership can become an insecure and heavy-handed exercise of power. Leadership without authority can lack sound direction, responsi-bi! ity, and accountability," making for disturbance rather than for peaceful growth in the Lord. Structures of government somehow 178 Review for Religious have to harmonize the two. Authority is usually provided in struc-tures at general, provincial, and local levels that maintain personal authority balanced by councils, chapters, and assemblies according to particular traditions, and that indicate an unambiguous line of accountability. Leadership, which cannot be legislated so directly, is implied in statements about the charism, spirit, and vision of the institute, in the qualities required in sisters exercising author-ity, and in the details of responsibilities and job descriptions. Moreover, it has been characteristic of the structures of religious government that authority is not exercised in isolation, nor should it be exercised in a way that creates a gap between those exercis-ing authority and those accepting it. This last point is a matter of style rather than of structure and is as much a challenge for teams and groups, even when the respective responsibilities and rela-tions are well spelled out, as it is for individuals. The revision of constitutions has led to some solid rethinking in the whole area of leadership, authority, and government. As we have seen, the theme goes far back in the history of religious life, and the strands intertwine inextricably, like differently colored ply in a length of wool making a single thread. Sisters today are certainly clearer on the issues than they were at the turn of the 1970s. All the same, we are never free from the responsibility of asking ourselves: (I) Has the basic function of leadership, author-ity, and government in religious life changed? If it has, why? And to what? (2) Do our structures correspond to their purpose and function? Now I would like to share with you what some samples of recently revised and approved constitutions from different parts of the world have to say to us about leadership, authority, and government in religious life today. In the light of these concrete statements, I will afterwards pick up again the two questions I have just raised. Sampling Some Revised Constitutions During my period of service at the Congregation for Institutes of Consecrated Life and Societies of Apostolic Life (CICLSAL), about 1500 revised constitutions received their decrees of approval, and there have been a few more since then. Among this overwhelming amount of material, my only option was to take a sampling. I decided on five criteria of choice. March-April 1993 179 Linscott ¯ Leadership, Authority, and Religious Government 1. My first criterion was to restrict myself to constitutions presented in English. There are more than enough of these to give a range of thought and experience, and I have the advantage of knowing them well and of having worked with many of the sisters who produced them. 2. My second criterion was to cover the different spiritual traditions in religious families, since these affect concepts and structures of government. I took sisters' constitutions deriving from the inspiration of the classic founders Alphonsus, Augustine, Benedict, Dominic, Francis, Ignatius, and Paul of the Cross. I also took some from the women's congregations that have a com-mon source of spirituality: Ursulines, Sisters of St. Joseph, Sisters of the Presentation, Sisters of Mercy, Sisters of Charity, Sisters of the Incarnate Word. I sampled as a further category congrega-tions with a strong and clear individual charism that are not notably indebted either to one of the major religious families of men or to other groups of sisters. 3. My third criterion was to cover a wide range of cultures, since these are important in the expression of values and princi-ples. The English-speaking world is notoriously extensive, and also some institutes present their texts in English either because this is an acceptable second language or because their principal growing points are in English-speaking areas outside their coun-try of origin. I ended up with constitutions from Australia, Austria, Belgium, Canada, England, France, Holland, India, Ireland, Malta, New Zealand, the Philippines, Rome, South Africa, and the United States of America. 4. A fourth criterion was to include a few constitutions of men religious by way of comparison. 5. Lastly, I included a random sampling of the remaining texts to a total of sixty constitutions. Fifty-five are by sisters and five by men religious: two clerical institutes and three of brothers. My observations are based on these sixty texts. Initial Impressions As one would expect of approved constitutions, on the subject of leadership, authority, and government, all the texts are canon-ically accurate inasmuch as they all harmonize with the present law of the church and with the values, principles, and basic structures deriving from their own previously approved founding charisms. 180 Review for Religious Yet no two are alike, and when I speak of a certain degree of com-monality I am not referring to common material or even to depen-dence on a common Code, but to a certain convergence of values and thinking across texts worked out independently and expressed with a great deal of diversity. Convergence. The highest degree of convergence is in the impor.tance attached to authority in regard to both government and leadership. In almost every case, whether the actual words are used or not, there is the idea that authority is to be exercised in government by sisters with qualities of leadership. The three elements go together, and it is authority that links the other two. There is a high degree of convergence also on the source of reli-gious authority being ultimately God himself and on the spirit of service which marks its exercise. Jesus Christ, whether as shep-herd, servant, son, or savior, is the model for the kind of exer-cise of authority in leadership that should characterize religious government. This spiritual level is usually clear and well expressed with a direct application to unity and mission. Areas of Diversity. The convergences are not bland, because there is no uniformity in the concrete provisions that express the converging values and principles. Each institute has not only its own founding gift, but also its own living tradition and experience, its own "now," and its own vision of the future. So, for example, even institutes which have the Rule of St. Augustine or that of the Franciscan Third Order Regular or the Constitutions of St. Ignatius as part of their proper law will have their own ways of incorporating these in concrete enactments. A good deal can be inferred, therefore, from the way in which the principles of government are actually spelled out. There are nuances about authority, leadership, and government to be found in the job descriptions given for moderators at the different lev-els, in the qualities and priorities looked for in those who will be responsible for government, in provisions for a particular style of operation, or in the way that responsibility and accountability are handled. Relationships and structures are the other areas with rich implications. The way in which a text expresses the com-bined responsibility of the membership and the various sisters in authority for the well-being of the institute is also instructive. So are the relations and interaction of moderators and councils and of both with chapters. Something can be learned from the way that the material on March-April 1993 181 Linscott ¯ Leadership, Authority, and Religious Government authority and government is organized and presented. Some con-stitutions begin with people, some with types of norm; some begin with the whole entity of the institute as the body expressing the corporate charism and recognized as such by the church, some with the rights and responsibilities of the individual sister. Most start at the general level, since this avoids having to repeat and anticipate, but some begin with the local level. Perhaps the most revealing thing is terminology. If we raised our eyebrows in 1983 over the Code's use of"moderator," it was only because we had not yet realized our own creativity in find-ing names for those who were once uniformly referred to as supe-riors and for the sisters who work immediately with them. All the constitutions I studied were approved between September 1982 and May 1991. In them I met superiors, abbesses, prioresses, directors, facilitators, coordinators, sisters-in-charge, guardians, custodians, mothers, moderators, ministers, and presidents. These are helped and advised by councils, cabinets, government groups, boards, teams, and assistants and are accountable to assemblies, senates, and chapters. When the substance of all these is actually spelled out in terms of purpose, function, authority, and account-ability, there may not be any great difference at present between one reality and another. I have a strong sense, however, of dif-ference in climate and general approach between sisters who are superiors with a council responsible to a general chapter and sis-ters who are presidents with a cabinet responsible to a senate. What is denoted is similar, but the connotations are different, and it remains to be seen where that will take us. Leadership, Authority, and Religious Government in the Texts First of all, let me say that the three concepts, though they are present in each of the sixty texts, are not always specifically named. Neither do they receive equal emphasis. Authority gets by far the most attention, even in the two constitutions where the writers did not use the word itself. Government also gets pretty full treat-ment, especially in the abstract, and texts which reflect some reluctance to say that a moderator governs will spell out for her a number of responsibilities which are clearly those of govern-ment. Leadership is stressed much less. The word rarely occurs except in phrases such as "the general moderator is the leader of the congregation" or "the sister chosen as the general moderator 182 Review for Religious should have qualities of leadership." Leadership in its ordinary sense, however, is very often implied, and the spiritual role of leadership is clear. Religious Government and Authority. Statements about gov-ernment alone are usually clear and often pithy. They tend to ~pecify purpose: "Government in the eongregation provides structures and offices that facilitate our common life and ministry by ordering relat!onsh'ips and designating the functions of the members" (U.S.A.). "Governance is the means through which the resources of the congregation are unified, directed, and integrated" (U.S.A.). More subjec-tively descriptive but still purposeful is a' statement such as this: "Government is an experience in relationships, in deci-sion making, and in communication. Through itwe strive together to seek and do God's will" (Rome). From England comes the observation, that government is par.t of any organized society and that, in the case of rel!gious, it maintains the inspiration, nature, and purpose of an institute as living reali-ties. Most of the provision for government follows statements on authority which place its source in God o1: in Jesus Christ and which distinguish it from other kinds of personal power: :'Christ's authority given him by the Father was clearly .distinct in its exer-cise from the authority of the rulers of this world who lord it over their subjects," says an Irish text. "Christ expressed his authority in loving service: to heal, to forgive, to give life, to send in mis-sion." Some texts underline the ecclesial dimension: "Authority is given by God to the church, and it is from the church that the congregation receives its recognition as a religious institute and therefore a share in the authority of Christ" (England). "Authority in our institute is of an ecclesial nature and should reflect the self-g!ving of our divine master" (Philippines). "God is the source of all authority, but in working out his plan he asks for our coop-eration" (England). Some constitutions refer authority directly I have a strong sense, however, of difference in climate and general approach between sisters who are superiors with a council responsible to a general chapter and sisters who are presidents with a cabinet responsible to a senate. March-April 1993 183 Linscott ¯ Leadership, Authority, and Religious Government The model of religious authority is, without exception, Jesus Christ. to superiors and chapters, but at least one broadens it to this: "From Jesus, proclaimed in the gospel, the authority of the . . . congregation, mediated and affirmed through the church, resides in the communion of its members according to their respective roles" (U.S.A.). The model of religious authority is, without exception, Jesus Christ, "the master who made himself servant in order that those he served might share his life and mission and that they in their turn might minister to others" (England). "Evangelical author-ity," says a congregation based in Rome, "is service which reflects the humility and self-giving of Jesus." Another one says: "Authority is founded on Christ, who received it from the Father and who came as one who serves. The example and teaching of Christ inspire sisters in positions of authority and all of us to serve as he did" (Rome). From Austria comes this statement: "In a religious con-gregation, the only model of authority is Jesus." The same arti-cle goes on to say, "Being a Marian congregation, all authority should reflect the gentleness and motherliness of our blessed Mother." This unanimously affirmed source and model determines to a great extent what the constitutions have to say about the nature of religious authority, what it requires, what it extends to, and how it is exercised. The question "What is it?" is variously answered: "It is a service meant to help the sisters discern and accomplish God's will" (U.S.A.). "It is a ministry of service which has as its object the fostering of unity in our diversity and the promotion of our mission in the life and work of the church" (England). "It helps us incarnate the vision of our founder in our time and to go forward together in the same spirit towards the same end" (Canada). Unity, mission, identity, and the discerning of God's will recur constantly as themes of response to the ques-tion "What is religious authority?" or "What is it all about?" It is interesting that the attempts to define authority as principle, which tied some of the renewal chapters in knots in the late 1960s, have been abandoned in the approved constitutions. There is no dictionary definition but rather a description, or an inference from needs and consequences, which is concrete rather' than the- 184 Reviev~ for Religions oretical. It expresses a basic principle, however, and links it with government, charisms, obedience, and leadership. This principle is nearly always taken from the standpoint of faith. What is required for the exercise of religious authority is expressed in terms of values, attitudes, qualities, and relation-ships. Sisters exercising authority do so for the sake of unity, wit-ness, effective corporate service, the growth of their sisters towards the fullness of Christ, and the building of the kingdom of God (Belgium, France, South Africa, U.S.A.). They are asked to be unifiers, animators, discerners, listeners (England, Holland, Ireland). The qualities looked for in a good superior at whatever level are instructive. In these texts there is much less of the utopi-anism that characterized the early 1970s and scared away many a good potential superior by requiring a combination of qualities which an archangel would have had a hard time meeting. The requirements now are geared to a more realistic perception. "A sis-ter who exemplifies the spirit and life of our congregation" (India) is a requirement which recurs fairly often and which applies to religious Pope Paul VI's observation that the people of our time respond better to example than to theory. "A woman of prayer and faith, close to God in her personal life" is also often mentioned. Then come the personality traits: compassion, courage, vision, love for the institute and for the sis-ters, practical intelligence; then the qualities that relate specifically to the exercise of authority: perceptiveness, good judgment, patience, balance, firmness, experience of life, and the capacity to listen, to collaborate, and to decide. It is noticeable that recently approved constitutions take it for granted that the qualities of those exercising authority need to be complemented and com-pleted by those of their immediate collaborators and by the sisters at large. Hence the importance of relationships, not only in the sense of personal relations--as, for example, between a superior and her councilors or with her sisters--but also in the deeper sense of the necessary interrelation of authority and obedience for the common project, or in "the sense that all the sisters in their various ways are responsible for the good of the institute. "There can be no community among us," says one text, "unless our com-mon life and mission are governed by deliberations and decisions that draw us all towards a u.nity of thought, sentiment, and action. To those deliberations and decisions we are all obligated as reli-gious pledged to obedience--both to contribute and to respond" March-April 1993 185 Linscott ¯ Leader'sbip; Authority, and Religious Government (U.S.A.). A text from England sees sisters serving in authority as "challenging each sister to fidelity in our shared spirit and charism so that our way of prayiiag, living, and working together may be fruitful for burselves and for others." This kind of statement car-ries religious authority beyond the juridical limits of the consti-tfitions and church law according to which it is exercised and into the realm of th~ basic values of religious life for which it is given. Principies foi" the exercise of religious ~iuthority receive more attention in recently approved ,constitutions than in preceding texts, where they tended to be taken for granted. As early as 1966, Ecdesiae Sanctae provided for "an ample and free consultatiofi of all [the religious in an institute]" in the preparation of the special general chapter of renewal (ES §4), and this basic concept of par- ~igipation echoes in practically every text. One document puts it like this: "Since the Holy Spirit works in all, we encourage the active pai:dcipation of each in the decision-making process within the community and the congregation. Our acceptance of respon-sibility for implementing the decisions made is a source of unity among us" (U.S.A.). Participation is seeh as a source of mutual support (India) and is meant to further the aims and goals of the congregation (U.S.A.). More specific than participation as a gen-eral principle is participative government which, according to one text, "includes these elements fundamental to government struc-tures: sl~ared responsibility, subsidiarity, accountability" (U.S.A.). These last three principles, together with the need for commu-nication, are mentioned in practically all tiae constitutions stud-ied and directly reflect the influence of Vatican II. The American text just quoted says that shared responsibility, subsidiarity, and ac6ountability are fundamental to government structures. In one' way, such structures exist to make religiofis authority effective: They channel authority and locate it, limit it, and focus it. They are, therefore, very specific to each institute, reflecting as they do its charism and traditibns, it~ circumstances and its cultures. The connection.wii:h charism is usually evident. Congregations whose founding gift requires a stable way of life in the sense of a fair amount of residential stability and a good deal of authority at the local level will have structures that allow for decentralization and immediate participation. Congregations whose founding gift requires apostolic mobility will have more centralized general structures if things are to work well, and par-ticipation in matters beyond the local level will often be limited i 86 Review for Religious to elected representatives. For example, three congregations in the Benedictine tradition from three different continents all have structures which move solidly from the individual sister to cor-porate unity. Two institutes strongly in the Ignatian tradition begin with the need for someone "who holds the charge of the entire body of the society and whose duty is the good government, preser-vation, and development of the whole body" (Ireland). Here the starting point is the superior general. Most institutes lie on an arc somewhere between these two. The fact is that structures, all of which are approved as adequate in their provisions for government, can be as varied as the charisms they reflect. Circumstances diversify them still further, for there are bound to be dif-ferences in structures of government between an institute many of whose sis-ters are centered in one house Structures, all of which are approved as adequate in their provisions for government, can be as varied as the charisms they reflect. (England), an institute whose sisters are in small houses near to each other (Belgium), and an institute whose members are widely scattered across vast areas in the prairies of the United States or the outback of Australia. Cultures, too, certainly affect structures and in particular the way in which structures are regarded. Institutes of the same reli-gious family and with a good deal of common tradition keep adapting their structures differently according as they are in Australia, Canada, Rome, or the United States. The European texts lay stress on the persons who exercise authority, their qual-ities, responsibilities, soundness of judgment, relation to others, accountability. There is an underlying element of trust and need to support, and an implication that, given the right persons, things cannot go too far wrong even if the structures themselves are less than perfect. This, however, is not an excuse for poor structures. The structural provisions are generally good. The Indian texts have greater structural detail, but still a considerable stress on the person. Some of the American texts, however, are very strong on structure, almost as if good structure of government could protect an institute from any kind of abuse of power. This is by no means a universal feature of texts from. the United States, but March-April 1993 187 Linscott ¯ Leadership, Authority, and Religious Government where it occurs the structures are given in great detail, there is generally a system of checks and balances, a high proportion of the whole text is devoted to government, and there is not very much about the kind of sister looked for to exercise authority. In an extreme case, there is no more than the bare juridical require-ments. Again, between the two extremes, there is a wide range across the sixty texts. Each of them has been approved in its own right. The only point I make here is that, beyond the influence of charism and of apostolic circumstances, governmental structures for the exercise of religious authority are affected to some extent by culture. This has its own repercussion, of course, in interna-tional congregations. Religious Authority and Leadership. That the duty of leading is an aspect of government and that religious authority is given for this purpose is clear in most of the constitutions. "Those who hold authority in the institute have the right and responsibility to lead it in fidelity to its spirit and mission," says a text from Australia. There are also many references to general and local superiors being leaders of the whole institute or of the local com-munity respectively. What this leadership consists in emerges from the qualities looked for in a superior: "A woman of faith, discretion, and courage, she cultivates a spirit of availability and openness. A woman of compassion and understanding, she inspires, unifies, directs. A woman of fidelity, she fosters a response to the church and the world in accord with our charism. She is responsible for creating an atmosphere conducive to the spiri-tual, intellectual, and affective growth of each member, and she should show more concern for the Holy Spirit and for persons than for structures as such and for the letter of the law" (U.S.A.). This pastoral approach reappears in very many texts. Superiors lead by what they are and what they do: "She is steward of our way of life., of the heritage and mission of the congregation and of the gifts of each sister . She leads by her example, teaching, and decisions . . . and she exercises her authority with pastoral con-cern" (Australia). If the superior is expected to have leadership qualities, they are of a Christlike kind and facilitate her free and simple exercise of authority. One constitutional text notes that, when this is the case, the leadership qualities in the sisters are also fostered. "The right exercise of authority encourages each sister to become that per-son whom the Father called in Christ. The superior is confident 188 Review for Religious that the Spirit who creates diversity is able by his loving influ-ence to preserve union of mind and heart among the sisters. In this encouraging atmosphere, the graces of our baptism and religious vocation give rise to a number of leadership qualities among the sisters, all contributing to the vitality of community and the ful-fillment of our mission in the church" (U.S.A.). The role of authority in its pas-toral leading then becomes the encourage-ment and harmonizing of the leadership gifts in the community. This very fact points out the distinc-tion between the authority to lead that is vested in one person with assistance from others and the leadership gifts that can be in any community member. The two are not the same and are usually distinguished when they appear in constitutions. For example, we have from Australia: "The superior exercises her authority according to the spirit and laws of our congregation. In giving leadership, she encourages the participation of all the members," and from the United States: "The community min-ister is the canonical leader and unifier of the congregation. She has authority and responsibility for spiritual and apostolic lead-ership." If the kind of leadership expected of sisters in authority is implied in the qualities desired for eligibility, the direction of that leadership is usually implicit in their functions. At the general level, a superior "unifies in charity, urges fidelity to the gospel and to the constitutions; calls individuals and groups to core-sponsibility and account; keeps abreast of movements in the church and in society; enunciates goals and priorities as a com-munity in mission; focuses the corporate nature of our life and mission; and serves in various representative and governmental capacities" (U.S.A.). At the local level she serves the action of the Holy Spirit who is forming the community from within into a single body for the building of the kingdom (Canada). In texts from Malta, India, the Philippines, and New Zealand, too, this is spelled out in terms of animation, administration, and forma-tion. The role of authority in its pastoral leading then becomes the encouragement and harmonizing of the leadership gifts in the community. March-April 1993 189 Linscott ¯ Leadership, Authority, and Relig4ous Government The ideal would seem to be that a sister who exercises reli-gious authority is a leader and that her leadership qualities are evident in her governing as she encourages and draws on the gifts of her sisters, especially those who more immediately share responsibility with her, for the well-being of the community. Leadership and Government. For the sake of completeness, there should be a word about what the constitutions give us on leadership and government. It is a short word, because they say very little on the point directly. For the constitutions, leadership is a quality desirable in sisters exercising authority, and govern-ment is the concrete process by which authority is exercised to unify and animate the institute so as to attain its goal. The texts take both leadership and government in relation to authority, not in relation to each other. We are obliged, so to speak, to go via authority if we want to link the other two. This is probably an inevitable state of affairs, for constitutions are spiritual juridical documents which give principles and norms for what can be leg-islated. Both authority and government are patient of legislation; leadership is not. So it is normal that, while several texts hope for leadership as a quality in those vested with authority to gov-ern, nobody assumes that it is a quality conferred by the fact of having that authority. This in itself is a realistic step forward. Conclusion How can we summarize all this? The new elements that mark the current phase of religious government in contrast to those which preceded it seem to be: ¯ a renewed sense of the spiritual dimension and of the kind of responsibility which it involves; ¯ a sharp awareness of the rediscovered founding charism; the concept of authority as service reflecting the Christ who came not to be served but to serve; ¯ the idea of complementing necessary gifts; openness to a wide participation of the sisters in general according to their roles and experience, continuing the thrust of the Second Vatican Council on the dignity of each person and expressing the belief that the Holy Spirit can work through each one for the good of the whole; ¯ the adoption of responsibility, subsidiarity, and account-ability as basic principles; ¯ the recognition by many that religious government is inseparably linked with the founding charism and with 190 Review for Religious the vow of obedience and so has a dimension of faith and of relation to the church that distinguishes it ultimately from administration, organization, management, or indeed any other form of government. At the same time, pro-cesses of consensus and discernment, variously under-stood, have been widely adopted. The evolution of the understanding and praxis of leadership, authority, and government in religious life is continuous. It is not in itself an experiment which can be tried out for a certain num-ber of years and then be confirmed, modified, or dropped, although individual structures expressing it can be handled in this way. In itself the evolutitn is essential and consistent. It is, there-fore, from the viewpoint of the present moment in an evolving continuum that we can pick up the two questions we raised some pages back. Has the basic function of leadership, authority, and government in religious life changed? If it has, why? Ana to what? We have seen that the goals and values for which leadership, authority, and gov-ernment exist in religious iife go far back in history, emerging from the following of Christ in radic~il gospel living as it was first understood bythe desert fathers and mothers and the early mqnks. From at least the time of St. Benedict, these goals and values have included the promotion of individual and community growth towards the full maturity of Christ; th~ fostering of unity, peace, and mission at the service of the church; the encouragement of fidelity; the ensuring of forrhation; the provision of the necessi-ties for consecrated life, all in accord with the particular found-ing charism of the institute. It is evident from the survey of the sixty recently approved constitutions that these basic goals and values remain constant. The stated purpose and function of gov-ernment is always that the institute a~hieve the goal for which it exists in the church: a specific pu.blic witness to Christ and his gospel in unity, prayer, and growth in love and in the service of mission. As regards these purposes, there is little change. What has changed, from the evidence of quite a few texts, is something which is not directly within the competence of con-stitutions: the kind and extent of responsibility actually involved in undertaking the service of government today. Whereas, even into the 19th century, religious government was (and in principle still is) primarily a spiritual and ecclesial matter, for many insti-tutes of sisters today there are accretions which create a further and different kind of responsibility. A superior general who has March-April 1993 191 Linscott ¯ Leadership, Authority, and Religious Government been elected to see to the growth and mission of her sisters in service to the sick with Christ the healer may find herself by that very fact fostering that growth as president of a multimillion-dol-lar hospital corporation. The superior of an institute with an apos-tolate of education may well be ex officio a member of the boards of various colleges and universities. She will almost inevitably find herself ultimately responsible for the administration of homes for the aged sisters and for dealing with financial reports. The spread of an institute and the desire for hands-on government may call for wide travel, a knowledge of languages, and the capac-ity for inculturation. Both public relations and communication, with all their current technicalities, will claim attention. Clearly, responsibilities have to be delegated. However, under this kind of pressure, things may get treated from the point of view of the accretions instead of the essential. This substitutes administra-tion for religious government. It tends to depersonalize, to use authority for efficiency only, without the spiritual quality which should animate the government of religious. The accretions, which are many and demanding and which show no sign of dimin-ishing of their own accord, are the proper field for delegation and group work. To elect superiors and councilors or tdam mem-bers in view of the accretions instead of the capacity to serve the basic goals and values of the institute would be to build in a dis-tortion. Somehow, the different responsibilities have to be dis-tinguished and provided for in their own right. Do our structures com'espond to their purpose and function? This is a question that each institute has to answer for itself, because each one has its unique charism that determines the purpose, function, and structures of its government. Certain circumstances, however, have influenced structures and government in many institutes of sisters dedicated to works of the apostolate; there are reflections of them in the constitutions studied. It may be worth noting them, for they could still clog the wheels in some institutes. Among such circumstances would be: ¯ an institute's existence before canonical recognition when there was not a corpus of canons a.dapted to the needs of sisters and when, in consequence, individual traditions of government could range from the very firm to the very loose according to personalities and to the local circum-stahces-- such precanonical traditions may well have an influence still; ¯ the high degree of uniformity in provisions after 1917; 192 Review for Religion, s ¯ the tendency to authoritarianism and the stress on author-ity of status between the Code of 1917 and the renewal initiated hy Vatican II; ¯ the rapid change in structures and praxis that followed the special general chapters at the end of the 1960s; ¯ the impact of social, political, and psychological change brought about by major movements over the past thirty years: peace and justice, solidarity with the poor, femi-nism, rapid communication, even the recent collapse of communism; ¯ internal tensions regarding identity vis-a-vis the laity, lifestyle, mission, place in the church, raison d'etre; ¯ some confusion of the functions of consultation, consen-sus, and discernment with the functions proper to gov-ernment. SCRIS had a point in the early 1970s when it held that lead-ership and religious authority are not the same thing and that their respective relations to government are different. Time has brought out, however, that religious government does not impose a choice between the two. On the contrary, both are needed, although in different ways. Good religious government reflects not only the word of the gospel, but the Word himself, who leads as pastor and as servant precisely because he so evidently has authority. Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is not extended to copying for commercial distribution, advertising, or institutional promotion of for the creation of new collective works or anthologies. Such permission will be considered only on written application to the Editor, Review for Religious. March-April 1993 193 JANICE McLAUGHLIN The Meaning of Evangelization Today evangelizing The Shona people of Africa have many names for God. My favorite is "Chipindikure"--The One Who Turns Things Upside Down. Chipindikure comes from the root word kupinduka, which means transformation or revolu-tion. This is what God is doing in the life of each of us and in our world. And this, I think, is what evangelization is all about; letting God's message--which is the most revolu-tionary message the world has ever known--letting that message transform us, turn us upside down, so that we in turn may transform society. Evangelization, then, is about change and about choice. I can say no to change. I can choose to stay in my little rut and refuse to be shaken up and turned upside down. But God does not give up that easily. Like St. Paul, God knocks us off our horse over and over again until we get the message. We have all had these moments of insight in our lives, these turning points, which open us to n~w possibilities. Let us look at some examples of what I mean from my experience--after which I hope you will look at examples from your own experience. After I entered Maryknoll in 1961, I became involved in the civil-rights movement and the antiwar movement. Janice McLaughlin MM spent 22 years in Africa. She recently completed her doctoral dissertation on "The Catholic Church and Zimbabwe's War of Liberation 1972-1980" at the University of Zimbabwe. She may be addressed at Community Office; Maryknoll Sisters; Maryknoll, New York 10545. 194 Review 3~br Religious I also worked with the "war on poverty" program in the small town of Ossining, New York, near Maryknoll. But I think that my eyes were really opened for the first time when I went to East Africa in 1969. Learning another language and living in another culture is perhaps a shortcut to transformation. It forced me to give up my old way of looking at things--my Pittsburgh, St. Lawrence O'Toole Parish, McLaughlin, United States way of looking at life, at God, at the world. It is a shock to learn that you do not have all the answers and that you are not even asking the right questions. The wonderful people of Kenya, and later the people of Zimbabwe and Mozambique, taught me that people are more important than things; that being is more important than doing; that God and relationships are at the heart of everything. In 1977 I went from Kenya to Zimbabwe, which was Southern Rhodesia at that time, and worked as the press secre-tary for the Justice and Peace Commission. I was detained and then deported for telling the truth about the war that was taking place there. Racial segregation and discrimination were govern-ment policy, as they had once been here in the United States. I saw that the war of liberation was an Exodus experience for the African people as they journeyed from slavery to freedom. I came to realize that this iourney goes on in each of our lives as we seek to free ourselves from whatever enslaves us. For some peo-ple it is drugs or alcohol or a history of physical or sexual abuse. For us religious it is often our fears, our inflexibility, and our selfishness. Later I worked with refugees from the war and saw that we are all refugees on a journey through life to our true home. The refugees showed me that, the less we carry on the journey, the easier it will be to reach our destination. In fact, life is a process of stripping us of all we cherish until God is all and everything for us. This is the mystery of death and resurrection which is at the heart of our faith--dying to self so that we may live in Christ. Thus refugees and displaced persons, political prisoners and freedom fighters, and the courageous men, women, and children of Africa who never give up hoping in the midst of so much destruction and death have evangelized me and have shown me that evangelization is incarnational and prophetic and is rooted in prayer. March-April 1993 195 McLaugblin. Evangelization Evangelization Is Incarnational Valentine, one of my students at a school for freedom fight-ers in Maputo, Mozambique, helped me see how incarnation works today. He told me how he had joined the liberation strug-gle after his graduation. "I thought I was better than the others because I had finished high school," he confessed. "I thought that I would be made ~ commander. But I was treated like everyone else." He said that his clothes became torn, that he had no soap for bathing, and little food. He began to think that he had made a mistake and that life was better under colonialism. "Then in my downtrodden position," he said, "I learned the beauty of the revolution. I learned that my suffering was to help others. My life now is to serve the people." Valentine was turned upside down, from being a conceited, selfish youth to becoming a person for others. "From my down-trodden position, I learned. ," he said. This is how God teaches all of us. When we are down and out; when we have lost what is precious to us; when we do not have all the answers; when we feel useless, lost, and alone: God reaches out and touches our pain, our suffering, our loss, turning our little daily deaths into new life. "She who loses her life will find it," God has promised. The happiest moments of my life were the times when I had the least, when, like Valentine, I was downtrodden and suffering with and for others. The three weeks I spent in solitary confine-ment in a Rhodesian prison, for instance, I had few material pos-sessions: a prison uniform, a lumpy bed, and lousy food. But this hardly mattered because the other prisoners reached out to me and welcomed me in their midst. They sang freedom songs at night and smuggled notes to me during the day. They even sent me food when they learned that I liked their African diet. I felt part of something bigger than myself. I was suffering for a cause, and the pain and fear no longer mattered because I was not alone. I was with the oppressed people, and God was there with us in our prison cells. I had this same experience of solidarity and closeness to God in the refugee camps deep in the forests of Mozambique. There I was the one who was weak and powerless. I did not know how to survive in the forest, so the children became my caretakers and guides. They would keep me company to cheer me up; they would teach me their language and share with me any special treats like sugarcane or maputi (a kind of popcorn). They were ministering 196 Review for Religious to me. I did not have to produce or perform, but merely to be there with them in their exile from home. This incarnational approach from within is very different from the balcony approach, where we stand outside and above, pointing fingers at what is wrong and telling others to change. Too often church people, including us religious, stand on our bal-conies criticizing and throwing stones at the world instead of immersing ourselves in the pain and suffering of the poor and oppressed, as Christ did. This immersion enables us to see the world from a new perspective. It is what turns us upside down. Evangelization Is Prophetic When we have been changed, then we are ready to change the world together with the victims. I remember an African sis-ter in Zimbabwe, Sister Marie Theresa Paulino, who explained to me how she became involved in assisting the freedom fighters during the war of liberation. "I thought of Jesus carrying his cross," she told me. "Everyone stood on the sidelines and watched. Only one woman had courage and came forward to wipe his face with her veil. I decided that I could not stand on the sidelines and watch my people suffering, but like Veronica I must have courage and do something to help." She was a nurse. She would disguise herself as a peasant woman, tie her medical instruments around her waist, and walk long distances to mountain caves where she would treat freedom fighters who had been wounded. This was a very risky thing to do. She could have been arrested and even killed if caught by the government authorities. Who knows what the church authorities would have done if they had known of this single sister's act of courage to wipe the face of her suffering people? Each of us is called to have this kind of courage, to wipe the faces of suffering people: the homeless in our streets, the drug addicts, the AIDS patients, the gangs in our inner cities, the sin-gle mothers, the abused and abandoned children, the new immi-grants. I have discovered in the months that I have been back in the United States that there are endless problems here needing to be solved. In fact, it seems tp me that the people of the United States are much more needy than the people I have known in Africa; people in this country of excess and abundance are in dan-ger of losing their souls. Marcb-Atrril 1993 197 McLaugblin ¯ Evangelization Prophetic action is needed to turn the values of this country upside down. We need more than a new president or a new congress or a balanced budget, though these might help. We need more than family values, though these too might help. If we want to save this country, save this planet, and save ourselves, we must return to the radical message of Christ in the gospels. What would the world look like if we truly walked in the footsteps of Christ? Do you think we would turn back Haitians fleeing the poverty and violence in their country? Would we exonerate the police-men who beat up Rodney King? Would we doubt Anita Hill? Would we bomb Iraq or any other so-called enemy? Would defense be our largest industry? Would we fail to sign environ-mental treaties at the Earth Summit? Would we allow thousands of Africans to die of starvation? Would we walk by the homeless in our streets? Would we allow violence and sex to dominate our television and movie screens? Would we let money rule our lives and rob our souls? Someone must stand up and say that t.he emperor has no clothes. Emperors, whether in the church or in society, do not like being reminded of their nakedness, and so we can expect to be condemned and criticized. Do we expect that we his servants should not suffer as Christ, our master, has suffered all these things for our sakes? Let me tell you of a friend of mine in Zimbabwe, Father Michael Lapsley. He is an Anglican priest from New Zealand who has spend all of his adult life condemning the sin of apartheid in South Africa. He was deported from South Africa and from Lesotho. Then two years ago in Harare he opened a package that had come to him from South Africa. It was a letter bomb. It blew off both his hands and destroyed one of his eyes. When I went to see him in the hospital a few days after the bombing, he had two bandaged stumps where his hands had been and a gaping hole that had held his eye. If it had been me, I would rather have been dead. But Michael was cheerful, and he said, "The Boers took my hands and my eye, but they left me my most powerful weapon, my tongue. And with my tongue I will continue to denounce apartheid until the day I die." This is what it means to evangelize the world, to live as Christ did and in so doing to change the world. 198 Reviev; for Religious Evangelization Is Rooted in Prayer We cannot hope to lead such radical lives without the sup-port of prayer. Prayer will give us the courage to take risks, the wisdom to expose the lies of our society, and the strength to join the victims. My understanding of prayer, too, been changed by my expe-rience in Africa. The African leader and philosopher Leopold Senghor has said, "Faith here [in Africa] is as essential to the soul as is bi'ead, rice, or honey to the body. Africans' gift to humankind is their ability to.perceive the supernatural as something really natural--so to speak." Creation spirituality, then, is nothing new to the people of Africa. It is their cul-ture and their way of life. They do not dis-tinguish between the sacred and the secukir. God is perceived as being tru.ly present everywhere and in all things. So they respect other human beings as the temples of God, and they respect the earth and all its creatures as God's dwelling place. African spirituality is all-embracing; there is nothing outside its scope. During Zimbabwe's war of lib-eration, for instance, the traditional religious leaders set down rules of conduct for the freedom fighters. VChile these spiritual men and women who are prophets, healers, bringers of rain, and mediums between the living and the dead were not able to prevent the war, they were able to humanize it by forbidding the needless shedding of blood and the destruction of wildlife and vegetation. African religion thus played an important role in introducing spir-itual norms and values into the freedom struggle. A recent article about prayer from South Africa's Institute for Contextual Theology points out the surprising fact that Jesus had not been teaching his disciples how to pray. They had to ask him. The article explains that Jesus wanted his followers to experience prayer as a need rather than a duty, and notes that there is no commandment in the Bible which says, "Thou shalt pray." It goes on to explain that prayer is like eating and sleeping. Unless there is something wrong with us, we will all eventually feel the need for food and for sleep. The same is true of prayer. How we pray will vary with each person and with our situation. Prayer will give us the courage to take risks, the wisdom to expose the lies of our society, and the strength to join the victims. March-April 1993 199 McLaughlin ¯ Evangelization Africa has taught me to be still and listen to God speaking through all creation and through the people and events I encounter each day. It has taught me to take time for silent pr.ayer, as well as to join in religious celebrations of the people. I have learned to trust the action of God in my life and in other people, rather than trying to do everything myself. Conclusion Life, then, is a journey towards God and with God. Evangelization involves becoming aware of this presence of God in our lives and then sharing this knowledge with others. I believe that this awareness grows when we immerse ourselves in the real-ity of the poor, whether in Zimbabwe, New York, or New South Wales. Their suffering and their faith shatter our complacency, forcing us to question all our preconceptions and prejudices, turn-ing us upside down. We can either become cynical, hopeless, and bitter, or we can face our own powerlessness and grow in faith, hope, and trust in God. Steve Biko, the South African leader who was tortured and died in prison, once said that comfort and security are incom-patible with leadership. I would add that they are incompatible with religious life. We will rarely be turned upside down in the comfort and security of our middle-class convents, spending all our time looking inward at our own spiritual growth. When we come down from our balconies and go out to oth-ers, especially the outcasts and the most needy, we will come alive. It is prophetic just to take the poor seriously in this society where wealth, possessions, and power mean so much. I should add that as women we are also among the poor and the oppressed because we have so little power in our society and in our church. Making the voices of the poor heard in our churches, homes, and offices and in the corridors of power throughout this land can make a difference. I firmly believe that we religious women can turn this society upside down. Let us do it! 200 Review for Religious Questions for reflection and sharing: i. Reflect on some of the turning points in your own life. How were you turned upside down? 2. What do you think needs to be turned upside down in your present situation? 3. What do you think needs to be turned upside down in this society? 4. What action will you take to make at least one of these changes? A Daughter's Monologue with Her Mother You are my child now. Now, you are my child. You may raise your brows at my leaving, or close your eyes on approach, wanting more nearly to turn toward the wall, to shut out the world long since set aside; one you no longer speak to. I will make room for your mood; your darkness, delight. You are my child now; who shall I name you ? You are my child now. There's no wanting in you but ¯ merits my care. You can wear soft hair in brhiding or turned in a bun. Neither will burnish my love nor undo it. Rest quietly, then, macushla. You can't disappoint me. Just who you are is my best expectation. You are my child now; I am the mother. Ann Maureen Gallagher IHM March-April 1993 201 MARIO I. AGUILAR Broken African Pots and a Mission Spirituality MwisSionary work in Africa has for years been associated ith lonely and courageous missionaries, single indi-viduals or very small communities of religious and lay people who have preached the gospel on the African continent in very diffi-cult circumstances. While the former facts are true in some way, in this article I want to look at the particular experience of a group of religious women and men working in Garba Tulla, Kenya, and their own sense of achievement and failure. Although this case is a very localized one, it opens the way to another understanding of missionary spirituality and, I would say, missionary work. I kvill focus, not on missionary strategies--that would constitute mate-rial for missiological studies--but on African pottery. I believe it can help to illustrate a spirituality for mission. In this article I assert that spiritual fulfillment, failure, and possible despair in missionary work are directly related to our own expectations coming from our own sense of achievement and self-understanding. The particular goals and expectations that missionaries arrive with permeate their sense of fulfillment and failurein their missionary work. What one person considers to be success and fulfillment can seem to be failure and reason for despair to somebody else. For this reason I suggest that the African way of making pottery could help us discover God's pres- Mario I. Aguilar SVD has taught Scripture and religious studies in Kenya and anthropology at the University of Vienna. His present address is: School of Oriental and African Studies; Department of Anthropology; Thornhaugh St. Russell Square; London WC1H 0XG; England. 202 Revie~ for Religious ence in different cultures--something I would consider the final goal in missionary work and in our own search for a spirituality of mission. On the other hand, there is this about African pottery: it involves making, breaking, and remaking pots. It is a constant process, one which never ends. Garba Tulla Parish: A Case Study The parish of the Good Shepherd (Parokia Tissitu Dansa) of Garba Tulla is located in the Isiolo deanery of the diocese of Meru, Eastern Kenya. The parish as such was created in 1987, after years of being an outstation of the Isiolo parish and then a so-called Catholic mission. By most people it is still considered the Garba Tulla Catholic Mission. Located in a semidesert area and in the middle of Garba Tulla town, it has a very short history as a so-called missionary presence among th~ Boorana people of the area. From the late 1970s, priests from the Isiolo parish (120 kilo-meters away) had gone to Garba Tulla, mainly on weekends, in order to celebrate the Eucharist with the Catholics who worked in the area. It cannot be denied that their missionary presence was oriented towards the conversion of the Muslim Boorana towards Christianity and specifically towards the Catholic Church.' In 1985 one priest and two brothers established their resi-dence for the first time at the Catholic Mission in Garba Tulla, but my case study begins in 1986, when a group of religious sisters joined the men religious who had been working in the area. At that time the missionary personnel working in Garba Tulla started considering themselves a team, a mission team of religious rather than a number of individuals working in the area. In a deanery where most of the priests come from diocesan backgrounds, this missionary team of religious constituted a novelty. Regarding a missionary strategy, the team went through stages of understanding their presence and work in the area. During the first stage, 1986-1987, the team moved towards being a Christian presence among the people, i3ut with the spiritual goal of fulfill-ment through the conversion of Muslims to the gospel. Their sense of spiritual fulfillment in mission came from the fact of their presence there and from the hopeful possibility that some Muslims would eventually believe in the gospel. New enterprises and new expectations, especially for a team Marcb-~lt~il 1993 203 Aguilar ¯ Broken African Pots Each one of the religious on the team felt that his or her spiritual fulfillment depended on the implementation of a particular model of mission. which had just arrived in the area, provided a time of search for strategies and for a religious spirituality that stressed God's dia-logue with his people, but also stressed the need people have for Christ as the ultimate revelation of God. That was expressed in the creation of many projects of development and in efforts to form a praying community among the team, because of the lack of Christians from the Boorana people of Garba Tulla themselves. The team comprised seven people, who came from seven different countries--a nat-ural richness, one would say. Nevertheless, it created a deep crisis of purpose, because of the different understandings of mission work present among members of the team. By 1987 the leader of the team was changed under difficult circumstances, and a search for a new purpose began once again. There was a new sense of searching for fulfillment after the damage caused by the team's fail-ures of communication and understanding had somehow been repaired. (I believe that those scars will never be healed completely.) The spiritual failure felt by the team was ¯ explained as part of the problem of having a team with individuals of different nationalities and therefore with different models of mission. There were ethnocentric tones to the problem as well; people failed to understand one another's attitudes. Nevertheless, I would say that, by itself, the variety of spiritualities present in the team caused enough internal tensions for a complete breakdown in communication and cooperation. Each one of the religious on the team felt at one point or another that his or her spiritual fulfillment depended on the implementa-tion of a particular model of mission. New attempts to unite the team around a particular model of mission work have in reality also failed, even as new leaders in the team have moved to a second stage, dialogue with the Muslim community, and a third stage, the strengthening of the parish. Those two attempts provided a complete change from the above-mentioned first stage, which was concerned with the actual con-version of the Muslim community towards Christianity. This case could sound like a very familiar story among reli- 204 Review for Religious gious, but to me it posed many questions regarding spiritual ful-fillment, acceptance, failure, and even despair in missionary work. The result of that time of tension was a new beginning, a new search. Years later the team is still searching for answers. Years later different nationalities are still trying to understand what went wrong with those religious at that time, and the scars are still present. As a member of the team which followed the 1987 crisis, I asked myself many times if what actually went wrong was con-nected, not to mission strategies, but rather to a very limited understanding of a spirituality for mission. That mission team ran out of their spiritual resources as religious because they failed to accept that personal fulfillment also requires failures and even despair at certain times of our lives. It is in this sense that I pro-pose that African pottery provides a model that fits our need for spiritual fulfillment and the presence of God in our lives. Success and Failure in an African Pot In 1992 I had the wonderful opportunity to sit surrounded by potters at a village of the Nkhoma mountains in Malawi. The potters were women who belong to the Chewa people. I was acquainted with the art of pottery in my home country, Chile, and also as a religious I had explored the possibility of prayer involving the use of clay and pottery, with very limited results. But now I felt the need to relate a spirituality for mission, based on my experience in Kenya, to the feelings and events of those days spent under the sun in the mountains of Malawi. Among the Chewa people, women produce pottery while men weave mats. A group of women sit in front of a house, surrounded by their children. Usually one woman has learned the techniques of pottery from another village and teaches the others. The clay is prepared by being pounded in a mortar so as to eliminate impu-rities. Pottery making begins when the woman takes a lump of clay and proceeds to pick out of it the hard little pieces that are still present and would cause problems as the clay is molded. The complete process is simple and at the same time elaborate; skill comes only with practice. The more pots you make, the more skilled you become. The clay is pounded with the palms of both hands till it becomes like a flat plate. Then it is slapped at the sides, till the March-April 1993 205 Aguilar ¯ Broken African Pots A broken pot is never thrown away; it becomes an important part of the process of making new pots. actual form of a vessel begins to appear. This is done with round movements of the hands, with the clay in the air. The shoulders give a certain rhythm to this hard process. A lot of strength is required to shape the clay, and what looks like easy work---and fun, too, in a way--is really hard physical work. The potter's hands become hard and dirty. (A skillful potter can make six or seven new pots in a morning's work.) Finally the pot begins to take shape, and what was a piece of clay looks like a new creation. The whole activity of pottery making is witnessed by a group of the village com-munity. Small girls try their luck at pot-tery making. They mold smaller pieces of clay into small pots, their own contribu-tion to village life and a particular com-munity activity. Less-skilled women who are still learning the potter's art are helped regularly by those who have more experi-ence and skill. The whole activity becomes a community activity, in which individu-als are not ashamed of being helped in their process of pottery making. Individual women are encouraged by others with the phrases "Press harder, . Push the clay up," "Make sure both of your hands are molding the clay," and so forth. There is a constant concern for each other. At the proper moment the new, shaped piece of clay is placed on pieces of broken pots that have been spread out on the ground. Those pieces come from pots which broke while being fired or broke while being used for cooking on the family fire. Broken pots, therefore, are still useful for the community in their cre-ative activity. A broken pot is never thrown away; it becomes an important part of the process of making new pots. Broken pots symbolize the continuity of a particular village, where new pots could not be made and would not exist without the contribution made by those broken pots. The past of a people is symbolized by the broken pots, which become part of a present and provide con-tinuity for the future of a people who need to be fed in order to have a future. In the pottery process the potters constandy apply water to the 206 Review for Religious clay while they shape it. The broken pots and the water both con-tribute to the making of new pots. The clay placed on the broken pieces of pottery lies at arms' length in front of the potter as she sits spread-legged on the grtund. When one asks the women why they work this way, they simply say it l~as always been like this. For my part, I am reminded of the act of giving birth. Just in front of the womb, a new creation is b.eing shaped and brought to "life." The process is like giving birth, I could not help thinking how distant, by contrast, from the work of their hands first-world potters appear to be, while in the African villages there is a close union between the potter and her creation, the new pot, nourishment and new life for her own village and community. A piece of wood is used to shape the sides of the pot. The bottom of the pot is shaped with a knife. The inside is cleared of any extra superfluous clay, and the pot is left to dry in the sun-- except during October, when the pots are shaded from the very strong sun of that time of year. After the clay has dried some-what, the pot is smoothed with a stone and decorated and is then ready for firing. Mthough the potter may modify the traditional line-and-dot patterns of decoration, there is a tendency.towards a good deal of continuity. When a woman ig learning pottery, she is taught how the lines and dots are "supposed to be." The process of firing the pots, which takes place some days later, provides a very interesting sight. The pots are lined up and covered.with leaves and branches, Thes~ are then set on fire. The whole community sit~ around the fire and watches as a few women take care of it. There is~ a great sense of expectation as the proc.ess goes on. Some pots will break. Others will come through in good shape and will be ready ftr the final decorations made with some roots~ while the pots are still hot. The "paint" for the decorations (red and black) is provided by local roots which the commufiity also associates with initiation and maturation.' When I was present for the first time, only one pot out of ten broke during the firing process--considered a real success by the community. Usually more pots break. Following the firing of the pots, the whole community cele-brates the event with a meal. After all, the community itself will store and cook their food in those pots and will also generate some income when they sell some of the pots at the local market. March-April 199~ 207 Aguilar ¯ Broken African Pots Not every region produces pots, for the right kind of soil is pres-ent only in the dry areas of the Nldaoma mountains. Wonderfully, the dry soil of arid mountains is the means of feeding these com-munities and thus sustaining life. Creating and Breaking Pots in Mission Work It seems to me that when one talks about potters and pottery, one assumes (as in Jeremiah 18:1-6) that God is the potter and we are those pots of clay that he is molding. What would happen if we consider ourselves the potters and that the clay symbolizes the cultures and peoples we are trying to evangelize, such as the Boorana of Garba Tulla, Kenya? When a mission community moves in and establishes itself, a particular group of people encounters another particular group of people. Each group has its own culture. The so-called "mission-aries" have the idea of forming a Christian community with the other group. Their effort can be compared to the making of pots, for that process, too, is culturally shaped, and people's expectations derive from tradition. Without excluding the possibility of lay people being mis-sionaries and therefore "makers of pots," I will explore these con-cepts with reference to Garba Tulla and its particular makers of pots and the particular missionary community in the parish of the Good Shepherd. The potters involved here came from different cultures. They all had experience of pottery making, and all of them recognized that it could be done only in a particular, culturally constructed way. Pottery making as the creation, subsistence, and growth of a Christian community required a certain experience and a certain risk. All those missionary religious had already experienced mis-. sionary work in other cultures and had brought with them whole bundles of assumed knowledge and expectations. Because of those past experiences, the process of learning pottery making in the Garba Tulla context was already shaped by their backgrounds. There were no teachers involved in this pottery making. Each one just did as he or she knew best. The clay had been prepared by the Italian missionaries who had lived among the Boorana before. When the new potters took over, there was no period of preparation, and the process of mak-ing the pot began immediately. The pot had to be shaped accord- 208 Review for Religious ing to the potters' expectations, and everyone's expectations were different. Although fulfillment, success, and failure can be assumed in the community of African women making pottery, there was no sense of one community of pot-ters among those missionaries. The making of pots was being done individually; different pot-tery techniques were being used. While it is true that a pot is a pot and not something else, the same word when used by different peo-ple evokes different images, shapes, and colors. And so, with-out some discussion and planning and some exchange and dialogue concerning the matter, there is no way to know somebody else's ideas about the making of pots-- or the making of a Christian community. While a pot is being made, much cooperation is needed. People offer each other valuable suggestions about the shape and consistency of a pot. The water needed for making the pots needs to be shared cooperatively. But for both potters and missioners, the process of firing a pot is the crucial moment of. fulfillment or failure. Without some discussion and planning and some exchange and dialogue concerning the matter, there is no way to know somebody else's ideas about the making of pots-- or the making of a Christian community. Towards a Spirituality of Broken Pots The pots need to be fired in order to be ready for use. In fir-ing, the makers of pots learn how successful their work has been. After the ashes are cleared, some of the pots will be found broken and later find themselves part of a new effort to make pottery. The time when the community witnesses the firing of pots is a very exciting time. A whole community effo]'t is being judged and evaluated. Our Western attitude looks almost exclusively at the result: if the pots that have broken amount to none or only a few, then the whole exercise has been a great success. If the bro-ken pots are numerous, then the whole community exercise is a disaster. March-April 1993 209 Aguilar ¯ Broken African Pots Even if all the pots break and there is none left, they still rejoice because they have exercised a community moment, they have strengthened their common effort to keep their community fed. The African attitude toward such evaluations is completely different, and it hassomething to contribute to a missionary spir-ituality. Very few times in their lives hive the potters seen no broken pots after the firing. Even when a great number of pots breaks, they rejoice in the sturdy few that will increase the num-ber of cooking pots or the income of their community. Even if all the pots break and there is none left, they still rejoice because theyhave exercised a community moment, they have s.trengthened .their common effort to keep their community fed. If the number of new pots is none, they still have the broken pots, which are needed for the making of new ones. With these thoughts in mind, I consider no missionary effort ever to be in vain; any attempt at community life and at preaching the gospel through that community life cannot be in vain. Even the¯ so-called "fhil-ure" of the religious missionary team in Garba Tulla at a particular time, has aided new attempts to proclaim the gospel among the Boorana peo-ple. Through the life of those reli-gious, broken pots have become new pots once again. New expectations have arisen, and new people have arrived. Once again some individuals have disagreed with one another, but new expec-tations l~ave been created. Some will become'broken pots, others goo.d pots, but they will all eventually be part of each other. If'one looks at success and fulfillment and at failure and frus-tration in mission work, one realizes that the fulfillment or frus-tration among religious does not come from the visible or measurable results, but from the attitude towards those events. The sense of expectation and purpose in a religious community is the guide to the true meaning of fulfillment or frustration in mis-sionary work. Of those religious who served in Garba Tulla dur-ing that time of "crisis," some would consider that period a failure because the objectives of the planned mission work were not real-ized. Others, instead, would see tl~at period as a fulfilling and 210 Review for "Religiom. gratifying one because they provided it the much-needed experi-ence of learning how to cooperate on an international religious team. Success and failure among religious men and women can-not be evaluated in a simple empirical way, as in the business world, but they coincide with our own attitude towards the whole process of preparation for that particular time in our lives and towards the spiritual fruits which can appear during that time and afterwards. Further Points for Reflection. The lessons for a spirituality for mission based on the process of molding and firing pottery can be summarized in the follow-ing points: ¯ The whole process calls for an openness to the Spirit so as to recognize the whole process as already a "success." ¯ We need to accept that we are always learning and that oth-ers are also learning. The whole process of going through a learn-ing period in our lives is also a success. Hopefully that process of learning will never end. ¯ Pottery cannot be properly made by one person; it has to be a community effort, because we all need others to help us. Religious doing missionary work also need others in order to bear fruit and make new beautiful pots. ¯ Different people have learned pottery from different teach-ers and designs from different regions and villages. The beauty of it lies in its diversity. The success in our process of learning pot-tery comes from the realization that a proper diversity brings beauty and opportunities for exchange and dialogue. When reli-gious come from different countries and different cultures, they also experience success if they are able to recognize and appreci-ate the beauty of their diversity. ¯ The pot of water that is shared by the potters is needed for the flow of moisture in the making of pots. That water is passed around when somebody realizes that somebody else is in need: the other person's pot is also my concern. Success in missionary work begins when one realizes that all persons, including even oneself, need water at one point or another. The fact of caring for one another's project is already a success in life. ¯ The broken pots become important because they symbolize the continuity of a group of people, of a community. They are March-April 1993 211 Aguilar ¯ Broken African Pots used in a new effort to make pots for the community, for the stor-ing and preparing of food for the life of the community. The bro-ken pots become more important than the good pots because the pots that turn out fine after firing will eventually be sold to mem-bers of another community. The broken pots provide continuity of life that the village community needs. Maybe a spirituality for mission could be called a spirituality of broken pots: the more pots we break, the more successful we are, for we have experienced the past and present community pulling together, and we have recognized the need for others if we are to be successful. A spirituality of broken pots would recognize the need to accept that we cannot fully control the firing pro-cess. Whatever we do, some pots may end up broken, and so there is the possibility of trying again. Other pots may turn out well and then, in one way or another, will help the community to serve other people, even other potters, and people in other villages. The broken pots retain their unique importance because they provide the foundation for a new making of pots and thus for the food and life of the community. I feel that a spirituality for mis-sion should be a spirituality of broken pots--and that a spiritual-ity of broken pots always creates success, as Jeremiah shows: "So I went down to the potter's house; and there he was, working at the wheel. And whenever the vessel he was making came out wrong, as happens with the clay handled by potters, he would start afresh and work it into another vessel, as potters do." Note 1 See M.I. Aguilar, "Nagaa: Centro de Encuentro con el Islam," Chile Misionero, 9 (1992), and "Dialogue with Boorana Religion: A Path of the Gospel in Garba Tulla, Eastern Kenya," The Seed (Nairobi), October 1992. Review for Religious MICHAEL D. MOGA A Spirituality of Aging In life we are confronted with many spiritualities and are frequently forced to make a choice among them. There is the spirituality dis6nctive of a diocesan priest and there are many spiritualities of religious life. The spirituality of a contemplative religious is quite different from that of a religious engaged in the active apostolate. The spiritual-ities offered by oriental religions differ from those of Western religions. The theme of this paper is simple: the spirituality for an older person is quite different from the spirituality for a younger person. As we grow older the Spirit of God leads us through certain approaches and principles that are distinctive to the particular period of life in which we find ourselves. Human life is constantly changing and we are chal-lenged to move with those changes. We move through the stages of childhood and maturity into old age which demand that we leave behind one way of living to face life in a new and different way. The adjustments are difficult and may take many years to accomplish. The change from maturity to old age challenges us once again to leave something behind and to adjust to a new situation of life. Like the passage from childhood to maturity this new change presents us with a difficult Michael D. Moga SJ has taught philosophy in various seminar-ies and colleges in Mindanao. His address is Xavier University; Cagayan de Oro City; Philippines. aging christ March-April 1993 213 Moga ¯ A Spirituality of Aging adjustment which will demand a great deal of effort and pain before it is fully accomplished. I find it strange that a rather long portion of time and edu-cation (as much as 40-45 years) can be set aside to prepare a per-son for adult life whereas little or no attention or time is devoted to planning for one's final phase of life (which can sometimes last as long as 25 or 30 years)! In our early training as religious we were presented with a certain spirituality that for the most part fitted the life of a young person. It emphasized generosity ("to give and not to count the cost"), high ideals (working for "the greater glory of God"), and commitment. This spirituality was exemplified in a saint like Francis Xavier who lived a life of generous commitment until his early death at 46. He did not live long enough to face the need to change his spirituality. A spirituality for an aging religious must, of necessity, be quite different. I suggest that John the Baptist, who said: "He must increase and I must decrease," would be a fine model. John saw that his disciples were leaving him and following Jesus. He sensed that his basic work was completed and his role in God's plan had been fulfilled. He accepted all of this. He did not try to hold on to his disciples nor did he need to continue his previous work of preparing for the Messiah. He stepped back and let Jesus pro-claim his message, trusting that God was working through Jesus and through others. In a spirit of trust he lived his statement: "He must increase and I must decrease." Aging religious find themselves in the situation of John the Baptist. As they grow older many things are taken from them. As they diminish in body, mind, and spirit their influence in the world around them is lessened, and they are called upon to find God in these losses. Instead of emphasizing generosity as they did as a young religious, they are called to accept these dimin-ishments and even to rejoice in them. The total commitment to apostolic work of the young religious is set aside. Instead of giv-ing themselves more fully to apostolic involvement, aging reli-gious are called to withdraw from such involvements. Above all they are called to trust, to believe that as they decrease, Jesus increases. They are called to trust that their diminishment is part of God's way of furthering the kingdom. A spirituality of aging can take many different forms. Let me present a few of them. 214 Review for Religious 1. The spirituality of an old person should include a serious preparation for death. Death is not simply something that happens to us. It is one of the most important actions of our lives, for in death we go back to God. Such an important movement of our lives should be given due attention and concern. Just as in our younger lives we took the choice of our careers very seriously, so is death a similar crucial moment which deserves to be treated with similar seriousness and to be prepared for. The period of aging has been given to us by God as a time of intense preparation for death. It would be a mistake to be so busy with our work and other affairs that we give no time, thought, or effort to this approaching event in our lives. We may want to die with our boots on but such an attitude may possibly manifest a lack of faith. We are, of course, called by God to do our share of the work of building the kingdom. But our faith affirms that we are called by God to pass beyond ~his world to live with him in an eternal kingdom. It would be wrong in our present lives to be so occupied with the "God of this world" that we ignore that "God of the future" and the life that he calls us to. One way that we prepare for death is to begin to put things aside. Since in death we will be forced to leave our involvements in this world, a preparation would be to step back from these involvements, to become less absorbed in our concern for the achievement of goals and the attainment of success. Nature aids such stepping back from involvements. For an aging person the world often becomes rather "tasteless." The process of aging may not only reduce the sensitivity of our taste buds but also diminish our hunger for the activities and concerns of the world around us. We can find ourselves not caring which basketball team is the champion this year, which songs are the most popular, or who is the most popular movie star. When we were young such things made a difference, but as we grow older we find ourselves losing touch with these "popular" concerns. The tendency to lose touch need not be conceived as a sad thing, a loss. It is clearly the way nature guides us to turn away from unimportant things and to focus our lives on what is more Aging religious find themselves in the situation of John the Baptist. March-April 1993 215 Moga ¯ ~1 Spirituality of Aging essential--on the death that is coming, on the God we are soon to meet. Thus as we prepare for death we are challenged to free ourselves from all that is unimportant in life. In our journey through life we easily let ourselves get caught up in concerns, possessions, and habitual ways of thinking and being. How won-derful it would be if the contemplation of death could make us truly "free" of all these petty things so that we might live for what is truly important. Preparing for ~something means that we focus on it. The preparation for death demands a positive focus on that meeting with God which is found in death. Preparing for death thus invites us to turn toward God and give ourselves directly to God. Older religious shbuld be freed from apostolic involvements precisely so that they might have more time for prayer, more time for God. Every year we prepare to meet God in our celebration of Advent. During Advent we join with the people of the Old Covenant in their "waiting for God." We also join with Mary as she waits for her child to be born. During Advent we Christians give our energies to "waiting," to living out our waiting in a full and complete way. The lives of aging religious can embody this spirit of Advent and be filled with a "waiting for God." 2. A challenge to accept. One major characteristic of a spiritu-ality of aging is its emphasis on a person's acceptance of dimin-ishment. As we grow older various things are taken from us. There is a basic lessening of energies as we grow older. Vision and hear-ing begin to deteriorate. Health fails as we encounter various ill-nesses and pains. Control over one

The Mercury January, 1894 ADVERTISEMENTS. IRailroab "The "Royal "Route" New and Direct Line To and From QETTYSBURQ. Fast, Frequent and Superbly. Equipped Train Service Between NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Barber Sfy°P> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK, K& /Wat* C°ff£SS and /ViUgrc arjd ^v-fc £or)S£r«VatOr° REPAIRING PROMPTLY DONE. ADVERTISEMENTS. Irving College, For LJoung Ladies. A Lutheran School for Lutheran girls. Chartered 1856. Confers degrees of A. B., and M. E. L. Experienced Fac-ulty. French and German spoken. Music—full conserva-tory course—piano, organ, pipe organ, violin, guitar, voice. Specialist in elocution and physical culture. Fine brick building, splendidly furnished, steam heat. Pupils carefully drilled sociably. Course high, thorough. Twenty minutes' ride from Harrisburg. Art a specialty. The only Lutheran school for girls in Pennsylvania. Synchronized time. Elec-tric bells. Send for catalogue. PROF. E. E. CAMPBELL, A. M.,- President, Mechanicsburg, Pa. F. WEBEK & CO. Drawing: Materials and $p: Drawing Instruments DRAWING PAPER, PENCILS, &C. A LARGE ASSORTMENT OF DRAWING MATERIALS OF ALL KINDS. J. WOODFIN MINIFIE, Manager, No. 5 NORTH CHARLES ST., BALTIMORE, MD. Special Attention to Orders by Mail. Main Office, 1125 Chestnut St., Philadelphia. # {|attepg> * and ||?ei?'§ fupni§bei®§, "@K® TRUNKS, LEATHER GOODS, AND VALISES, 12 W. MARKET ST., YORK, PA. Special Attention to Mail Orders. H. S. Benner, Choice Family Groceries,, Chambcrsburg St., Gettysburg, Pa. Coffees, Teas, Flour, Fish, and Canned Goods. Queensware, Glassware, Etc. PITZER HOUSE. A temperance house. Pleasant and home-like. Teams and Guides to all points of interest on the battle-field. REASONABLE RATES. 127Chambersbarg St.,Gettysburg, Pa. JOHN E. PITZER. MEMBER POST 9, G. A. R. J. W. EIGHOLTZ & GO., DEALERS IN PIANOS, OP.GAJiS, IWTJSIC, STfWlGS, Ete. 12 BALTIMORE ST., GETTYSBURG, PA. SAJWUELi FABEP,, ~&Fine Cigars & Smokers' Mieles**- CHAMBERSBURG ST., GETTYSBURG. J. H. MYERS, Fashionable Tailor, Clothier1 —AND— [fenf^' Fufnighbi1. You alutays find the liatest Styles tov Gents' OUardrobes. No. 11 BALTIMORE STREET, GETTYSBURG, PA. ADVERTISEMENTS. in College pvises Society Babges fliri3e flfoebals Stationery The most successful designers of College and University Badges in the Country Estimates Designs on Applieation BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, "Pa. ,Hary had a Little Lamb, (Stam? your Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for SI 5.00 you know. These Cuitorn-Made Suits are popular throughout America— because they represent the very Quintessence of Nobby Dress, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, staling kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Ealti more cheapest market. KEELER the largest custom producer. Full Dress Suits Trousers, - - Frock Suits, - Overcoats, - > JOnN M. KEELER, 5 N. Calvert St. Baltimore, Hd. "Suffer no longer the extortions of loc*-l tailors ' $25.00 Up. S4.00 Up. $18.00 Up $18.00 Up. Correspondence Solicited With Responsible Parties Desiring to Act as Agents. THUTH WEflflS JO ]HSK Because it needs none. It bows at no human shrine, seeks neither place nor applause; it only asks a hearing, and so, too, do we. Our immense Fall and Winter stock is full of rare and choice bargains. Stylish Men's Suits and Overcoats at $IO, $12, $15, $20. We'll buy them back if you don't like them. Sole agents for Youman Silk and Derby Hats. Oehm's Acme Hall, CLOTHIERS, HATTERS, FURNISHERS BALTO AND CHARLES STS., Baltimore, Md. WILLIAM SMALL, DLM D0OK tlnHEK AND DOORMm 6 WEST MARKET STREET, YORK, PENNA. IV ADVERTISEMENTS. F. D. SCHRIVER, Draper, Importer, • A^D JVterehant Tailor, 23 Baltimore Street GETTYSBURG, PA. GETTYSBURG COLLEGE FOOT-BALL TEAM, SEASON OF 1893. k The College Mercury. Vol. I. Gettysburg, Pa., January, 1894. No. 9. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor : FRED H. BLOOMHARDT, '94. Associate Editors : FRANK E. FICKINGER,'94. ORVILLE L. SIGAFOOS,'94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL W. KOLLER, '94. ROSCOE C. WRIGHT, '95. WILMER A. HARTMAN, '95. Alumni Association Editor: D. FRANK GARLAND, Baltimore, Md. Business Manager ; BENJAMIN R. LANTZ, '94. Assistant Business Manager: CHARLES F. KLOSS, '94. TERMS • /One volume (ten months), . . . . $1.00 ' \ Single copies, 15 Payable in Advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. eOMTE/STS. EDITORIALS, ; 139 GRADUATE LIFE AT JOHNS HOPKINS UNIVERSITY, . 140 CONVERSATION, '. . 142 THE MUSICAL CLUB'S TRIP, 144 THE TRUSTEES MEET, 145 COLLEGE LOCALS, 146 ALUMNI, 149 FRATERNITY NOTES, 151 ATHLETICS, 152 TOWN AND SEMINARY, 153 LITERARY SOCIETIES 154 EBITO-RIAL. A HAPPY NEW YEAR TO ALL. \I7ITH this issue, THE MERCURY appears with two changes in its Board of Edi-tors. It is, indeed, very unfortunate that the efficient Editor was compelled to resign on ac-count of ill-health and pressure of work. But since such is the case, it will be the purpose of the reconstructed Staff to do their utmost to make the " Students' Paper " as attractive and entertaining as possible. These, of course, are not the only essentials of a good journal, but they help to secure attention for the weightier material. The supplement to this number is an engraving of the victorious foot-ball team of the season of '93, which doubtless will be highly prized by THE MERCURY readers. * * * /"^HRISTMAS vacation, the happiest time ^-^ in a college man's life, is over, and work has taken the place of two weeks' enjoyment. In view of the " good time " that most of the students have had, it is not surprising that many of the recitations are wearing a kind of holiday attire. In a few days, however, things will have drifted back to their accustomed channels. * JUDGING from our exchanges, it would be ^ supposed that the " proverbial waste-basket" of the editors has not been filled to overflowing by productions of the students. College men should consider it an honor to have their thoughts find place in their journals. There should be an active competition for the space given to these articles. Then the standard of the paper would be raised and his 140 THE COLLEGE MERCURY. own powers would receive such benefit as he cannot receive from any other branch of college work. * * T/ NOWING well that an attractive Annual A^- is of much benefit and credit to our col-lege, The Spectrum Staff have decided to en-large their book. This will make the cost much more than formerly. In order to make it a financial success, it must have the support of the students and Alumni. It is hoped that any one who desires to aid in this work, either by subscription or by an advertisement, will communicate with the business manager, Mr. H. M. Witman, Gettysburg, Pa. * * COOT-BALL, CHANGE IN RULES.—It is now proposed by three of the larger college teams to change the rules of foot-ball. The proposition is to make a decided change, so as to eliminate some of the features which have proved themselves dangerous to the safety of the players and prevent such " acci-dents " as have recently occurred. Yale, Har-vard, and Princeton are announced to begin the work, and it is supposed that this move-ment will meet with approval everywhere. If " rough play " and " interference " could be eliminated, the game would certainly be very much improved, and there would be no need for Synodical or Conference objection to the game. We trust it will be done speedily, so that the almost brutalizing methods employed, which lead to death in many cases, will be entirely forbidden. We hail this movement with joy. We are thoroughly in sympathy with inter-collegiate games, and think they are helpful to the institutions and the students, but deplore the present methods employed, which certainly do endanger life and limb. The Alumni of the college rejoice in the many victories gained for our Alma Mater in the re-cent campaign, and are delighted with the gentlemanly deportment of the team in the contests. '"TO THE ALUMNI.—This paper is for you as * well as for the students of the college. It comes to you in the interests of the institu-tion you love. It is, therefore, in a sense your' paper, devoted to the advancement and growth .of Pennsylvania College, which is your col-lege above all others. Rally to its support. It is not published to make money for its edi-tors and managers. The accumulating gains, if there should be any, will accrue to the liter-ary societies in the. college. It is for them alone. They must be fostered and encour-aged in every way possible. Subscribing, therefore, for THE MERCURY will aid the two societies in a substantial way, and will bring to you every month the news of your college, fresh, interesting, helpful. Send in your sub-scriptions at once. We speak here as an Alumnus to the Alumni. G. GRADUATE LIFE AT JOHNS HOPKINS UNI-VERSITY. TN the busy round of undergraduate life in an American college, the student is often apt, in the struggle for a higher plane of men-tal activity, to forget the existence of a great sphere of thought and action far above and beyond his own little world. It is the world of workers, thinkers, revolu-tionizers, and the student fresh from the neces-sarily narrow fields of college work stands almost dismayed at the widening vistas which everywhere meet his view. Nor can one who has not dwelt in such a world and come under the thrilling influence of its great men and great thoughts altogether realize its peculiar charm. It is an arena of tireless activity, and once in the circle the student seldom looks behind with regretful longings for the easy life of col-lege days. To be sure such conditions are not frequently met with, but even in our own country there are a few institutions which present them in their entirety. Among such schools of ad- THE COLLEGE MERCURY. 141 V vanced work in America, perhaps none stands in a more conspicuous position or exerts a broader influence than the Johns Hopkins University. It approaches nearest to our ideal, the German Universities. Its Faculty contains some of the most prominent and inspiring men on this side of the Atlantic, and the men sent forth from its walls are exerting an influence worthy of their institution throughout our halls of learning. Surrounded by such influences and aroused by such examples of successful work, it will be interesting perhaps to look into the life of a graduate student and see wherein lies the secret of his success. It might be answered in a word—in hard work. He has ceased to deal with glittering generalities and beautiful theories, and is brought face to face with hard facts. He soon loses much of the inter-est he formerly took in non-pertinent subjects amid the engrossment of his life work and de-votes his best efforts to it alone. This may help to explain the sudden metamorphosis of the loiterer along the more flowery paths of learning into . the preoccupied thoughtful worker who is ready to face any obstacle, be it ever so rough and hard to surmount. It is his life work, and all else must fall aside and leave him ready for the struggle. It has ever been the aim of this university to send out fin-ished men, and in this the student is a willing co-worker, and, as,has been repeatedly said by those acquainted with the facts, American students of this class are harder students than the Germans themselves. Most especially is this true in those studies requiring laborious laboratory work. There are at present in the university more than two hundred and fifty post-graduate stu-dents who are divided among these subjects— Languages, History, and Politics, Physics, Mathemathics, and Astronomy, Chemistry and the Biological Sciences. These students may further be divided by the character of their work into the laboratory workers, which in-cludes all students of Pure Science, and into reading students, into which class those fol-lowing Languages and Historical subjects naturally fall, though it must not be understood that those engaged in laboratory work are not readers. Far from it. Their lamps burn the midnight oil most frequently. When the student enters the university he selects a principal subject or major and two allied subordinate subjects known as First and Second Minors. The Minor subjects occupy him, all told, about eight hours a week each for one year. The principal subjects under which the student is classified occupies him in general three years, and one of these must be devoted to original investigation in some new field of work, or old one it may be, whose bounds need widening. This work forms the subject of his thesis for the degree of Doctor of Philosophy. In some departments, there is a growing tendency to lengthen the course to four years. Should this be the final result the university will stand second to none in the excellence of its work. As I have said, in such work as this one begins to look at things as they are and not as they may appear at a casual glance. He goes to the fountain-head for his inspiration, and soon learns how others have worked, and to imitate their example. Each department has its own appropriate laboratory—using the word in the original sense—and its own library, where all the works of importance are collected, and all the journals and scientific magazines are constantly received. The chemical department alone receives about 15 publications, of which several come weekly and the rest monthly. Of these probably three are in our mother tongue, while the rest range through French, German, Italian, and Russian, with an occa-sional waif from the land of Japan, which, however, usually " blooms to blush unseen." Such a course of work is necessarily special-izing in its tendency, and, I had almost said, isolating. The student in Sciences begins lab-oratory work on Monday morning and never lays aside his apparatus till Friday night. 142 THE COLLEGE MERCURY. Of course he fags a little now and then, when the natural perversity of inanimate objects begins to assert itself, but the Doctor's de-gree, at the end of the race is a never-failing spur. Perhaps I have left the reader under the impression that a graduate student's life is all one weary grind. However, it has a few bright spots. There is a Graduate Students' Association, which holds monthly social gath-erings, where one can brush away the cobwebs from the neglected corners of his brain and learn what his fellow-workers are doing. There are, too, several clubs in the various departments, which, though actuated by the thirst for knowledge primarily, yet have a spice of good fellowship and sociability. Besides, there are the Journal Meetings and Semina-ries, where students can occasionally air their views in original papers. The Journal Meeting especially is an excel-lent factor in keeping us in touch with our own sphere of work. To read all the journals and sift out the wheat from the chaff which finds its way even into scientific papers—cut and dried as they may seem—is evidently a Herculean task, but by the Journal Meeting we have the important- papers presented in compact and generally interesting form, and are entertained and profited at once. An ideal method, surely. Of course we miss the jolly life of college clays, and probably we feel a little sick of the grind at first; but, like the Lotos Eaters, we soon forget the scene of our earlier efforts, when fed on the strong meat of higher thought. With us Time flies on rapid wings, and, though it seems but yesterday that we knocked timidly at the portals, already we are talking of our work with ill-concealed pride in having found another clue to the great labyrinth of Knowledge. We have tasted the waters of the Pierian spring and are ready to drink deeply. R. N. H.,'91. CONVERSATION. T F there is one thing to learn at college, it is to do critical, independent study and think-ing. "A man kens just as much as he's taught himsel', and na mair." A man's mind should become inquiring, desirous of knowing the reason for everything, accepting statements after diligent inquiry only. Yet, although we recommend independent thought, it must be remembered to examine a subject from every standpoint. No man has concentrated within himself all thought upon any question. No matter how learned he may be, there is always room to acquire more, and he can always obtain something from others. There is a want felt by a number of our students who are eager in the pursuit of knowledge, viz.: the need of conversation, as distinguished from talk. Conversation turns upon affairs of higher interest, is more serious, more intellectual, and brings forth and de-velops one's innate powers and acquirements. It is often complained that we have too much serious matter in our studies to converse with interest upon topics of worth. But the true student is always interested in his work, and one finds no trouble in conversing upon a subject interesting to him. But, outside of his studies, there is always something in which one delights, and which would be profitable and pleasing to others; certainly we could relish conversation upon some worthy topic much better than this fragmentary talk upon matters so trivial that it becomes a burden to listen. Life is a race. In the business world men are earnestly active, pursuing their plans with unceasing energy. It is true that our school days are our happy days, the days of pleasure, yet pleasure is not incompatible with diligent study. All men of power have been earnest students. At school their thoughts were high and noble, due to the purposed career before them for which they prepared themselves with unswerving fidelity. In youth are laid the THE COLLEGE MERCURY. H3 foundations of the future life. Ruskin objects to hearing the' follies of youth talked of " indulgently." " Then," he says, " must the habits of thought be begun." Therefore, we find the ambitious student sincere and earnest in his work. He is here to learn, he feels that he needs every moment to add to his development, his mind is ever open to the reception of truth and eagerly seeking it. He profits by everything of value that he hears; trivial matters do not interest him, nor those who deal in them. " Talkers," says Bacon, " are commonly vain and credu-lous withal ; for he that talkctli what he knoweth, will also talk what he knoweth not." He will choose companions with the same high aims as himself, for he receives little sympathy or encouragement from others. The selection of friends is a duty of the most important interest to us. We all need friends, those whom we know intimately, and who know us, and who can be mutual aids to each other. Before we can admit any one into our life as a friend, we must know something of him, his disposition, in what he is interested. He must be made to know us, and this can be done by our life and conversation only. It is strange how often we are acquainted with persons for years, sometimes even live with them, and yet know little of them, often look upon them as inferior, till some extended conversation reveals hidden thoughts and beauties of which we never dreamed. At college, particularly, should such friendships be formed, for they are generally the most enduring. We are told repeatedly to cultivate the ac-quaintance of men superior to ourselves, to be filled with their thoughts, to catch their spirit, to receive the benefit of their molding power upon our lives. A man grows stronger in proportion as he grapples with questions and strives for objects just a little in ad-vance of him. So the acquaintance of men superior to ourselves elevates our standard of excellence and instills the ambition to attain to it. Young men go to our universities to come into contact with the great minds of the age, but better yet is it to cultivate the friendship of fellow-students superior to ourselves. The greatest of Greek philosophers said that there are ideas in every man, thoughts latent, of which he himself is absolutely ignorant, and that he who can draw these forth confers an inestimable benefit, and is profited himself. No one can do this so well as a companion with kindred ideas and filled with the same desire to learn. The human mind is closed to most truths, and remains in total ignorance of them till opened by some agency. We are aiming at the fullest development and widest expansion of the mind; for this a plentiful introduction of ideas is necessary. Study and reading partly supply these, but what and how to study and read ? And even then we do not sap a subject thoroughly. Everything looks a little different when passed through the prism of other minds, and the suggestions of others are continually opening to us new fields of thought and inquiry. It is impossible to travel over the entire field of human knowledge; all that a man can do to-day is to specialize, yet considerable can be learned in almost every department if properly sought. He is wise who in his daily contact with his fellows extracts from each the gist of what he has learned, perhaps, by severe study. Much ground must be traversed to acquire a few truths which can be learned in a short conversation. How often in our classes a student is asked his opinion upon a certain point, and cannot give any. True, to give an intelligent opinion upon any subject requires a thoughtful and dili-gent study of it, yet, with our limited knowl-edge, if before recitations the points in the lessons were discussed and conclusions drawn, we feel sure that not only when asked for an opinion would it be forthcoming, but a good habit also would be formed. Wherever we may go among young men, it 144 THE COLLEGE MERCURY. seems necessary to become acquainted with the slang expressions in use among them. Fortunately, we need not form friendships with them. We believe that all lovers of good English concur in the wish that the aesthetic nature of man be cultivated. Slang is so habitual with a great many of our young men that it is difficult for them to find expression in good English. Conversation upon interest-ing and important topics, we believe, would accomplish this if entered upon for the pur-pose of mutual benefit. Do not fear, either, to use big words if they express the thought exactly. Men with little ideas may use little words habitually. " Conversation maketh a ready man." No power is of any value unless it can be used. We are not disciplining our minds to make them mere reservoirs for the reception of knowledge, but we want to use them. The ability upon occasion to call to mind whatever we may have learned, and which is possessed by few, is well worth striving after. Telling something we know, too, makes it sink still more deeply in our memories. Good manners, it is claimed, will serve as an introduction to the best society everywhere. This is certainly to be desired. But the kernel of good manners is a good heart, and their adornment, a cultivated mind united with en-gaging conversation. Brilliant conversation of itself, no matter how unprepossessing may be one's appearance will attract and make friends. " People used to say that they never knew what conversation could be till they had heard Carlyle, seated at his table with his pipe." Mirabeau, although rough and brutish in ap-pearance, charmed every one with his brilliant conversation and was passionately admired, particularly by the women. We have spoken only of the value of con-versation to ourselves ; its influence upon oth-ers is without limit. For these and many other reasons which might be given, we think that the art of conversation should be culti-vated. A. F. G. '97. THE MUSICAL CLUB'S TRIP. /^N Friday, December 8th, the Glee, Banjo, ^^ and Mandolin Clubs of the College filled their first engagement outside of Gettys-burg at Westminster, Md. The Club left the Western Maryland depot on Friday morning in a special car gayly decorated with college colors and banners. Although crippled to some extent by the absence and sickness of some of their members, they felt not the slightest hesitation after the success of their entertainment given in Brua Chapel the week previous. The programme, although not rendered in the style in which the boys could have de-sired, was nevertheless received with high favor by the delighted audience. Odd Fel-lows' Hall, the only building of the kind in the town, although small, was packed with Westminster's wealthiest people and hand-somest girls and with the students of Western Maryland College. After the entertainment, a surprise of a most agreeable nature awaited the boys in the shape of a reception tendered the Clubs by Mr. H. M. C. Claybaugh, Esq., and wife. When the boys arrived at the residence of their warm-hearted host and hostess they were met by a bevy of twenty-five of Maryland's fairest daughters. Here a most enjoyable evening was spent, which came to an end only too soon, and at 12 o'clock the boys left, filled with praise for the hospitality of Westminster's citizens and its attractive ladies. Early next morning the boys assembled at the train, bid-ding good-bye to their genial host and newly-formed friends, and as the train pulled out of the station and the last looks were taken at the receding town many a staunch Pennsylva-nian was heard softly singing, " Maryland, my Maryland," and all agree that the trip to Westminster was by far the most enjoyable ever taken by the Clubs. One week later, on Friday, December 15th, the Banjo and Mandolin Clubs gave an enter- THE COLLEGE MERCURY. 145 tainment in Zion Lutheran Church, of Harris-burg, under the auspices of the Luther Union. The large Sunday-school room was decorated with orange and blue, and was crowded with an inspiring audience, whose enthusiasm for the college and appreciation for the music was evidenced in many ways. Although, on account of death, the reception that had been planned was not given, yet the boys spent a very enjoyable time in the city noted for its beautiful women. This trip to Harrisburg has revealed the fact that we have legions of friends there, and it is quite sure that when the entire organization takes its trip to Harrisburg in January a warm reception will be given them. The concert which was scheduled for Han-over, December 19th, was postponed until a later date. THE TRUSTEES MEET. A. SPECIAL meeting of the Board of Trus-tees of Pennsylvania College was called for last Thursday evening. There was a full attendance. The meeting was called for the purpose of receiving and acting upon the report of,the Special Committee (Graff, Albert, Baum, Dun-bar, and McPherson), appointed at the annual meeting upon the action of certain Synods which criticised the resolutions of the Board passed in June, 1892, when establishing the Strong Professorship of English Bible and Chaplain, and which asked for Synodical representation in the Board of Trustees. The report of the Committee was fully considered in detail, amended, and adopted as follows with entire unanimity: Resolved, 1st. That the Board most earnestly repudiates the construction placed upon its action, when establishing the Strong professorship, as an entire misconception of the intent thereof, and the Board deeply deplores the fact that the misconception has caused misunderstanding, and has given wholly unnecessary alarm as to the status of our Col-lege. 2d. That the Board maintains the principle involved in its action, viz.: No denominational teaching in the class work required of all students of the College, with ample provision for the teaching of Lutheran doctrine by the Chap-lain to all students who may be willing to receive it, as the proper policy for the administration of our College, as in ac-cord with the policy pursued by all our Colleges and by this College from its beginning, and as entirely consistent with the Lutheran status of this College. 3d. That with a desire to remove all occas'on for uncer-tainty, we add the following statement to Item III of former action : " It is to be u iderstood that this action shall in no way be regarded as affecting the status of the College as a Lutheran Institution." In regard to the Synods who have requested representation by Synods in the Board of Trustee's of the College, and have asked for such modifications of its Charter as will enable them to secure in that form definite Synodical representation with rotary membership, the following resolutions were adopted: Resolved, 1st. That while we cannot see our way clear to grant the request of the Synods referred to, in the precise form in which it is made, we direct, in order to allay all un-easiness in regard to the Lutheran control of the Institution, and to give assurance thereof, the officers of the Board to apply to the Court of Adams County, and to ask the inser-tion in Section 6 of the Charter, after the words " Board of Trustees," where they first occur, the words " of whom not less than three-fourths shall always be members of the Lutheran Church." 2d. That the Board in filling vacancies as they from time to time occur, will, by the election of new Trustees, secure as far as possible a ratable representation to all Synods in its territory, especially to such as give to the College their undivided support. All the above action was adopted by the Board with unanimity, and having been sub-mitted to the Faculty, it was concurred in by them, who each and all agreed to accept this action in its entirety as a final settlement of these questions, to frown upon all agitation to unsettle it, and to use their best endeavors to overcome existing discontent and to restore confidence in the College. The meeting of the Board was looked for-ward to with anxiety, owing to the feeling which had been aroused, and the happy and unanimous solution of all the difficulties which confronted the Board led to general congratu-lation upon the result. Rev. Dr. McKnight, President of the Col- 146 THE COLLEGE MERCURY. lege, presented to the Board, on meeting, his resignation of the Presidency, to take effect on April 1st, 1894, in order to enable him to ac-cept the call to become pastor of St. Paul's Evangelical Church at Easton. This matter was duly considered in all its aspects, where-upon the Board unanimously declined to ac-cept it and requested its withdrawal. To this request Dr. McKnight on Friday morning as-sented. On motion the Board expressed its satisfac-tion at the pleasure and profit afforded the students last year by Rev. Dr. Huber's course of lectures on Luther's Shorter Catechisms, and requested a repetition of them this year, and that they may be made a feature in his course of instruction. Adjourned.—Star and Sentinel. eOLLEGE LOCALS. ORVILLE L. SIGAFOOS and WILMER A. HARTMAN, Editors. TPIE Preparatory department closed on the 15th ult. The verdancy of the Freshmen is only surpassed by their originality. This was shown by their holding their last class meeting on the steps in Recitation Hall. A midwinter athletic contest will be held in the Gymnasium. Some of the students are already practicing for the event. Fassold, '95, and Brosius, '95, were called home before the close of last term because of the deaths of relatives. Dr. Baugher attended the meeting of the International Sunday-school Committee last month at Boston. The College Banjo and Mandolin Clubs furnished music at a concert in Zion's Lutheran Church, Harrisburg, on Friday evening, Dec. 15th. Owing to the illness of Physical Director Aukerman, Weist, '95, conducted the class drills during the closing weeks of last term. Dr. Menges has fully recovered from his illness and is again about his duties. Mrs. DeYoe, of Harrisburg, and Miss Mc- Knight, of Brazil, are the guests of Dr. and Mrs. McKnight. The musical organizations have several tours in prospect during the present term. Sickness prevailed to a larger extent in col-lege during the closing weeks of last term than for a number of years. Owing to a num-ber of students being confined to their rooms and several returning home because of sick-ness,, the opinion became prevalent that ex-aminations would probably be omitted. This hope of the students was partly realized by the action of the Faculty, in that only two exami-nations would be required of each.class. Those two subjects were chosen which came on Monday and Tuesday mornings in the sched-ule of recitations. The following were the branches: Seniors, Astronomy and Political Economy; Juniors, English and Latin ; Sophomores, Greek and Latin; Freshmen, Greek and Latin. A large audience gathered in Brua-Chapel on Friday evening, Nov. 24th, to listen to the initial concert of the College Glee, Banjo and Mandolin Clubs. The reputation which the Clubs had established during past years added to the faithful practice since the opening of college, united in stimulating interest in the occasion and in arousing the expectation of the auditors for the rendering of a musical programme of a high order. Neither were they disappointed. Ample evidence was given of the enjoyment of the programme by liberal applause and repeated encores. The following is the programme in full : PART FIRST. 1. The Water Mill, Macy. GLEE CLUB. 2. Newport Galop, Jennings. BANJO CLOT. 3. Danube Waves Waltzes, Arr. by Maxcy. MANDOLIN CLUB. 4. Down by the Riverside, Shepard. MR. KLINE AND GLEE CLUB. 5. Virginia Bells, Lansing. BANJO CLUB. 6. Medley, . GLEE CLUB. PART SECOND. 1. Gettysburg College Medley, Arr. by Baum. MANDOLIN CLUB. 2. Minstrels' Carnival, Grover. MESSRS. ECKELS, HERSH, BIKLE, IIERR. THE COLLEGE MERCURY. 147 3. A Southern Zephyr, Arr. by Hersh. BANJO CLUB. 4. My Old Kentucky Home, Foster. MR. W. H. NICHOLAS AND GLEE CLUB. 5. Flash Galop, Lansing. BANJO CLUB. 6. Evening Bells, Sheard. GLEE CLUB. The rumor of Dr. McKnight's possible resig-nation of the Presidency has been received with universal regret by all connected with the institution. A mass meeting of the students was held Thursday afternoon, December 14th, in Brua Chapel, for the purpose of inducing him to remain. Strong resolutions were unani-mously passed asking the Board of Trustees not to accept it, should it be presented. The Proctor wishes to announce to all the students that, with the beginning of this term, all absences from the required services must be accounted for within two weeks after the time. All excuses presented after the stated time will be refused. Some excuses that have hitherto been considered valid will not be ac-cepted hereafter. The lecture course tickets will be on sale in a day or two. Have your order and money ready when the Committee comes around, and patronize the Y. M. C. A. to the best of your ability. Dr. S. to M., '94—" What characterizes mountain air ?" Mr. M.—" It is very embracing." Dr. S.—" How does it effect the heart ?" Mr. M.—" It produces lung disease." Dr. N., in Freshman Class, Mathematics— " Is there a man that don't see that proof?" Co-ed.—"/don't, Doctor." R., '95, to W., '95 (in laboratory)—"Say, Werty, do you have to dilute the distilled water before using it ?" A " Prep." has signified his intention to join the " Philo. Debating Fraternity." We were in hopes that higher critics would ever stand aloof from the Lutheran Church, but were surprised to find H., '94, in a recent recitation, asserting himself in that direction. He expounded at considerable length in " Evi-dences " on Saul of " Tyrus." Dr. N. (in astronomy, on Monday morning) —" I was reading up a lunar theory last night " —(quickly correcting himself)—" Oh ! no, not last night! It was night before last." Prof. H. to M., '94—" Is this law which we are speaking of universal ?" Mr. M.—" Well, yes, sir, it's universal to some extent." The cause of the frequent tardiness of K., '94, has ever been a problem beyond the solu-tion of the students. This is Dr. N.'s expla-nation, which he gave to the Seniors recently: " Mr. K., having charge of the Observatory, goes on Observatory time, and Observatory time is slower than college time." That trip of the musical organizations to Westminster last month was one conspicuous for jokes at the expense of the boys, if nothing more. One of the young ladies asked " why they carried a Jew along ?" Another declared that those cheeks of S., '97, were painted. Two of the members who had been assigned lodg-ings at a distinguished townsman's house were met by the Senator himself when they rang for admittance. After a survey of the duet, his majesty remarked that he did not have any marriageable daughters, and then sent them to the hotel. The effect, according to their own statement, was so appalling they " couldn't eat any dinner." A certain lady asked the manager to send two of the finest gentlemen in the clubs to her house. Ask the manager who was there, and then ask one of the other fellows what the lady afterward remarked concerning her guest. Dr. S. to Mr. V., '94—" How would you test for hard water?" Mr. V.—" Dissolve a little of it in alcohol, and then use a viscid filter." " Our Pearlie " wishes to find some facts in the Life of Luther. Picking up Grote's History of Greece, he remarks, triumphantly: " That is just what I want." Failing in this, he ex-plores Geike's Hours with the Bible. He is now perusing Skeat's Etymological Dictionary. Dr. H. speaks about the strangeness of the fact that there were no Smiths among the Israelites. Strange community! Y. M. C. A. NOTES. The Y. M. C. A., on December 14th, held its last business meeting of the term. Owing to the absence of quite a number of the mem- 148 THE COLLEGE MERCURY. bers of the different Committees, the reports of committee work usually given at that time were deferred, and may be expected early next term. The funds belonging to the Association were ordered to be invested in such a manner as to yield an increased amount of interest. We hope, during the coming year, to make addition to these funds, which will be eventu-ally appropriated to the erection of a suitable Y. M. C. A. building. A hearty and liberal patronage of our lecture course will help, we trust, to accomplish this. The Association deplores the possible inter-ference with its lecture course by a prior entertainment in the chapel, and trusts that there will be no conflicting of interests. With the beginning of a new year and a new term, let us anew exert our efforts in winning young men for Christ, as that is our mission in college. A retrospect of the past term shows much for our encouragement, and Gettysburg College is far better with than she would be without this organization. GENERAL COLLEGE NEWS. The November number of the Ohio State Inter-Colegiate Record contains a full-page cut of Recitation Hall of Gettysburg College.' That co-education is making a wonderful advance is shown by the fact that 500 women are in attendance at the University of Michigan. Lehigh University has in prospect one of the finest Laboratories in the world. It will cost $200,000. The large colleges of the country as to the number of students stand in the following order: Harvard, Johns Hopkins, Cornell, Columbia, and Yale.—Ex.' Yale recitations have been changed from one hour to 50 minutes.—Ex. There are 430 colleges in the United States, with 122,523 students.—Ex. Dartmouth has turned out 40 College Presi-dents, 200 College Professors, 60 members of Congress, and 24 Governors.—Ex. The college yell is a purely American inven-tion, and is unknown in other countries. In England the students simply cheer or scream the name of the college or university. No attempt is made at a rhythmical, measured yell as in tliis country.—Depauw Weekly. Improvements of the near future at Yale are a covered base-ball ground and a campus lighted by electricity. " Young gentlemen," said a Professor to his class in Evolution, " when I am endeavoring to explain to you the peculiarities of a monkey I want you to look straight at me."—Ex. Caps and gowns have been adopted by this year's Senior classes at Amherst, Dartmouth, Harvard, Lafayette, Princeton, Williams, and Yale. German boys are said to be the strongest intellectually in the world, Irish boys the wittiest, French boys the cleverest, and American boys the brightest.—Ex. The New University of Chicago already has over 1,000 students.—Ex. THE MERCURY is pleased to add to its list of exchanges The Radiator, published by the A A 2, fraternity of the Hillhouse High School of New Haven, Conn., and the Echo of the Illinois Wesleyan University, both of which are excellent journals, published in an attrac-tive form and full of interesting college news. Muhlenberg College is agitating a move-ment which will do away with the afternoon recitation and transfer it to the morning. The Bucknell Mirror is now issued semi-monthly. In the past 25 years 19 college buildings have been added to the Princeton campus. In the last seven years Yale has scored 886 points to her opponents' 88 on the foot-ball field. James Kitchens, of the class of 1819, of the U. of Pa., is the oldest living college graduate. Miss S.—" When 1 was a child I spake as a child, but now that I am a man, or very nearly one, I act as a man."—Ex. The largest salary which any college pro-fessor receives is $20,000, the annual income of Prof. Turner, of Edinburgh. THE COLLEGE MERCURY. 149 Governor Pattison of Pennsylvania deliv-ered an address on the " Higher Education of Women" at the recent dedication of the " Latin School" of the Woman's College of Baltimore. " Where are you going, my pretty maid?" " I am going to college, sir," she said, " For I am an ambitious gay co-ed, And I am going to college, sir," she said. " And what is your fortune, my pretty maid ?" "To be independent, sir," she said, " And able to earn my butter and bread By what I learn in college," she said. " I believe I will marry you, my pretty maid." " Oh ! no thank you, no thank you, sir," she said, " You are wealthy and worldly, but not well-bred, Not manly as college boys, sir," she said. S. M. G. in The Occident. The registering of the Freshman classes at Yale has been completed, and the lists show 380 students in the academic and 222 in the scientific department. Over 9,000 students attend the University of Paris. The Class of '93, University of Michigan, numbered 731, the largest ever graduated from an American college. Yale, Harvard, Brown, Princeton, Leland Stanford, Cornell, University of Wisconsin, and University of Michigan now publish daily papers, and the University of Pennsylvania will begin the publication of one soon. Man wants but little here below, Is a sentiment we love, And, judging by his conduct here, He won't get much above. ALUM/SI. FRANK E. FICKINGER, Editor. '41. Rev. Henry Baker, D. D., one of the oldest living Alumni, who was stricken with paralysis about two weeks ago, is gradually passing away at his home in Altoona, Pa. '46. The Philadelphia Ledger, of Friday, December 1st, contained a portrait engraving of Rev. W. M. Baum, D. D., pastor of St. Mat-thew's, together with a very full report of his Thanksgiving sermon. '55. Revs. O. G. Klinger, '86, and Eli Huber, D. D., '55, addressed the Christian Endeavor Convention of Adams County, Pa., at Arendts-ville, Pa., lately. '56. Rev. G. W. Leisher, of Duncannon, Pa., has accepted a call to the Boalsburg charge in Centre County, Pa., lately served by Rev. Wm. A. Trostle. '56. Rev. J. W. Schwartz, D. D., of Worth-ington, Pa., informs us that at a meeting of his Synod action was taken to organize a Western Alumni Association, and that a meeting will soon be called for that purpose at Trinity Lutheran Church, Allegheny, Pa. '57. Dr. H. L. Baugher will preach in St. Mark's Lutheran Church, the one formerly served by Dr. C. S. Albert, on the first Sunday of the new year, January 7th. '57. The committee on the Revision of the Hymnal portion of the Book of Worship of the General Synod met recently in Dr. D. M. Gilbert's church in Harrisburg, Pa. The com-mittee consists of Drs. Gilbert, H. L. Baugher, '57 ; W. E. Parson, '67 ; Rev. H. B. Wile, '77, and Rev. E. H. Delk. The next meeting will be held some time in February, probably in Gettysburg. '59. Rev. J. G. Goettman, D. D., of Alle-gheny City, Pa., attended the December meet-ing of the Board of Church Extension, in the interests of several missions in the Pittsburgh Synod. On Sunday, November 26th, 1893, he celebrated his 30th anniversary as pastor of Trinity Lutheran Church of Allegheny. '61. Rev. M. L. Kunkleman, of Norcatur, Kan., has accepted a call to Wayne, Neb., and will,take charge there in the near future. '61. On Tuesday evening, December 5th, Dr. J. B. Reimensnyder, of New York, deliv-ered an address in the " Morgan Lecture Course" before the faculty and students of Auburn Theological Seminary on " The Sig-nificance of the Lutheran Church for Chris-trianity." '62. Hon. F. E. Beltzhoover has lately in-troduced a bill into the House of Representa-tives for the transferring of the Pension Bureau from the Interior to the War Department. '63. Dr. Enders, of York, being sick with the grippe, Dr. E. J. Wolf filled his pulpit on the 10th inst, preaching and holding communion in the morning in German, and at night preach-ing in English and conducting a large English communion. ISO THE COLLEGE MERCURY. '65. Dr. J. C. Roller's congregation, Han-over, Pa., celebrated its 150th anniversary by-appropriate services during the entire week of November I9th-26th. Quiteanumberaidedthe pastor in the jubilee services, prominent among whom were Drs. H. L. Baugher, L. E. Albert, E. J. Wolf, Charles E. Hay, and Rev. J. J. Al-bert. The history of the church is varied, but of continued prosperity, and the congregation is a glory to the denomination to which it belongs. '66. A. J. Riley, Esq., who declined the ap-pointment as President Judge of Blair County, is now Solicitor of the Pennsylvania Railroad Co. '67. Rev. Dr. Charles S. Albert was pre-sented with a purse containing $250 in gold by the congregation of St. Mark's Lutheran Church, of Baltimore, at the reception tendered himself and family before leaving for Phila-delphia. '69. The new Lutheran Church at Daven-port, Neb., was dedicated on November 12th, Rev. J. A. Clutz, D. D., president of Midland College, preaching the sermon. '73. Rev. J. F. Hartman, of Altoona, Pa., has been appointed to and accepted the editor-ship of the Keystone Christian Endeavor Herald. '73. Rev. T. J. Yost, of Altamont, N. Y., has received a call to the Lutheran Church at Montoursville, Lycoming Co., Pa. '73. Rev. VV. S. Freas, D. D., has been elected pastor of St. Mark's Lutheran Church, Baltimore, to succeed Dr. Charles S. Albert, but has declined the call. Dr. Freas is presi-dent of the Board of Church Extension, and secretary of the General Synod, and has had a highly successful pastorate at St. Paul's, York, Pa. Dr. Freas recently celebrated the eighth anniversary of his ministry in York, Pa. '75. Rev. E. D. Weigle, of the First Luth-eran Church, of Altoona, Pa., preached the annual Thanksgiving sermon before Pride of Mountain City Council, No. 472, and Coun-cil No. 152, Junior Order United American Mechanics. '78. Rev. Albert E. Bell, of Boiling Springs, Pa., has been unanimously elected pastor of St. Mark's, York, Pa., recently made vacant by the resignation of Rev. Mr. Bowers. It is hoped that Mr. Bell will accept the call. Un-til a pastor arrives upon the territory, Rev. Wm. C. Bare, '93, will be in charge. '79. Rev. Luther Kuhlman's congregation at Frederick, Md., are improving the parson-age by having another story added to it. '80. Rev. George S. Bowers, late of St. Luke's, York, Pa., preached his opening ser-mon at St. Mark's, Hagerstown, Md., on Sun-day, December 3d. '82. Rev. J.E. Zerger, of St. Paul's Church, Leetonia, O., has resigned, to take effect Feb-ruary 1st, 1894, and accepted a unanimous call to the Lutheran Church at Mt. Holly Springs, Pa., this change having become nec-essary on account of the health of Rev. Zerger's family. '83. Rev. George W. Baughman, of Everett, Pa., has accepted a call to the Uniontown charge in Maryland. '83. L. A. Brewer has been elected treas-urer, and is one-sixth owner of the Republican Printing Company, of Cedar Rapids, la. '84. Rev. Andrew S. Fichthorn, a few weeks since, resigned as secretary of the P. R. R. branch of the Y. M. C. A. at Tyrone, Pa. The following week he was unanimously elected secretary of the Association at Washington, Pa., at an annual salary of $1,000. This call he declined, preferring the work of the active ministry. His health is now fully restored, and he is well qualified in every way to do good work in any field. '85. Rev. G. G. M. Brown has removed from Union Bridge, Md., to Everett, Bedford County, Pa. '88. The members and many kind friends of Grace Lutheran Church, Canal Dover, O., tendered their new pastor and wife, Rev. John J. Hill, a very fitting reception on Thurs-day evening, November 16th. '89. Rev. C. B. Etter, of the Second (St. Paul's) Church, Akron, O., has been tendered a call to the pastorate of the Sharon Charge, near Wads-worth, O., and will probably accept. '90. Rev. F. S. Geesey, ofthe Trinity charge, York Co., Pa., was installed on last Sunday, December 10th. '90. Rev. G. H. Reen, pastor of St. Luke's at Mansfield, was installed on Sunday, Novem- THE COLLEGE MERCURY. I5i ber 26th. Dr. L. A. Gotwald, '57, delivering the charge to the pastor in the morning, and that to the people in the evening. '91. Schmucker Duncan, now pursuing a course in Philosophy at Yale, spent the Christmas holidays with his mother at home in Gettysburg. '91. Rev. A. Pohlmann, recently appointed missionary for the Lutheran Church to Africa, has been making a tour through the churches of Eastern Pennsylvania, talking in the interest of missions. He recently addressed large crowds of students at the Clarion State Nor-mal School. '91. Frank Swartz, at present a student in Hartford Theological Seminary, spent Thanks-giving week with his parents in Gettysburg. '91. Rev. A. C. Stup is to be addressed at Asheville, N. C. '93. Honor Luffer Wilhelm is the editor of an interesting college paper and one that should be in the hands of every student.— T/ie Inter- Collegiate Record. Little grains of sand, Drops of H20, Make the mighty sugar trust, And the broker's dough. F-RTVTE-RNITy /NOTES. PAUL W. KOLLER, Editor. PHI KAPPA PSI. Bro. Lutz, '94, spent his holiday vacation " doing " Baltimore, Washington, Philadelphia, and New York. Bro. Keffer, '95, visited friends in Pittsburgh during most of the Christmas holidays. Bros. Carty, '96, and Graff, '97, are about again after a brief illness. Bro. Claybaugh, 'yj, gave a reception to the musical clubs at his home in Westminster, Md. PHI GAMMA DELTA. Bros. Rietz, '95, and Aukerman, '97, were compelled to leave college before the close of the term on account of sickness. Bro. Herr, '97, also went home with an attack of the grip, but returned for the examinations. Bro. D. F. Garland, '88, spent a short time in our midst recently. His church is growing wonderfully and the entire section of the city in the neighborhood is being built up. We are represented on the musical clubs this year by the following men : On the Glee Club—Bro. Fickinger; on the Banjo Club— Bros. Baum and Fickinger; on the Mandolin Club—Bros. Wert, Herr, Baum, and Fickin-ger. Bro. E. E. Blint, '90, pastor of the First Lutheran Church of Littlestown, Pa., paid a visit to Gettysburg with his wife a short time ago. Bro. S. B. Martin, '90, spent his Christmas vacation with his parents in Gettysburg. Bro. D. A. Buehler, '91, is at present at home, having severed his connection with the firm in which he has been employed for the last two years. SIGMA CHI. A chapter of Sigma Chi is being organized at the University of Chicago. Sigma is one of the five Greek-letter societies which have thus far taken possession of this new fraternity territory. Bro. McPherson, '83, spent several days last month visiting friends in Baltimore. Bro. Hersh, '91, has removed his law office to the rooms in the Star and Sentinel Build-ing on Baltimore Street. Bro. Damuth, '92, spent part of his vaca-tion as the guest of friends in Harrisburg. Bro. Olewine, '97, was called home on busi-ness before the close of last term. Bro. Trowbridge, '82, who was compelled to relinquish his duties for a season as pastor of St Paul's Church, Baltimore, because of ill-ness, has returned to his pastorate after a rest, much improved in health. ALPHA TAU OMEGA. Bro. Lewis Gehrhart, '85, of Martinsburg, West Va., spent Thanksgiving in Gettysburg. Bro. Gehrhart, in connection with his law prac-tice, is editing the Martinsburg Independent. Bros. Hutton, Cable, and Menges spent Thanksgiving at home. Bro. G. G. M. Brown resigned his charge at Union Bridge to accept a call from the con-gregation at Everett, Pa. 152 THE COLLEGE MERCURY. Bros. H. G. Mentzer, '87, and J. C. Clug-ston, '89, have formed a partnership, having purchased a drug store in Waynesboro, Pa., where they will do business under the firm name, Mentzer & Clugston. Bro. Mentzer is a graduate of the Philadelphia College of Pharmacy, Bro. Clugston a graduate of the Baltimore Pharmaceutical College. Chapters have recently been established at the Polytechnic Institute, Terre Haute, Ind., and at the University of Nebraska, Lincoln, Neb. ATHLETICS. HENRY E. CLARE, Editor. THURSDAY, November 30th, our team closed the foot-ball' season with a very creditable game with York Collegiate Institute at York, Pa. The game proved an easy vic-tory for our team. After a few ineffectual on-slaughts the York men despaired of making any impression on our line or of running the ends. Punting was then resorted to, with veiy little effect, although the York full-back, Van Baman, did some fine work. In this way only couldtheyput the ball on our territory, and then only momentarily. Our men had no difficulty in breaking through their line or running the ends. Emmert made some veiy long runs, as did Mottern. The bucking of Apple was very effective. Manifold did the great playing for York. The teams lined up as follows : GETTYSBURG. POSITIONS. YORK. McCartney, left end, Manifold. Byers, left tackle, Williams. Tholan, left guard, Polack. Rank, centre, Anderson. Becker, right guard, Randolph. Minges, right tackle, Crider. Earnest, right end. Diehl. Emmert, left half-back, Jessop. Mottern, right half-back, Crider. Nicklas, quarter-back, Keyworth (McEall) Apple, full-back, Van Baman. Score : Gettysburg, 24; Y. C. I., o. In this game only five of the regular players participated. The other positions were filled by those who had never played in a regular game. The score shows that they filled their places with credit. This season, which opened so creditably in a game with Cornell' University at Ithaca, N. Y., has proved to be probably the best in the history of foot-ball at this college. With unprecedented difficulties and obstacles in the way of success, the team has made a record that is a credit to themselves and the college. Several times the team played in a condition that hardly justified their playing, but a defeat was considered more honorable than the cancelling of a game. The team played eight games. Three of the opposing teams were university teams, and two of them rank among the best in the land. The games won were two from Dickinson, one from Washing-ton and Jefferson College, one from York Col-legiate Institute. One tie game was played with F. & M. Those lost were with University of Pennsylvania, Cornell University, and Buck-nell University. From the pecuniary standpoint, the season has not been so profitable. As matters now stand, we are considerably in debt. The cause has not been patronized as it should have been by the students. But the principal cause of our indebtedness is the lack of an athletic field. Money was lost on every home game, not be-cause we failed to draw large crowds, but because we could not get them to pay when they could see the game for nothing. This is our great drawback. It is necessary now to work earnestly. All subscriptions should be paid at once, as well as term dues. Our debts must be met, and the fact that not a cent has-been added to the Athletic Field Fund for an age shows us conclusively that no one takes enough interest in us or our noble cause to help us out of the difficulty. We must do it ourselves. It would be unfair to allow this number of THE MERCURY to go to press without saying a word about Manager Kloss. All who have watched our varying fortunes this season could not help seeing that a great part of our success was due to his indefatigable efforts and un-abating interest. He deserves the thanks of all for his labors. Twenty-six players participated in the differ-ent games of the season. To give an account of the playing of each one would require more space than can be allowed, and probably would not be interesting to the majority of the readers. On the other hand, to make mention of a few and leave unnoticed others who equally deserve praise for the faithfulness and zeal with which they performed their duties would be unfair. THE COLLEGE MERCURY. 153 In order to avoid this, only the touch-downs and the players who made them will be men-tioned. During the season 15 touch-downs were made, giving us 80 points : First game with Dickinson—Aukerman, 3 ; Keefer, 1. Bucknell—Aukerman, 1. Washington and Jefferson—Keefer, 3. Franklin and Marshall—Aukerman, 1. Second game with Dickinson—Keefer, 1. York Collegiate Institute—Mottern, 3 ; By-ers, 1 ; Emmert, 1. Total, 15—Aukerman, 5 ; Keefer, 5 ; Mot-tern, 3 ; Byers, 1 ; Emmert, 1. Gymnasium work has begun in earnest. All seem to be pleased with the work of Director Aukerman. It is to be hoped that this very important part of athletic training be not neglected, and that good and well-trained ma-terial may be developed for our coming seasons. At a recent meeting of the Athletic Associ-ation, the advisability .of chartering the body was referred to the Advisory Committee. There was a young man from Ky., Who at gambling thought he was a dy., But he altered his mind, After trying to find, The ace, with a monte-man ly. TOW/S 7VND SEMI/NTVRy. ROSCOE C. WRIGHT, Editor. TOWN. BY the will of the late Mrs. Sarah Eichel-berger, of Gettysburg, the college, with the " College " Church, is made residuary legatee. It is supposed that each of these will realize about $1,500. Her husband's will adds $2,000 to the funds of the college, and about $22,000 to the endowment of the seminary. These bequests from citizens of the town are very gratifying to the friends of the institution, and it is to be hoped that others will follow this good example, and so arrange their wills that these noble institutions will be helped to much needed equipment and teaching force. Postmaster Kitzmiller's commission expires on January 27th. Ex-County Treasurer Rufus E. Culp, R. M. Elliot, and ex-Prothon-otary George L. H. Grammer are the appli-cants for the position. Murderer Heist, who was to have been hanged here on December 14th, has made a statement in which he places the guilt on a man named Reese. His attorney has secured a reprieve from Governor Pattison un-til January 17th, during which time he will make an effort to secure a commutation of the sentence to life imprisonment. The Sunday-schools of the town held ap-propriate Christmas services. Those con-ducted by the students in the country held theirs before vacation. Dr. Breidenbaugh made an analysis of the stomach of Associate Judge Donohue, who died so mysteriously a short time ago, and found strychnia in sufficient quantity to cause death. The coroner's jury rendered a verdict that he had come to his death at the hands of an unknown person. The County Commis-sioners offer a reward for the arrest of the person. The schedule on the Phila. & Reading road is even more inconvenient than that of the old Gettysburg & Harrisburg railroad. The college musical clubs furnished the music for the evening sessions of the Institute. This was the most successful Institute ever held in Adams County. No services were held in the College Church on Sunday, December 17th, on account of diphtheria in the family of the sexton who occupies a portion of the building. Mr. Chas. Young, Gettysburg's talented young artist, has received liberal praise from the Art Editor of the Pldladelphia Inquirer. Mr. William B. Duncan, of Arkansas, has returned to his home after a pleasant visit to relatives and friends here. Miss Richards, daughter of Rev. Dr. Rich-ards, of Muhlenberg College, visited her aunts, the Misses McClean, the latter part of the term. Prof, and Mrs. Huber G. Buehler, of Lake-ville, Connecticut, are visiting Mrs. Buehler's parents, Dr. and Mrs. E. J. Wolf. Mr. Chas. Shapley, father of Mr. J. S. Shap-ley, of the Class of '90, died in Carlisle, De-cember 18th. 154 THE COLLEGE MERCURY. SEMINARY. The Seminary closed Monday, December 4th. Two cases of fever caused much anxiety among the Theologues. As a result the Faculty thought it best to close the term im-mediately. It is reported that a Harrisburg paper has published a letter from John C. Grimes, of the Junior Class, who disappeared so mysteriously last term. The letter is written to his father from Chicago. Rev. Dr. E. J. Wolf has an article on the " New Doctrine " in the New York Independent of December 14th. Mr. W. S. Oberholtzer and Mr. Edgar Suth-erland recovered from their sickness in time to spend Christmas at their homes. The work on the foundation of the new building progresses rapidly when the weather permits. Mr. E. E. Parsons, of the Junior Class, supplied the pulpit of Fourth Lutheran Church of Altoona during vacation. Rev. M. L. Tate, of the Senior Class, preached in the Lutheran Church of Bellwood during vacation. Mr. N. F. Bare, of the Junior Class, will preach in the Lutheran Church of Boiling Springs until a pastor has been secured. Bishop Daniel Payne, at one time a student in Seminary, and the oldest Methodist Bishop in the world, died at Wilberforce, Ohio, recently, aged 72 years. LITE-RTVRy SOCIETIES. WALDO D. MAYNARD, Editor. OF the many advangages which the literary societies afford to the students, those gained from the reading-rooms are of no little consideration. Here are to be found the leading newspapers, such as the Philadelphia Press, New York World, and many others of equal importance, together with the best magazines published. These rooms are main-tained for the convenience of the students at a considerable expense. Most of the students appreciate these privileges. There are, how-ever, some who are not only unappreciative of them, but even abuse them. It is next to an impossibility to keep Puck and Judge or the illustrated papers in the reading-rooms for any length of time. The Christmas number of Judge was not in Phrena. reading-rooms long enough to permit one-quarter of the members of that society to read it. Then, again, many men have an idea that this is a place for smok-ing and lounging. Men of this class make a nuisance of themselves, to the annoyance of those who wish to read. Isn't it about time that there is better decorum in the reading-room ? Many of us have only a few minutes to spend in reading the papers, and our time is too valuable to be wasted on account of the interruption of carelessness and indifference on the part of certain individuals. Again, it is unjust to expect the societies to furnish read-ing material for the monopoly of a few. We are now about to enter upon another term of work in the literary societies as well as in the other departments. The last term was considerably broken up, so that there were not many evenings for regular work. There-fore, we should tiy to make our work as interesting and profitable as possible. We hope to see some good men developed for the coming oratorial contest in June. Now is the time and the societies the place to train for the contest. There are still many men who have not as yet connected themselves with either of the societies. We would call attention to the fact that all non-society men are required to pay one dollar for the use of the reading-rooms after the first term, so from a financial stand-point it is about as cheap to be a member of a society as not to be. The two societies will continue the special meetings which have been found to be so profitable. Miss Lillie Tipton had charge of Philo. library during the holiday vacation. Messrs. Maynard, Barndt, Bell, Burger, and Clare are on the Committee to prepare special programmes for Phrena. Philo. has elected Mr. O. L. Sigafoos, '94, to fill the vacancy on Staff of THE MERCURY. ADVERTISEMENTS. Wanamaker's. What makes Wanamaker's so dis-tinctively Wanamaker's is the spirit that actuates the merchandising—all the time striving: to serve our customers better and better, shortening the road from producer to consumer and saving to patrons every possible penny of cost. How well we have done it is a matter of history, how well we shall do is what concerns us. The look is always ahead. Every part of the store shows points of unusual interest. Sporting Goods. Things for wear. Things for home helping. And there are lower-than-ever prices on many of them. JOHN WANAMAKER. SEND FOR CATALOGUE OF you^s L^D^S, NEAR. BALTIMORE, MD. This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Session, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M.,Principal, LUTHERVILLE, MD. PROFESSIONAL CARDS. CHJl^IiES S. DU^CA^i, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltinxoi-e Street, GETTYSBURG, PA. CHAS. E. STffltfkE, '87, ATTORNEY-AT-LAW, Baltimore Street, GETTYSBURG, PA. DR. CHAS, B, STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. fj tiber's Dr^2 Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. atest Styles \r\ IS Hats, Shoes, AND Gents' Furnishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes A. D. BUEHLER&CO., Headquarters for Stationery and Blank Books. LOWEST CASH PRICES. VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, fieux Yot*k. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jecxielfy Store for Souvenir * Spoons, i Sword Pins, &c. Post Office Corner, Centre Square. COLLEGE EMBLEMS EMIL ZOTHE, Engraver, Designer; and fllanafaetufing Jerjuelep, 19 SOUTH NINTH STREET, Opp. Post Office, PHILADELPHIA. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, and Stick Pins. Athletic Prizes. ALL GOODS ORDERED THROUGH G. Z. STUP. ADVERTISEMENTS. VI1 R. H. REININGER, fl]V[OS EC^EHT, Merchant * * *■■*'•■* Tailor. DEALER IN Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. Pocket Books, Trunks, Telescopes, Rubbers, NEXT DOOR TO POST OFFICE, Etc., Etc. UP-STAIRS. CENTRAL SQUARE. AMOS ECKERT. PETE THORNE, Shaving $ Hair Cutting SPECIAIi TO STUDENTS. pine Tailoring. Parlors JOSEPH JACOBS, 1 LXl l\J 1 0» Merchant Tailor, FmST CLASS 7VRT1STS. Chambersburg Street, (Below Eagle Hotel) CENTRAL SQUARE. GETTYSBURG, PA. FLEMMING & TROXEL, Red Front Cigar Store Billiard R. H. RUPP, Proprietor. fio. 8 Baltimore St., Gettysbufg. ANt> The place for a fine Cigar or a good Pool 'Rooms. chew. Solid Havana filler, 5 for 25c. An elegant article. BALTIMORE STREET. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. Vlll ADVERTISEMENTS. ESTABLISHED 1876. PE/NKOSE MgEKS, AY/dTcnndKER ™ JEWELER. Iiafge Stoek of LCiatehes, Clocks, Jexxielvy, etc., on Hand. GETTYSBURG SOUVENIR SPOONS. COLLEGE SOUVENIR SPOONS. 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R. STINE S. SON'S CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. MERCHANT TAILORING A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, RA. A. G. SPALDING & BROS. MANUFACTURERS OF .Athletic $> ^porting Goods OF EVERY DESCRIPTION THE NATIONAL LEAGUE BALL, BATS, CATCHERS' GLOVES AND MITTS. MASKS. BODY PROTECTORS, ETC. ETC THE SPALDING TOURNAMENT TENNIS BALL, THE SLOCUM RACKETS. RACKET COVERS, PRESSES AND NETS, COURT MEASURES, MARKERS, POLES. FORKS. ETC., ETC. Uniforms and Clothing for all Sports, Outing and Gymnasium use- The finest imported Serges and flannels. Newest Styles and Patterns. SEND FOR OUR NUW CATALOGUE'S CHICAt.O, NEW YORK. PHILADELPHIA, 10S Madison St. 243 Broadway, lojz Chestnut St. DMTLLTIELD LIVEKT. Rear of Washington House, Opposite W. M. R. R. Depot. GETTYSBURG, PA. ^W& All Kinds of Teams. Good Riding Horses. -:o:- The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

Issue 36.5 of the Review for Religious, 1977. ; REVIEW FOR RELIGIOUS IS edaed by faculty members of St LOUIS University, the editor,al offices being located at 612 Humboldt Braiding, 539 North Grand Boule-vard; St. Louis, Missouri 63103. It is owned by the Missouri Province Educational Institute; St. Louis, Missouri. Published bimonthly and copyright © 1977 by REVIEW FOR RELIGIOUS. Composed, printed, and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $2.00. Subscription U.S.A. and Canada: $7.00 a year; $13.00 for two years; other countries, $8.00 a year, $15.00 for two years. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money order payable to REVIEW FOR RELIGIOUS in U.S.A. currency only. Pay no money to persons claiming to represent REVIEW FOR RELIGIOUS. Change of address requests should include former address. Daniel F. X. Meenan, S.J. Robert Williams, S.J. Joseph F. Gallen, S.J. Jean Read Editor Associate Editor Questions and Answers Editor Assistant Editor September 1977 Volume 36 Number 5 Renewals, new subscriptions, and changes of address should be sent to REVIEW Fon REL1c~ous; P.O. Box 6070; Duluth, Minnesota 55802. Correspondence with the editor and the associate editor together with manuscripts andbooks for review should be sent to REVXEW YOn REL~CIOUS; 612 Humboldt Building; 539 North Grand Boule-vard; St. Louis, Missouri 63103. Questions for answering should be sent to Joseph F. Gallen, S.J.; St. Joseph's College; City Avenue at 54th Street; Philadelphia, Pennsyl-vania 19131. The First Week of the Spiritual Exercises and the Conversion of Saint, Paul Carolyn Osiek, R.S.C.J. Sister Carolyn is on the faculty of Catholic Theological Union, Chicago, where she teaches New Testament. Most recently, she had been Research/Resource Associate in Women's Studies at H~rvard Divinity'School. Her address: Catholic Theological Union; 5401 S. Cornell; Chicago, IL 60615. The title ~ays in a general way the topic of this article. Actually, however, it is somewhat the other way around, for another way of expressing the topic would be: Paul's decisive "First Week" experience, or, the "First Week" in the life of Paul. The present investigation Will be an attempt to focus, examine, and understand the personal experience of Paul which parallels and reflects the process experienced and planned by Ignatius for his followers in what he later came to call the "First Week" of the Spiritual Exercises. There are some obvious limitations to such an undertaking. First, if as is generally accepted, Paul's initial conversion experience took place some-time between 33-36 A.D., and if what is preserved of his Philippian, Ga-latian, and Corinthian correspondence was written between the years 54 and 57 from Ephesus, there is a 20 year gap between the.experience and the description. 1 Second, Paul had no intention of writing an autobiography.' He alludes to his own spiritual experience only insofar as it helps him convey ~The chronology of the letters is disputed. Here I follow J. A. Fitzmyer, "A Life ~Jf Paul," Jerome Biblical Commenthry, ed. R. E. Brown. J. A. Fitzmyer. R. E. Murphy (Englewood Cliffs, N.J.:Prentice Hall, 1968), pp. 218, 221. 657 6511 / Review for Religious, .Volume 36, 1.,977/~5 his point to others, usually in terms of the bankruptcy of the Mosaic laW vis-a-vis the grace of Christ--a religious situation far removedin actuality from the experience of most of us, whatever figurative applications can be made. Third, the one source in which Paul's spiritual conversion-is graph-ically and formally portrayed (in triplicate)--Acts 9:22 and 26~could be utilized in a consideration of New Testament theology of conversion, but in the light of modern scriptural source criticism cannot responsibly be used to shed light on Pauline spirituality or spiritual experience. Some of the elements picked up by Luke in.his triple narrative will be used as illustrative of the Pauline experience in the wider dimension of familiar religious symbols, but it must be kept in mind that for Paul they are secondary. This brings us to a statement of the broader scope of the present under-taking. The purpose of the investigation is not historical. If it were, it could well stop with the Pauline data. Rather, the full scope is an attempt to understand Paulis wounding and healing as exemplary of a common spir-itual journey through death to new life for a purpose. The expanded ar- .ticulation of that process is drawn from personal experience as retreatant and as a spiritual director. It might be well to begin by describing the structure of the "First Week' '~ process as it will be treated here. Basically it is a movemrrit of entering into death in Order to have life, of descending into the depths 0nly to find there new inspiration to arise, of going down with the old and familiar and coming up in newness, as the ancient ritual of baptism by immersion so clearly portrays. It is wodnding and healing, alienation and reconciliation as the person comes face to face first with human evil and then with divine good-ness. Precisely where these two currents cross is the point of greatest pain because the comparison becomes nearly unehdurable. But out of the con-flict engen.dered by that pain comes the energy to begin anew, and thus the paradoxical cycle of death and rebirth is once again lived out. Ignatius' term -confusion" is not a bad word to describe the growing sense that something is wrong, both in its literary meaning of "shame" and especially in its more common sense of "losing one's bea.rings." There are three stages that can occur as defenses are stripped away and the sense of confusion sharpens. Ignatius described these three stages one way in n. [63] of the Exercises: first, a deep knowledge of-pers~onalo sin and a feeling of abhorrence; second, an understanding of the "disorder of my actions" and a resulting feeling of horror; third, a. knowledge of the sinfulness of the world ~.and, again, a.sense of horror. Abhorrence and horror are strong enough terms, yet they imply a primacy of activity on the part of the retreatant though, it must be added, the grace to have such feelings is clearly seen as something to be asked of and freely bestowed by God. The terminology used by Ignatius here, at least as we can understand it four centuries later, does not adequatrly desc.ribe the passive nature of the First Week experience as it is sometimes encountered when, without active The Spiritual Exercises and the Conversion of Paul / 659 pursuit of desire for sorrow for sin, and so forth, rational defenses and affective supports ~reviously relied upon suddenly disappear. Disorienta-tion deepens as awareness of sin increases. The revelation of sinfulness progresses; as Ignatius.described it, in three stages. The first is that of felt guilt over specific acts for which the person is respohsible, guilt that has been accumulating perhaps over a long period of time, the full impact of which suddenly bursts forth with unexpectedly painful sharpness as the reti'eatant faces God and himself in solitude. Crnfusion is balanced only by the fi~m witness of the mercy and forbearance of God in allowing the person t~J come to this point. The second stage occurs if the layer of the conscious mind can be sufficiently peelea off to-reveal the underlying basic tendencies to evil for which a perso~n is only partly responsible at the conscious level. The feeling of confusion, pain,, a~nd alienation increases and a ne'w factor eri(ers in: helplessness-sthe inability to do what one Would want to do about vast areas of life. ,;The realization deepens that one is unable to Consciously regulate tendencies to grab for security, love, and control that diminish both victims and subject. The person is painfully aware of not being in control of his own motivation. At this point feelings of guilt mix with a newly discovered fear of one's own innate destructiveness. Mistrust of oneself can be countered by trust in the God who has kept him from becoming worse than he is. In the third stage the probe of the ~pirit goes deeper still until it reaches the 16vel at which personal responsibility is no longer at stake. It is .the experience of total powerlessn~ess, helplessness, total inability to act in any way.to save oneself. The forces of disintegration seem to be triumphing and God seems to have left the person totally to his own resources which have consequently cru'mbled. Here it is no longer a question of guilt and merc~,, but of the ability to live with fear and to cling to some memory of the love of God. The familiar theological maxim that God sustains all things in existence at every moment becomes a crushing reality, for the person is This "confusion." flowing from the sense of being judged by God, is not the result of a rational process: it is total loss of face before a situation which cannot be long endured with the usual supports of reason and prudence. We find ourselves con-fronted by ttie cross of Christ placed in the presence of unmeasuredness itself, that which is "madness to the world" (I Co 1:23).2 Z"La 'confusion.' fruit spirituel de cejugement divin, n'est pas le r~sultat d'une argumenta- 'tign logique: elle est perle totale de contenance, devant une situation qui pr~cis~ment ne peut ~tre plus Iongte.mps support~e avec !es ressources habituelles de la raison et de la pru-dence. ~Nous voici, devant la Croix du Christ. mis ,en presence de la d~mesure m~me, qm est 'folie l~our le monde" (I Cor 1:23) . La premiere semaine des Exercices." Christus, vol. 6. no. 21 (1959), pp. 22-39 (translation mine). 660 / Review for Religious, Volume 36, 1977/5 sure that nothing within himself is preserving his being, .and yet it seems to be God himself wh6 is crushing him. Ignatius understood [53] that only the total powerlessness of Christ on the cross as he is destroyed by force.s beyond human control can give any meaning to this experience, W. de Broucker describes this state of soul in a way that sums up the whole triple movement: It is precisely the attitude expressed by the dying Chris.t that marks the beginning of the movement upward: "Into your hands I commit my spirit." Surrender into the hands of God, the cessation of struggle against the force that seems to be annihilating the self, goes against the basic instinct of human nature. It is natural for us "to fight for life, to hang on tenuously to the familiar. If the shred of self that is left can be given up, a new self can be formed. With surrender comes trust that there is someone or something to surrender to, and that something other than total chaos can result. Once trust has been given, a dim hope can begin to arise, an assurance that dawn will~ome and that a reason for the suffering and death of the experience may be that something greater is coming to birth. With a new confidence given to the force that is at work within, further insight into one's personal responsibility may result. There may be deep-ened realization of how one's total helplessness before God, now a.~vivid reality, creates subconscious defenses in the form of root tendencies to turn away from God in order to avoid pain, conflict, or unwelcome truth. New awareness of personal orientation away from God then leads to a whole new outlook about personal sinfulness. The avoidance, neglect, anxiety, and self-seeking expressed in everyday~life as sin are seen with much more understanding and insight into one's personal motivation.s and weaknesses. At this point a healing of pain and guilt can take place and the mercy of God becomes an invading presence _bringing with it the experience of reconcil-iation leading to a deep sense of peace and eventually of joy. The new clarity of understanding leads inevitably, for the person who remains faithful in following the new way where God is'leading, to a trans-formation of attitude and behavior. This transformation is a psychiC and spiritual change that invades the whole person, btit rarely does it happen all at once. It involves the abandoning of certain accepted values and untried assumptions regarding personal autonomy, perception of truth, or need for affectivity. Realization of what God is asking in these areas and consequent surrender and acceptance of change usually happen gradually over a period of at least several months. What is happening simultaneously is the ac-quisition of a new set of personal values to replace the old ones, values usually founded on sharpened awareness of the fragility and weakness of the self and a deep sense of awe an~d gratitude at the ways that God's power is at work in weakness. Mary Esthei- Harding describes the psychological change that is taking place at this point: The Spiritual Exercises and the Conversion of Paul / 661 Whenever there is an upsurge of highly activated unadapted material into conscious-ness, the task of assimilation becomes urgent. This holds true whether the new material is valuable, creative stuff or merely alchaic phantasy that bespeaks more a morbid exuberance than a prolific creativity. The assimilation of the new material demands a fresh standpoint, which implies a recognition of the relativity of all former judgments. What was formerly considered unqualifiedly good must'now be judged in the light of,the new and enlarged understanding; the same must be done with that which has been considered bad? The whole experience might be summarized as an awareness of: the goodness of God gratitude sinful actions guilt. need for mercy, forgiveness sinful tendencies fear struggle need to experience love of God powerlessness surrender trust hope And a new awareness of: sinful tendencies new awareness of mercy love motivqtion for sinful power of God acts , need to change There follows a healing and reconciliation peace, joy and a gradual transformation of values, attitudeS, behavior As 'was stated at the beginning, the primary focus of this paper is the spiritual experience of Paul, aRd the previous discussion of the process is by ~ay of setting the stage. Patil's change Of heart is classically spoken of as a "conversion;" The limitation inherent in the use of this term is the restricted sense in which the word is most often used: change of faith or religion or, somewhat more broadly, emendation of a wayward moral life, while the root meaning of the word "conversion' ~ is really something closer to an "about face~'--a total turning of the person from one orientation to another. While Paul's "conversions" certainly did entail a change of reli-gious affiliation, though probably not a change of moral conduct, it must be Understood. primarily in the broadest sense of the term, as a complete overthrow and turn-about of personal values. Because of the ambiguities aPsychic Energy: Its Source and Its Transformation, 2nd ed. Bollingen Series X (Washington, D.C.: Pantheon, 1963), p. 285. 662 / Review for Religious, Volume 36, 1977/5 present.in the word "conversion," it might be preferable to ~pe~ak of the "transformhtion" of Paul in his encounter with the li~,ing Christ.4 Contrary to, what much p0pu,!ar arid undiscrimina.ting piety (and perhaps even the a~uthor of Acts)would,have us think, Paul's transformation did not happen.overnight or even in three days as a careless reading of Acts 9:18-30 might suggest. Paul himself speaks of three years (Ga 1:18).~tran~spiring before he began to preach Christ. There is no reason' to suppose that the process moved along with remarkable speed. We tend to clothe Paul's transformation~ixperien~e in'a thick ~overirig of the miraculous, leaning too heavily on the clear triple account of Acts and too lightly on Paul's own illusive comments. The flash of light, the heavenly voice of the reveals/r, Paul's being struck to the ground, and the mysterious three-day blindness are all stock elements of narrations of divine epiph-anies. For some, miraculous revelations are a stumblingblock and a source of conflict. But for most people today, they are something else: an invitation to disregard. And so what happens°is that someone like Paul, who leaps out at us so humanly in his own writings, becomes relegated to the dim past, to the gallery of "saints" who are not quite as human as the rest of us, to the realm of the "supernatural" dichotomized from that realm in which we ourselves live and struggle. The reason for all this is 'not surprising: we do not have to have the uncomfortable experience of seeingourselves reflected in such a "saint." The ways of God with humanity are as varied as are the persons who seek to know them, and yet there are qualities of our common humanity that remain very much the same. It is for this reason that an analysis'of the transformation process a~ given above, and an attempt to see that process as it happened in Paul are worthwhile. We may be able to see something of ourselves in him and so better understand the ways of God in us. It is a mistake to think of Paul as changing f.rom hardened persecutor to egthusiastic mystic, from~his, blind cruelty to a Christian sensitivity, as though: his transformation, were from sinner to saint. Paul was not a hard man; .he was a sincere and generous man. His pursuit of Christians sprang 4An important article or] the structure and Western interpretations o"f Paul's conversion ex-perience appeared long ~go and attracted considerable nOtice in Protestant Scholarly circles, coming as it did out of a Lutheran interpretation of~Paul; I refer to Krister Stendahl'.s "The Apostle Paul and the Introspective Conscience of the West," Harvard Theglogical:Revi~ew 56:3 (July, 1963), pp. 199-215, an article well worth reading. In recent conversation betwe_en the author arid rfiyse!f there was agreement about Paul's "clear conscience" regarding his former way of life in Judaism (see ~specially pp. 200-201); however, I would not want to stress the idea of "introspection" as the search for personal sin, but would rather emphasize the seeking after awareness of God's action within the person. In contrast to Dean Stendahl's interpretation (pp. 204-205) I would distinguish two aspects of Paul's change of ways: first, a personal transformation, and second, the directing of that new energy toward evange Jzat~on of the Gentiles. The Spiritual Exercises and the Conversion of Paul / 663 not from cruelty but from enthusiasm in the service of God. He was the good and tlpright man whom the Lord loved, and because the Lord loved hii~ so much, he called him to give more. Paul says of himself (Ph 3:5-6) that his family and religious credentials were impeccable and that he had done far more than the minimum required to be a son of the Law. He was without fault in itg r~gard,'fully aware of its value as gift bestowed upon Is-rael as a proof bf God's love. Hi~ sincere thirst for justice miast have led him periodically into the self-scrutiny of the just which produces an awa(eness of personal failings anti sinful tendencies that only deepens devotion as it deepens-an ap~areciation of God's mercy. ,.Then something happened. Whether his encounter with the living Christ was as dramatic as Acts 9 portrays it is doubtful, for Paul nowhere alludes to~,,his experie]ace as containing elements of the sensational,but rather de-scribes it qui[e simply: "Have I not seen Jesus our Lord?" (1 Co 9:1); "I did not receive [the gospel] from a human source nor was I.taught by any but a revelation from Jesus Christ" (Ga 1:12); "God who had set me aside from my mother's womb called me through his grace and revealed his son in me" (Ga 1:15; see Is 49:1; Jr 1:5). There is an undeniable sense of personal encounter and ,call, even for a specific mission, but ~very little impression of fanfare. He found himself at point zero, knocked off his horse more internally than externally, with no patterned defenses or conditioned responses to fall back on that had not been stripped away by a new presence that was relentlessly pursuing him. ,When the realization of whathad happened began to take hold of him, Paul knew he had been changed. Luke's image of blindness approximates in physical.terms what must have been his psychic,state for a period of time: confusion, loss, fear, inner chaos, spiritual paralysis, the terrifying~feeling that hig whole world was coming apart. As he began to surrender to the force that was invading him, he would have become aware that it was a new and unwelcome presence that of Jesus of Nazareth, suddenly: intruding upon his well-ordered world. This is in fact the heart of the experience of brokenness: that Christ manifests himself in a new and unexpected way, and before his demanding presence all pre-conceived structures of life must be put aside. '~ Onc~ he had accepted what was happening, he would have begun to see h~ms~lfin a new way, feeling within himself the slowi3i-dawning and terrible realization that he had misplaced his devotion and misdirected his zeal, the frustration of knowing for the first time that he had beeri turned in a di-rection which, in the light of a new awareness, he had to judge as the wrong way. New understanding Would .have brought about new se'lf-knowledge and a new capacity for radical honesty about the movements of his life, enveloped in deepened awe at the sustaining and patient love of God re-vealed in Christ who was now calling into question the whole meaning of his life. ,664 / Review for Religious, Volume 36, 1977/5 The realization that the love of God has been constant when our re-sponse has been anything but constant, that his forgiveness was extended even before we knew for what to ask it, can be a crushing blow from which the security of the ego never fully recovers. The wound inflicted on it is not cured, as if the tearing never happened; rather, it is healed, brought to new wholeness- not in spite of, but because of the rending. As is often the case, Paul's healing and reconciliation with God were not for his sake only., but that he might lead many others to the same point: "The love of Christ overwhelms us when we realize that one died for all., so that the living should no longer live for themselves but for him who died for them and was raised again., for everything is from God who has reconciled us to himself through Christ and given us the ministry of reconciliation" (2 Co 5:14-18). What is cautiously born then is a'self that must undertake the painful task of she~lding and leaving behind as so much debris much that the former self deemed of value, in order to make room for new value to come. In the case .of Paul the reversal which he had to endure to be faithful to newly-given grace was dramatic and loaded with not only personal but also social consequences: "But whatever was formerly gain to me, I have com~ to consider it loss because of Christ; mor.eover, I now consider everything loss because of the overwhelming knowledge of Jesus Christ my Lord, for whom I have let go of eve~:ything and consider it rubbish in order to gain Christ and be counted with him" (Ph 3:7-9). For him it meant giving up a worldview, religious affiliation, a certainty of being right, a reputation, family and friends, the whole fabric of personal and social relationships that had formed the pattern of his life. Few are called to so drasti6.a change. Yet the most fundamental change must have been one with which many can resonate: the need to reconstruct from broken fragments.a new self, a much more fragile self, like an earthenware jar hollowed out at the center in which "the overflowing power comes from God and not from us" (2 Co 4:7). It is the need to understand and accept the voice of Christ addressed to the prostrate human spirit, "My grace is enough, for strength is brought to fullness in weakness," and to respond by saying, "Joyfully then I will openly share my weakness so that the power of Christ may be revealed through me" (2 Co 12:8-9). It might be argued that the above account of Paul's conversion .and transformation is a fanciful extrapolation based on insufficient data. Yet the essential human experience underlying it is so basic and .universal that no matter in how many myriad forms it is manifested, a true experience of transformation from one spiritual state to another (as opposed to a super-ficial "conversion" that is only temporary because self-induced) has certain fundamentally similar components. Certainly Paul's experience was a trans-formation of this kind. Though he leaves many things unsaid, the pain and fear, the bewildering search, and ultimately the ecstasy of discovering that it is precisely in crucifying weakness that the power of the risen Christ is manifested, come through in the few literary traces he has left. The Spir!tual Exercises and the Converison of Paul / 665 For Paul transformation meant a radical break with the past, with family, home, and faith. For most of us, the break is not so abrupt, and yet the need to abandon old habits of thinking and feeling to make room for new ones still only dimly perceived is a common element. Spiritual directors are plentiful these days, but guides and models in one's spiritual experience are not always easy to come by. An ability to find echoes of one's own life in the jolting experience of Paul may give encouragement and be a cause for that movement of hope in darkness which affirms with him that no matter how chaotic may be the experience of finding out what we really are, for the person who continues trying to hang on the way Christ has hung onto him neither height of blind pride nor depth of despair--both of which can co-exist in the same person--nor any creature of the imagination can ever wrench us away from the love of God that is expressed to us in Christ Jesus our Lord.5 ~See Ph 3:12; Rm 8:39. REPRINTS FROM THE REVIEW Profile of the Spirit: A Theology of Discernment of Spirits by J. R. Sheets, S.J. .50 Retirement or Vigil by B. Ashley, O.P. .30 The Confessions of Religious Wom~en by Sr. M. Denis, S~.O.S. 30 The Four Moments of Prayer by J. R. Sheets, S.J. .50 The Healing of Memories by F, Martin .35 The Nature and Value of a Directed Retreat by H. F. Smith, S.J . 35 The Teaching. Sister in the Church by E. Gambari, S.M.M. .30 The Theology., of the Eucharistic Presence by J. Galot, S.J. .30 The Vows and Christian Life by G. Greif, S.J. .30 New Reprints° Centering Prayer--Prayer o~ Quiei by M. B. Pi:nnington, O.C.S.O .50 Colloquy of God With a Soul That Truly Seeks Him .30 Prayer of Personal Reminiscence by D. J, Hassel, S.J. .60 Orders for the above should be sent to: Review for Religious 612 Humboldt Building 539 No. Grand Blvd. St. Louis, MO 63103' Please include remittance with all orders less than $5.00 A Theology of the Religious Life Local Church and Ladislaus Orsy, S.J. Father Orsy teaches Canon Law at the Catholic University of America. He resides at Carroll House; 1225 Otis St. N.E.; Washington, DC 20017. The text of this article is the keynote address given in New Orleahs at the annual convention of the National Conference of Vicars for Religious, on March 21, 1977. The notes were added later to try to dispel some ambiguities in the text and, elucidate further the author's mind. Saint Thomas Aquinas introduced one of his famous works with the Sen-tence: "A small error in the beginning leads to a great one in the end.''1 In the same spirit of wise caution we can say that the wrong question ~n thee beginning is likely to lead to the wrong answer at the end. Let us transform, therefore, the terse words of the title, "A :Theology of the Local ChUrch and Religious Life," into a question rightly construed, that can lead us securely in our inquiry toward the ans~ver~s that we do not know at the point of our departure. Indeed, the title breaks up quite naturally into three queries: 1. What is our understanding of the local church? (By under:standing we mean tides quaerens intellectum; faith seeking underst.and!ng. Here we mean the knowledge of the local church that is givew t.hroughfaith, and is deepened through our reflection on the data of faiths)z ° ~ ~ 2. What is our understanding of religious life? (Understanding means, here again, knowledge through faith and reflection.) , 3. What is, and what should be, the right relationship between the two? The questions spring quite natur~ally from the title. Yet, I am still not satisfied with them. They shouldbb focused with more care, sharpened with greater precision. Also, they should impose a limit on our rather broad topic, and thus make the discussion of it more manageable for our specific purpose. Let us try again to set the right questions. 666 A Theology of the Local Church and Religious Life / 667 1. What is our understanding of the fact, of the ~event, of a particular church ? There are two significant changes in this new formulation. We seek a better understanding of the fact or event of the church; that is, our'focus is not on an abstract concept, but on an actually existing community of Chris-tians who form a church, although not the:universal Church. Our focus is concrete and existential. Our understanding will develop more from .the observation of the living body than from the analysis of texts. Also, we substituted the term "particular" for "local." The reason for this isthat local church has a geographical connotation and tends to point to a parish or to a diocese, hardly to more than these. The term "particular" allows greater flexibility; it points toward the natural unity of a group of Christians inside the broad,universal community. Such unity may well emergedn a diocese, .but it may well go beyond it and extend as far as an ecclesiastical province, a region, or a country.~ It may even spread over several countries. To seek the understanding of a "particular" church, instead of a "local" church, frees us from narrow boundaries and will allow us to examine the issue in a broader context? But we must impose a restriction on ourselves. We do not intend to exhaust the mystery of a particular church by investigating all its dimen-sions. We want to understand its life in relationship to religious commu-nities. That is all; but, it is a lot. 2. What is our understanding of the fact and event of religious com-munities? Here, too, our focus is concrete. Our primary interest is not in the concept of religious life, but in the real life.of religious communities.4 With a well-defined limitation: we seek the understanding of the life and work of religious communities in their .relationship to a particular church in which they exist, and where they give themselves to the service of the universal church. 3. What is, or what should be, the relationship between the two, a particular church and religious commutiities, in it? We intend to reflect on the living relationship that exists, or should exist, in the b6dy of the church between two diverse members. We seek ihis understanding in view oflntelligent Christian action, with the intention of ¯ finding norms and guidelines for such action. Let us turn now to the first q,uestion. First Question: How Can We Come to,a'Better understanding of the Particular Church? All understanding begins with the perception of facts. For facts about the particular church we must turn to the awareness of Christians through-out- the centuries, from the beginning to our days. Review for Religious, Volume 36, 1977/5 Some historical pointers about the development of the particular church; or, how did the Christian community perceive the particular church throughout its history? In the early centuries, Christian communities developed maihly along the great commercial routes of the Roman Empire. Soon they structured themselves; the bishop presided over the congregation. The local com-munities were closely knit; those were the times when Christians knew each other by name. While they were aware of the universal dimension of their religion, they enjoyed a certain amount of local autonomy,. Yet, right from the beginning, there was a ,movement to bring the smaller communities around the bishop into a larger unity, either under the supervision of a traveling bishop, or under a metropolitan residing in a larger city, usually the capital of a province. Particular churches with their own language, liturgy, discipline and customs, developed, not so much in each~city, but in larger territories that represented a natural cultural unity, They developed different understandings of Christian faith; they created different practices. Of course, those differences did not go so far as to deny or contradict the unity necessary for universality, but they certainly went far enough to give a different character to each of those particular churches.'~ Such trends are clearly discernible well into the Middle Ages. Individual dioceses in most places were too small to give a specific ex-pression to their faith, to create their own discipline; culturally, they were ¯ ¯ absorbed into a larger unity, into the ecclesiastical province or the national church. Thus, the Irish church, from the beginning, wa.s quite different from the continental churches, yet there was not much difference from one diocese to another. The English church, too, had its own characteristics under the leadership of Canterbury. On the Continent, the legal customs of Germanic peoples gave a certain unity to many churches. In Spain, the Mozarabic rite developed and united many dioceses in worship. In France, churches around Lyons formed again a vital unity, distinguished by their liturgy. We could continue the enumeration of such developments, but for the purpose of this article, let us content ourselves with a general statement, that I believe is historically correct. If by particular church we mean a church that has its own specific charisms, its own mind and its own heart within the universal Church, then only a few dio.ceses were truly.particular churches,n Differences in theology, liturgy, and discipline could be found much more between ecclesiastical provinces, regions and territories of nations, than between dioceses. The source of such variety is much more in human culture than in the understanding of faith. With the waning of the Middle Ages, a change takes place. The power of the metropolitan see in the Western church is reduced to a minimu~m. Liturgical worship, preaching, and discipline become strongly unified in the whole Church, even to the point of exaggerated uniformity. The role. of A Theology of the Local Church and Religious Life / 6159 particular churches, be they dioceses, regions or provinces, is reduced to a minimum. Vatican Council II wanted to restore the dignity of the particular church and the bishops sti'essed its importance repeatedly,r ~'et the council was not in a position to do much reflection on the nature of the particular church, on what it has been throughout different periods of.history; it did not tell us how the term should be understood in the future. Indeed,°the developments after the council reflect some confusion, even some contradiction in these matters. In many theoretical writings and commentaries on the council, it is assumed that the particular church is the diocese. Its unity, its specific character, its distinctive vocation are em-phasized. Yet recent developments in liturgical and disciplinary legislation do not give,.much importance to individual dioceses; they give much more power to larger :tinits represented by national or regional episcopal con-ferences. While differentiation on the diocesan level is virtually impossible, ex-cept in insignificant and minor matters, privileges, exemptions, special permissions are easily granted to a larger unit such as a region or a nation. It is clear now that the term "particular church" can be used in two distinct ways. It may refer to an individual diocese, to one congregation around its bishop, or it may refer to a larger unit that comprises several dioceses and possesses a unity that springs from human factors such as culture, history, national inheritance, and so forth. Both uses are legitimate and important. But the meaning ought to be clarified in each case. Reflecting on the relationship of religious communities to the particular church, we cannot sweep away this problem of meaning, calling it purely semantic. The issue of relationship is alive on both levels and brings up different problems that we must face. There is the issue of the rela~tionship of.religious communities to a diocese. But there is also the issue of the relationship of religious com, munities to a larger unit, e.g., ~to the national church, that has its own particular characteristics. In the United States, both issues are alive. Theological reflections on the fact or event of the particular church, or, what is our understanding of a particular church? 1. Christian people throughout their historY were aware of belonging, as it were, to two communities: one, universal, the other, particular. The universal' community is world-wide; it springs from the action of the one Spirit of God, who was poured out on the face of the earth. The entrance into it is through one baptism that is the same everywhere. The particular community is the local one~ For some, the local church means the parish, for some others the diocese, for others again, it may well mean the church in a country. 2. The temptation always existed, and will probably never leave us, to Review for Religious, Volume 36, 1977/5 oppose the two to the point that one is considered important at the expense of the other. But any such consideration is wrong because it tears up the visible body .of Christ. When we speak of the universal Church and the particular ones we. do nothing less.and nothing more than to describe an existing differentiation in the social, body of Christ. His body is one, but it is composed of parts; the whole could not exist without the parts;-and the parts have no life .in themselves. Any separation means death for all; any destruction of natural harmony brings sickness to the whole organism. 3. Paradoxes can be helpful inour attempt to understand such complex differentiation. It can be :said that there is both autonomy and dependence in each member of the body. The particular church is autonomous and yet it depends on the universal Church. The universal (~hurch is itself the source of life for all other churches; yet its vitality comes entirely from the local churches. We may think of the autonomy of the heart in bur body. It will not ~ perform well unless all the other organs let it do what its spec!fic task is; any unwarranted intervention with. the heart,may bring subsequent disaster for the whole body. Yet the heart is totally dependent in its function on the whole body. The rhythm of its beat, the strength of its action, are carefully regulated by numerous other factors and agents present in the living body. If they,.cease . to function, no life-giving blood will flow into the heart. We may not be able to reach~a precise definition for the local church, but reflection through symbols and images can give us a great deal of, under-standing. 4. If we ask now what precisely the source.of differences is among the local churches, we find that it is mainly in the humanity of those Christians who form them, that is, not so much in any specific Christian belief, but in th~ human traditions; history and culture of those who believe. Thus, initially, the Jews and the Greeks and the Romans all received the good news equally, but they built up churches that were marked by their own culture, national customs and characteristics. Thus there were soon Jewish churches, Hellenistic Churches, and churches of the Romans, all part of the "same universal Church, yet all different. .Later, the inhabitants of Ireland, of England, of the Iberian peninsula built their churches on the universal elements of Christian faith, worship, " and discipline, and on the particular elements of tl~eir own inheritance. 5. The situation is not much different today. Here and there, an isolated di6cese may be found that has its own distinctive life as a diocese. The Christian community of a Pacific Island may well develop.distinctive traits that no other diocese in this world can possess. But such cases are rare today. More often there is a regional unity. The dioceses of Alaska form a natural unity that is quite different from their sister churches in the South. A Theology of the Local Church and Religious Life / 671 There" might also be a national unity. The dioceses of Japan are not mark-edly different from each other; the strong unity of the culture and traditions on the four islands is manifest in the particular church of Japan. Even a whole contir~ent can display a unity. How many times in recent years we have. heard the churches of South America speaking with voices that were strikingly similar to one another. There are foundations in South America for a specific particular unity that embraces the Christians of many dio-ceses, numerous provinces and several nations. 6. °Such re°flecti0ns and considerations do not leave us with a clear concept'and definition of what a particular church is; but they leave us with a good working understanding of the complex nature of our Church that is both universal and particular at the same time. Our undei-standing reflects the true state of things and.~e do not become captive of romantic ideas that are definitely present in the .post-conciliar writings. Father Karl Rahner himself stresses that there is church whenever the bishop celebrates the Eucharist, surrounded by his community. Such a ViSion certainly corre-sponds to our earliest traditions, but it is simply not realistic today. Few of the faithful ever partake in the Eucharist'celebrated by the bishop, and the size of the dioceses geographically or numerically makes any such cele- I~ration virtually iml56ssible. Our understanding it not in adopting clear theories. It is much more the perception of the changing, shifting realities of the Chi~rch. That is how it should be. The duty of Chri~tia.ns to uphold the particular church; or, how must we confess in word and deed our belief in the particular church? At this point, two facts stand out. One is that there is no Christian Church without particular churches, as~there is no human body withotit members. The other is that there is no Christian who does not belong, somehow, to a particular church, as there is no individual cell that does not belong,to a distinct organ in the human body. No one can; therefore, belong to the Christian Church without assuming the duty to uphold a particular church, although this duty may well be differentiated according to the condition of each one, as we shall see. There is no direct and immediate entry, into the universal Church, since it is the communio of local churches. Interestingly enough, not even the pope him-self, who traditionally has been called the "Bishop of Rome," or the "Uni-versal Bishop," belongs exclusively to the universal Church. He is not residing in a territory detached from all particular churches, as the Presi-dent of the United States resides in the District of Columbia, detached from any allegiance to any state. The pope is the Bishop of Rome and belongs to that particular, church, while he is also the head of the universal Church. The very structure of the (2hurch demandsthat there should be aduty on every single person to uphold his own local or particular church. The support to a,memb.er church must always be in harmony and good 679 / Review for Religious, Volume,36, 1977/5 balance with the belief and support given to the universal Church. There is no precise measure to determine how much a Christian should give tohis particular community and how much to the universal congregation of the Church. Such measure can only be determined by taking into account a call and a mandate: the vocation of an individual person or of a distinct com~ munity. Even in the case of the same person, of the same community, the contribution can be shifting and changing according to needs, and their existing capacity to give. Now we have come to the point where we can speak .more explicitly about the duty of religious communities to uphold the local, particular church. It is a duty from which there is no exception and no exemption. But the duty is not the same in every group. Religious ins'titutes that are exempt from the jurisdiction of the local or~linary and subject to the direct supervision of the Holy See, have a f9ndamental universality, a call and a mandate to go to local churches where the need is greater.8 They are freed from the power of the local,.bishop, not in order to be total free-lancers in the Church, but to be free to serve~ anywhere in any local church. Because of the universal call and mandate of such religious institutes, their world-wide organization, their capacity to move from one place to another should be respected. But once they are settled within the boundaries of the local church or in the territory of a particular church in the broader sense, they must blend into the local scene; they must even strike roots in the local soil in order to bring forth good fruit. They should not be a source of disruption, but a source of strength.9 Similar considerations apply to'various communities of pontifical right. As a rule their vision goes beyond the limits of a particular church, their aspirations often stretch far and wide. But they too, are at some place and have the duty to serve the people of God there. Then there are the institutes of diocesan right. They dedicate them-selves to the service of the universal Church through serving exclusively near a local church. They are not superior or inferior to the others; they simply have their own distinctive vocation and dedication. The duty to respect.and to serve a particular church SpringS not only from a law imposed by God through the structures of the Church, but also from the respect due to differences manifest in our human nature and in our historical traditions. The upholding of the local church originates in a deep belief in the Incarnation; in the blending of divine and h6man elements in the Christian community. The gift of God may be similar all around but it takes different shapes and forms in various ~places. Second Question: How Do We Perceive Existentially, Understand Rationally, and Be at Home Practically With Religious Communities? The question sounds broad but the focus of our inquiry is strictly cir-cumscribed again. We do not wish to reflect over all the aspects of the A Theology of the Local Church and Religious Life / 673 existence and life of religious communities. We want to know, to under-stand and help them in their relationship to the local and particular (hurch. This is the proper scope of our inquiry. A short survey of the development of religious communities in their rela-tionship to the local or particular church will be good grounding again for further reflection. Our survey will be limited to a few facts arising in the history of the Western Church. The birth and expansion of the monastic movement from the sixth into the ninth century can be described in a somewhat unusual way: the au-tonomous monasteries that sprang up first in Italy, and then on the con-tinent of Europe, also in the British Isles, had much of the characteristics of a local church. The monasteries were cities of God, distinguished from the cities of man. The brethren gathered around the Abbot to offer their praise and thanksgiving to God.~° In some places, the bishop exercised a certain amount of power over them. In other places, due oftrn to distance, the monks lived and died Within their own monastery, with no interference from any ecclesial au-thority. By the eighth century however, the weakness of being alorie and not being in communication with a broader ~egment of the Church became manifest. Signs of decline and decay were setting in. The eighth century that witnessed the movement of Cluny also saw an increasing awareness of the need forgreater unity am?ng religious com-munities. Monasteries of different places, provinces, regions and countries placed themselves under the power of the Abbot of Cluny. Such close unity clearly constituted a new relationship to both the particular and universal Church. In fact, without the help of the church of Rome, that is the pope, they could not have achieved what they did. With Cluny, an organizational breakthrough had been made. In the eleventh century, the movement of Citeaux brought about again a new type of union of monasteries built more on a bond of love than on any legal structure. In the thirteenth century, Francis and Dominic were certainly dedicated servants of local churches, but soon they moved beyond this: they em-o braced the whole of Christendom. They brought their own new approach toward serving both the local and the universal Church. They had a strongly developed sense of universality, without, however, turning their backs on local needs. ~ ~ The sixteer~th century is the time when new continents opened up. Discoverers and colonizers set out to conquer new lands. That is the time of the foundation of the Society of Jesus. The Jesuits seemingly had no allegiance to any local church. They were devoted to the pope. But further examination shows that while they set out on their apostolic journeys, often 1574 / Review for Religious, Volume 36~ 1977/5 sent by the pope himself, for the sake of the universal Church, once they arrived, they went to extraordinary lengths to build and to uphold local churches in India, in Japan, in South America. Paradoxically, they left thei,r native churches to become all to the natives in faraway places.~z The nineteenth and the twentieth centuries bring a new development. There are many apostolic foundaiions; some more for the sake of the universal Church, some definitely for the sake ofparticular churches. Both trends are represented: to serve the universal Church, and to work for the welfare of local churches. Here our historical survey ends and our reflections begin. The ecclesial Character of religious communities; or, hdw are they related to the Church? Our .aim here is to articulate with some clarity an understanding of the obvious fact of history that religious communities exist in the Church and they are in the service of our Christian people. 1. The birth, the development, the existence and the work of religious communities is nothing else than a particular manifestation of the life of the Church.~3 A religious com,rnunity, independently .from the ~:hurch, has no life. When a community prospers, it is growing in the life that was given to the Church. This statement should be stressed today ~ince some religious comn~unities have become soinvolved in reflecting on their own life that they hhve lost sight of the source of their life. They work within a- narrow horizon, and never find what they are seeking so anxiously. Also, once we understand the fact that there is no life in religious communities except what comes from the Church, it is easier to understand the history of those communities which once prospered spiritually but later grew old arid died. There is not necessarily any shame~in that. Human persons too. are born, develop, prosper, grow old and die. God may well call a community into existence to provide for the needs of the times; he may well call another one for new needs. We are not privy to his designs. We should give praise for the vocation we have and should not covet what we do not have. Those who are ~nxiously asking whether or not religious life will survive lock themselves in(o the limits of a wrong question. The right question is: is there an abundance of life in the Church? If so, that life. will manifest itself in new ways that we cannot foresee. There will be always foolish persons around, such as were Francis of Assisi, Ignatius of Loyola, Teresa of Avila, to surprise us, to shock us, and to entice us to follow them. If we put our hope. where it naturally belongs, that is, in the Church, our anxieties may well disappear.~4 ~ 2. A religious community may have many goals, all of them good and right. But there is a built-in purpose in .every community that seeks and obtains approval from the Church. They. publicly proclaim that the words of life are with the visible Church. They want to be publicly recognized by the Church, they want to have their way of life authenticated as good enough to follow Christ. A Theology of the Local Church and Religious Life / 675 The legal formalities of obtaining approval for a new religious com-munity have a deep theological significance. As often happens in the Church, the beauty is all within. A community asks for public incorporation into the strtictures of the Church. Such a quest is the fruit of an act of faith in the wisdom and the power of the Church. When such incorporation is granted, behind the test of the document there is a quiet recognition that the Church has seen grace operating in the community. It is an approval of the way of life of the group, of their service to thee community. The foundation. for the understanding of government and obedience in religious commu-nities is their ecclesial character. The Church gives them a public mandate. When they accept it, they obey the call to service.1'~ 3. Ye~, the mandate from the Church does not make all the ]zommunities the same. Each retains its own particular character and personality. Each is called to serve both the universal and local church in different ways. There are and there will be communities Who have their origin and the scope of their life within a local or particular church. There they were born, there they live, work and die. We all know such groups. Their gift is precious beyond telling.In Lesotho, who can serve the local church better than a congregation of native sisters? There are communities whose organization may spread throughout the ~niversal Church. Members are easily transferred from one place to an-other, according to need. Their vocation is to blend the universal mission with service in one place. The Franciscanor Dominican friars or the Jesuits would be typical examples of'suchcommunities. But let us recall that when a Eurbpean is sent to Japan, and takes up some apostolic work there, his mandate is to affirm and uphold through every available means the church of Japan. Missionary adaptation or "incuituration" is really an effort.to-ward building the local church. No matter how universal the vocation of a commu,nity is, eventually service must be given at a place that is the local or particular church. The duty of the Church to uphold religious communi.tiey; or, how can religious communities be "affirmed by the Church? The Church affirms a religious community through the act of public approval. But that is just the beginning. The initial act should be followed by unceasing help and encouragement to promote the integration of reli-gious into the life of the Church, both universal and particular. Respect for the ,way of life of each group should be the fundamental rule that governs the attitude of the Holy See or of the diocesan bishop. There is no single rule to say how this respect should go. , In the case of a contemplative monastery, respect may ~nean the ap-preciation of the prayers~offered by those monks and nuns, of the sacrifice of their lives. In the case of an apostolic community, the situation is dif-ferent; they are taking part in the practical work of evangelization. The 676 / Review for Religious, Volume 36, 1977/5 Church mandates them to preach, and to perform deeds of charity. They should be given an opportunity to share their experience with others. I.n the diocese, they should=be taken into the planning, even into the decision-making, process. Indeed, there is an ancient tradition to invite abbots of independent monasteries and, a newer practice, to invite superiors general of exempt religious, orders, to an ecumenical council. To have religious present at synods, held either on regional or diocesan levels, would be not only fair and just, bfit it would be according to our traditions, too. Such can be the affirmation of religious life in practice. At this point it is interesting to note that the development from synods to episcopal con-ferences is somewhat a departure from the old tradition of the Church. Surely, the episcopal body has a unique position in the universal Church, and the residential bishop is in charge of his diocese. But the bishop needs the religious to carry out well their own mandate received through their consecration. I~t is, necessary for them to be in steady contact with religious who carry so much of the burden of daily work in the Church and the churches. If reiigious share the pastoral work of the bishops, they should also have some part in planning and evaluating the same work.~ Third Question: What Is the Relationship Between the Particular Church and Rer, ligious Communities, and How Should This Relationship Develop? The relationship between a particular church and religious communities is a dynamic living relationship that must be created anew all the time. Legal norms cannot do more than give a framework that is always in, adequate .to generate life, but good enough to protect life that comes from deeper sources. Legal norms by their very nature are abstract, impersonal, and general. They are meant for typical cases irrespective of the persons inv61ved, and of their historical circumstances. But in real life there are only concrete situations and living persons and communities. The relationship depends on the personality of the bishop on the one side, of the religious community on the other side. They must work out their relationship concerning particular issues,lr Perhaps this.relationship is best described through analogies. The ob~,ious analogy of call and response can be used. The bishop calls on the religious community and asks for help to build the Church, to announce the good news, to do the good deeds of charity. When the re-ligious hear this call they must respond out of their own resources. The response of an enclosed community may well be in offering prayers for the needs of the diocese; the response of a group of Dominican friffrs may well be in preaching in' the diocese. The religious too, may call 'on the local church for help and encouragement; they may well need it. A Theology of the Local Church and Religious Life / 677 They may play another role in the diocese. They may call people to a better service of the Lord. They can act as the conscience of the com-munity. Their independence and freedom allows them to do so, provided they can do so without presumption.18 The analogy of the body can be recalled also. The religious community must find its own identity in the body of the church, before it can function properly. The community is a member of the local church, with its own structure and role. It would not be in the interest of the local church to weaken a member group. On the contrary, it must promote their welfare, It must respect theii- identity, must use them properly for the purpose they have been created.19 Such relationship cannot be regulated 'by the rules of justice only, Justice gives birth to rights that must be respected, and certainly should not be bypassed and neglected: Nonetheless, a living dynamic relationship cannot be created if both sides stand on their rights. Such an attitude would lead to a dead end where all the participants become captive to their own rigidity and: dedication to strict justice:2° ~ Good relationships between the local church and religious living and working in it must be created'continuously by both sides. There is no other way of creating it than by charity thiat means to give. Neither side should ask first what is due to them, but rather what is 'it that they can give to-the other. Only then will there be a new spirit that builds the church instead of destroying it; a new spirit that brings unity to the whole body instead 6f fraffmenting it. ~ Conclusion As we reach our conclusion we may well experience contradictory feelings. On the~one side, we experience frustration. After ali we did not succeed in finding precise rules and fixed principles tO determine ihe relationship of the local church and religious communities. We found only changing ,and shifting patterns and the need to create relationships where they do not exist according to our expectations. On the other side we experience contentrhent because we are guided by the Spirit of God and the intelligence of believers rakher than by rigid rules. After all, the Lord himself did not give many detailed instructions to his disciples. He gave them his Spirit to guide them in all. With the help of the Spirit they have built the Church. They were guided more by a person than by words. Our hope, too, is in a person, in the same Spirit of Christ. He is with us, in the local church and in the religious communities. Yet, our hope is also in the dedication and intelligence of Christian people on both sides, in the local church and in religious communities. They; together, can create their relationship anew. 678 / ReOiew for Religious, Volume 36, 1977/5 By dOing it, they will experiencethe joy of the Incarnation; they will share theagony of the Cross. Yet, throughout it all, they will 'be blessed and will know a contentment that is in a small way the anticipation of the gift of the Resurrection. Notes I. Parvus error in principio magnus est in fine in "De ente et essentia," begin~ning. ~ 2. Such understanding is the fruit of both contemplation and rational reflection. We must first accept the mystery through faith and then seek the understanding of it. 3. We do not intend to down-play the importance of a diocese. It is a natural unit in the church, ,sacramentally and organizationally. Nonethe-less, the life of a given diocese ordinarily does not differ significantly, if at all, from the life of neighb.oring dioceses. But, often enough,.a group of dioceses displays significant differences from the way another group .lives. The local churches of Holland form a unity that is quite distinct under many aspects from the d!oceses of Germany. Organizationally, the division of the universal Church into dioceses is of permanent importance; but, histori-cally, the larger units have played a more importapt role. The term "par, ticul,ar" is used in our text loosely; its meaning is to be determined from the context. At times, it refers to a diocese. More often it refers to a larger unit: to several dioceses grouped together, displaying a common understanding of the mysteries, using similar rites in worship, cooperating closely in apostolic work. 4. The theological principle cannot be stressed enough. We do not begin with a definition; we begin with the contemplation of an event in the history of the Church. We seek to reach some understanding through the con-templative perception of the mystery. Therefore, our vision will never be so complete as apparentlya definition is. Even if we are able to reach a good understanding, it remains incomplete and leaves plenty of possibility for further pr.ogress. 5. As succeeding generations of Christians may focus on different as'- pects of the same mystery, and give practical emphasis to their vision, in a similar way, churches existing in the same historical period may build up differing~understandings of the same mystery, and order their practices acc.ordingly, not in the sense of Contradicting each other, but rather, in the sense 6f completing each other's perception. The same mountain can be looked at. by explorers from the North, and by explorers from the South. Their differing vision of the same mountain is complementary, not contra-dictory. The contemplation of God's mighty deeds in our history, deeds that are certainly permanent, gives rise to perceptions and understandings, that are diStinct and complementary. We see the origin of particular churches in such different perceptions, followed by different practices. A Theology of the Local Church .and Religious Life / 679 6~ At any time of Christian history, a diocese can be called a particular church organizationally. There is one community, with a bishop presiding over it_But beyond any Organization, there is a sacramental unity in the diocese; if the universal Church is a sacrament, so is the diocese. "This Church of Christ is truly present in all legitimate local congregations of the faithful which, united with their pastors, are themselves called,churches in the New Testament" Lumen Gentium, 26. 7." Vatican Council II strongly upheld th6 dignity of, and the right of, the local church.' For instance: "That Church, Holy and Catholic, which is the Mystical Body of Christ, is made up of the faithful .who are organically united i6 the Holy Spirit through the same faith, the same sacraments, and the same government and who, combining into various groups held together by a hierarchy, form separate churches or rites. Between these, there flourishes such an admirable brotherhood that this variety within.the Church in no way harms her unity, but rather manifests it. For it is the mind of the Catholic Church that each individual church or rite retain its traditions whole aiad entire, while adjusting its way of life to the various needs of time and place" Orientalium ecclesiarum, 2. 8. A paradoxical statement; nonetheless it is true; Exempt religious orders mostly used their freedom from local episcopal jurisdiction-to go from,one place to another, either to help the churches most in need, or through missionary activity, to give birth to new churches. Sometimes the privilege of exemption helps specific activities in the service of the universal church, such as, to :sponsor an International School of Theology in Rome or elsewhere. 9.' The strength they give to the local church eventually rebounds to the strength of the whole. 10. To describe the monastic movement in terms o'ffuga mundi, that is flight from the world, only~ is to do injustice to history. Granted that to flee the world was an important motive for people who wanted to join the monastic community, still theii" main motive was to build the city ~of God among the cities of man.°The monastery was as self-contained as the Small cities built on the tops of the hills and mountains of Italy. Yet, there was a difference: praise and thanksgiving were offered, t9 God, day and night. The task of th'e earthly city wasopus hominum, the work of man; the task in the city of.God° was opus Dei, work thai belonged to God. Admittedly, the theme 'of "fleeing the world" is stressed in contemporary monastic lit-erature. But such writings must be contrast+d with documents, such as the Rule of St. Benedict, where the ongoin, g praise of God and his service takes the central place; also, with the fact that the monks did not hesitate to go out into the world "of barbarians in central and northern Europe to bring them the good news of Christ, and to teach them all that they found precious in human culture. A monastery could truly be called a,"local" or "partic-ular" church except, perhaps, for the fact that it was not presided over by 6~!0 / Review for Religious, Volume 36, 1977/5 a bishop. But the monks were dedicated to the service of the universal Church0probably more than they realized. Without understanding their universal orientation, we cannot understand the conversion of Europe. For a wisely controversial book on the rise and fall of religious com-munities, see Vie. et mort des ordres religieux by Raymond Hostie (Paris: Cesclee de Brouwer, 1972). For a classical exposition of the development of religious orders, see From Pachomius to Ignatius by David Knowles (Oxford: Claredon Press, 1966). 11. The Middle Ages, also, saw the foundation of religious orders that were principally devoted to the works of the universal Church. There were orders' to promote the Crusades, or to take part in them; to protect the possession of the Holy Land; to give themselves for the redeeming of the captives, and so forth. 12. Thi~ history ofthe Jesuits shows eloquently that the service of the universal Church can never be separated from the service of particular~ churches, and vice versa. They could not have been more dedicated to the universal Church. They accepted a mandate from the pope, and the pope only. Yet once they established themselves at a given place, they did everything to enter into the culture of the natives. They helped them, in every way that was compatible with Christian faith and the universality of the. Church, to build new churches with strong particular traditions. In China, they devised and fought for specific rites in the vernacular suitable for the Chinese culture and mentality. They attempted to do the .same in India. In South America, they sided with the natives against the con-quistadores, and gave life to local churches within the framework of the so-called "reductions," that is, autonomous Indian settlements leading a strong community life reminiscent, somewhat, of the early church of Je-rusalem. History shows that to serve the tiniversal Church redounds to the good of Particular churches. 13. We like to stress that the life of religious communities is nothing else than a particular manifestation of the life of the Church. There is no such thing as the Church on one side and religious communities on the other, eitherhelping each other inharmony, or being in open conflict. The member is not .separate from the body; all life of the member is the life of the body, Religious life cannot be conceived of as charismatic life independent and separate from the institutional life of the Church. Charisma and structures, although distinct, can no more be separated from each other in the Church than the flesh and blood of a human person can be separated from his bones: The skeleton, ugly and unfriendly as'it is, gives support and proportion to the beauty of the flesh that covers it. Charisma and institutions must work' together. ~ 14. There is no need that is as. great today as the need for purification of our faith in the Church, and the right understanding of what ,kind of A Theology of the Local Church and Religious Life / 681 community Jesus has founded. One conception should be discarded right from the start (in the terms of Karl Rahner, it could be called a "silent heresy"): the Church is a community of holy persons throughout. While it is true that there will always bepersons of extraordinary holiness raised by God among his people, there will always be many in the Church who are sinners, and glorify God by proclaiming his mercy. The Church is a human community, a community of sinners. Yet, because the Spirit of God is faithful to her, she will never lose or corrupt the word of God, provided the proclamation of the word takes place with ~'ull apostolic authority. Human limitations and fragility, however, will always be present and manifest in the Church till the end of time, be it in the hierarchy, be it in the people. To love the Church means to love the community as it is, and above all, to have the internal disposition to give what we can to this community. There is little love in those who continually expect to receive. There is love in those who know how to be compassionate. A religious community is one with the Church if the members are steadily asking themselves what they can give to her so that she can grow in goodness, into a greater likeness to Christ. For a more detailed explanation of these principles, see "How to Be One With the Church Today" in Blessed Are Those Who Have Questions, by Ladislas Orsy (Denville, N. J.: Dimension Books, 1976). Perhaps the best and most rewarding way of acquiring the right theo-logical understanding of the Church is to read and study its history. The real Church, suppprted by the Spirit, is there in its beauty and fragility. A merely conceptual and systematic approach may lead the unwary to a dream--beautiful and unreal. Once a person surrenders to,the dream, he will be frustrated by the harsh and true reality, that is, by the Church as it exists. 15. Indeed, the roots of a theology of obedience in religious life are there in the mandate that the community receives from the Church. There is a sacramental character to such a mandate, since the Church itself is a sacrament. (The seven signs are particular manifestations of the life of the Church.) Obedience to such a.great mandate should not be confused with ob~eying ordinary human rules and regulations that are part and parcel of the life of every community, religious or not. Through the v6w of Obedience, a person gives himself or herself explicitly, visibly, to the Church~ It is the sacrifice of legitimate freedom to accept a mission from the Church in which, behind human~structures, the Spirit of God lives. 16. There are few countries where the health and progress of the Church depend so much on education as in the United States. Much of this ~ork is sponsored, directed, or done by' religious men and women. Yet, when the most important policy-making body for the pastoral life of the Church meets, that is, when the episcopal conference deliberates, or de-cides, religious are absent and are given only a very limited opportunity to Review for Religious, Volume 36, 1977/5 contribute before, during, or after the meeting--a lack of balance, and the Church is poorer for it. °17. It is interesting to note that, with all the ingenuity of canon lawyers at .her disposal, the Church never succeeded in working out clear and entirely satisfactory norms to regulate the relationship between the local ordinary anti,religious communities of pontifical right, or those enjoying the privilege of exemption. Why? Because it is easy to state some theological principles such as: the bishop is the supervisor of~all apostolic works in the diocese; or, religious must be free to i'egulate their internal affairs, and to carry out their apostolate according to their constitutions. But, it is difficult t0 make detailed norms applicable everywhere. Nor will the new proposed legislation overcome this problem. If anything, history proves the insuf-ficiency of strict legal solutions. 18. A religious community of international dimensions can do much to bring a local church out of its own isolation, and to make it aware of the universal Church. The very presence of the members of~a community that works world-wide for the Church is a reminder ~to the faithful that they too belong to a community over which the sun never sets. 19. This implies respect for the particular charism of an institute. The local church should not try to use the religious for work contrary, or alien, to their own calling. 20. While it isright to work for justice, we should never lose sight of the ¯ fact that justice is the minimum of charity. Justice can proclaim what is due to each person and group and does establish a balance in the life of a human community. Yet the stability of an organization built on justice only remains precarious.To achieve contentment and happiness, it is necessary to ttave charity all around. By charity, we do not mean charitable handouts, but strong love that consists in giving, not only advice or things, but ourselves. A society in which each vindicates his or her own fights is built on a shaky foundation. A society in which each one is intent on giving what he has to others, is like a house built on a rock. This is obviously true of the Church, but it is equally applicable to any secular society. The great national'heroes of the past were those who were able to give to others, not counting much what they were giving. From what we just said, rio one should conclude that ttie cause of justice is not urgent, and that we should not work for it. Quite simply, as Christians, we must say that justice, in itself, i.s not_enough. The strength and perfection of love is a vital need for every human being and every"human society. The great idea of balance and welfare through the virtue of justice ought to be completedby the foolishness of love that God revealed through his Son. See the Conclusion in Morale Internationale, by Rene Coste (Paris: Desclee, 1964). For general orientation about the great problems of the world, and for spiritual recreation, all at once, see Return to the Center, by Bede Griffiths (Springfield, IL: Templegate, 1977). From the Center will those actions flow that bring love, peace, and justice to all men. Prayer: Adventure Into the Unknown Cecile Godreau, M.M. Sister Cecile worked for eighteen years in Bolivia where she was active in spiritual direciio~ for young religious. Presently she resides with the M.aryknoll Sisters; Maryknoll, NY 10545. Today there is a thrill at the very thought of the unkno~,n. Is there life on Mars, on Jupiter, or on the planets around other suns? If there is life, is it more advanced or more perfect than the life forms we know? What about our own planet? Are there life forms we have not yet explored? What about ¯ those areas on earth where men have never or rarely ventured?.What secrets do they hold? There was a time when the knowledge of the unknown would have inspired us to build protective areas, or at least, to introduce taboos for safety's,sake. Today we want, and are drawn to venture into, the heart Of the unknown. I would suggest to anyone with a bit of explorer's blood, and ~,h~ has a heart desirous of giving beyond what is often a dull, everyday existence (called life), to join me in a consideration of a great adventure. This ad-venture is so unique and so intensely personal that it is different for each -one. It is so thrilling that the one who goes on this journey will need an eternity to finish it to discoger its source. I mean prayer, God's version of p~ayer, called spiritual life by some, mysticism or i:ontemplation.by others. I call it adventure: God calls: maybe, he proffers a mind-blowing call, the kind of call that, as in the life of St. Paul, knocks us down when we are riding high. Maybe it is a call as quiet as an evening calm. Or, maybe it is a call after a powerful experience in a Common pCayer situation because of, or with, an unusually charismatic person's approach to our weak defenses. Again, maybe it is merely the movings quietly within that crumble all our preconceived plans and leave 683 684 / Review for Religious, Volume 36, 1977/5 us stunned by silence, or the slow and burning love that somehow separates us from our past. It is impossible to mention every situation, for from the time of this very conversion, it is different for each. God knows how best to invite us into the great adventure. Once we have been converted, we are left to find our way into God's country. Like the prophet Elijah, we realize that God is not in the con-version, not in the earthquake or thunder, but in the whispered breeze. Even trees, whose job it is to let us know when a breeze is near, are often u~nmoved by the gentleness of a tiny breeze. But we are made with hearts attunedif we will but go into our hearts to see and hear what is taking place therein. Some stop here. It is difficult to go within. Our culture has worshipped the extraverted, the active, the expressed word. Our people are expected to tell the world how they feel about everything. So it is almost impossible to have a silent center within us. We are not accustomed to going deep within where God is waiting for us. We are afraid to find out how it is to meet God in our'hearts. We are afraid to discover life within because someone may think we are not socially-minded. People may think we are not committed. "Alone in our hearts where God resides" has a scary sound to it, or, perhaps, even neurotic. What is God doing inside when we have been shouting to him from afar? Some break through and come to the God within. For them, He is Father, or Jesus, or maybe an inner awareness or "presence." Here we are bound to kneel in silence. Even our vocal prayer and meditations come to a halt. As the silence deepens, we wonder if it is right to be here. And we need help so often to just sit and enjoy what it is to be with God. Here we need often to be assured like children. We are moved to love so deeply, we may think we are a little "different." We search for others to understand. Often there are few around who dare to talk about this. We are alone and happy, deliriously in love, or quietly secure. Our God is like a mother nursing its child, a child being embraced by a loving mother, or held like an infant to a father's cheek. As we settle down like Peter to build tents for our experience, Jesus reminds us it is time to go back down to the bustle of the city. Our first reaction to move on is, "I thought this was it!" We balk at being born, and we refuse to leave this hallowed place. So God "puts out the lights" so to speak. Here many get discouraged. Yes, they lose heart. Why? Because all was so comfortable. Here people try to find other loves and ways. They are frightened because they think they have lost their faith. "Faith," of course, is the name mistakenly put on the experience of God within. Faith,-in fact, is the stepping out into the darkness that God directs us toward. We "explore" Faith by putting our hand into the hand of the resurrected Jesus to go out and discover what it is to be Jesus, Son of God. We are going to have to molt our skins of the intense joy and the security Prayer: Adventure Into the Unknown / 685 that we had, and we realize that we are vulnerable. To put our hand into the hand of Jesus is not a journey deeper within. It is a journey beyond our human limitations. Here Jesus who directs our adventure gives us self-knowledge. We might get discouraged and have the feeling of one who has climbed too far, too fast. We are aware of our smallness. Yet, Jesus who helps us on our journey is intent on leading u~ onward. When we reach the place he means us to explore, he does a very strange thing. He lets us see our world through his eyes. We might find ourselves somehow knowing what Jesus means in his gospel. Somehow, we tread through life as Jesus did. We, little by little, begin to know ~vhat it meant for Jesus to have been driven by the Spirit. Now we no longer seem drawn within. Our eyes are cast out onto our world! How terribly important each person we meet becomes! We are not sure we are loving others as our-selves, or as Jesus, because we are somehow filled with a compassion beyond our own. We are almost sure our small selves are being used by Jesus. Yet, all along the way, we are aware of the difference. Our real selves come to light. We find fewer and fewer excuses for ourselves, and we are driven deeper into our faith. For some this step is done very quietly, almost imperceptibly. Some cry, "I no longer know if it is me or Christ living in me," while others go deeper into faith, knowing only that they must go on seeking a water to quench the thirst of "Everyman." Here each one is given something of Jesus to use for Others. Little by little, the awareness of self is lost in the dream of bringing solace to others. 'Here we lose touch with our world because it claims to do what we, in fact, are made ~over~ tiy Jesus to really accomplish. We talk a different language, and our agony is this language. We no longer speak as men do who have tongues in cheek. Our new simplicity makes us a target for the clever and the powerful. Yet we seem to be drawn to quietly go on. our wills and intellects, no longer bound up in our feelings, are sharper. We are able to see our. way better than before, and our way takes us, like/Jesus, into the Father's will. We delight in our brothers, whether large, smzll, sinful or ~,irtuous. We ar~ at last able to see the God hidden in each. We know what it is to be Jesus. We begin to desire with all our strength to build a temple to our new-found religion. Jesus will be our Master, and we will do our worshipping strongly for a new world. We will be the Jesus of this world. It seems we have arrived, and yet--yet, God has just brought us to a new faith. It is as though all the experiences we have had were pu! in a vast sea, and we were set afloat in the tiny boat of our new faith. No longer do we feel the strength of God, nor see the glory of Jesus. We are asked to ride a stormy sea in a skiff. There is only one thing to do: trust. We are terrified by our nothingness, as we are compared, not with men, but with God. This death experience is the most terrible and the most beautiful experience of our lives~this realization of what we are without 686 ,/ Review for Religious, VOlume 36, 1977/5 him. The deep peace that has seen us through that dark and light of our lives is a must now, and we hope it is real in this stage of our adventure. Here, too, each person is different, and comes to this at different times. Once we have opted for death, we are given a faith that we never thought possible: No longer a faith held up by our deepest feelings, nor one seeing the progress of Jesus in our lives, but the faith that believes because one holds on to God beyond any reason. We go into the darkness to be pulled out now not trusting ourselves, our "faith," our ways, even our religiosity. We are pulled out swinging from a thread like a string puppet. We go from anger, to despair, to surrender. Surrender, which once sounded so terrifying, is the beginning of life. A dark faith is given us. No longer do we explain, or sing to it, orhold it as a precious keep-sake, for we realize.it is simply gift. We are now ready to walk back with a song to our native home. Nothing can really make us fear again. Our wordless love is for God, the Great Unknown. God, who lias been badlyexplained over and over by ourselves and others, takes us into himself. It is as though welook for our small boat, only to see it has disappeared. We are at the beginning of an intense desire. Longing and homesickness set in to show us how intense ourodesire is for God. Yet, he turns us back to live again among his people. He gives us each a seed to nurture, and when grown, to share the fruits with others. Some are so overwhelmed by this that they fall into silent prayer, agonized with the weight of their message. Others are filled with speech, a babbling speech, yet a speech that can be recognized as a song of God. One can open one's eyes and God has grown unlimited. We hasten to meet him, only to find that at this point, he spreads out in all directions. One is surrounded by God, silence, and it will take an eternity to begin to explore, to begin our adventure into this great unknown. How much we desire to begin to go towards our deepest love, and at least arrive at the first steps toward an eternity of ~urprises, peace, and our Source. We are willing to live a thousand years, if that be what he desires. We ~ealize that creation needs our new song which we, like God's trou-badours, will sing, with hearts somehow free and waiting, in this new-found peace, his last call. An Apostolic Spirituality for the Ministry of Social Justice Max Oliva, S.J. Father Oliva is the Director of Social Ministries for the California Province of the Society of Jesus. His special interests are the theology and spirituality of Social justice. He conducts workshops on these two themes as well as on. other aspects of social justice. He is also Associate Director of Field Education at the Jesuit School of Theology at Berkeley. He ~resides at the Jesuit School of Theology at Berkeley; 1735 LeRoy Ave.; Berkeley, CA 94709. Introduction We hear a lot of discussion today about the need to promote justice in economic, social and political structures. It takes only a cursory reading of the Bishops' Synod Statement, "Justice°in the World," tofind the Church issuing this call: Listenihg to the cry of those who suffer violence and are oppressed by unjust systems and structures, and hearing the appeal of a world that by its perversity contradicts the plan of its Creator, we have shared our awareness of the Church's vocation to be present in the heart of the world by proclaiming the Good News to the poor; freedom to the oppressed, and joy to the afflicted) How does one pursue social justice in the light of one's faith? How do we in.corporate and integrate the important ingredients of our own need for personal contact with marginated and oppressed people and the ongoing process of conversion that each of us must undergO? Row do we bring about a balance between our faith and our practical efforts for changing structures? This article offers some reflections on an apostoli~ spirituality for changing social structures, a ministry which can be a part of anyone's life and ministerial vision. The thoughts expressed here are the result of the tSynod of Bishops, 1971, "Justice in the World," page 1. 687 61111 / Reviewfor Religious, Volume 36, 1,977/5 author's reflection on his own ministry, both in inner-city Black commu-nities and in efforts to change social structures,z What do we mean when we talk about changing social structures? The most obvious example of structural change that comes to mind is the effect that a state or federal law can have on a whole range of institutions and the people in them. Take, for example, the Equal Employment Opportunity Act, which has had the effect of requiring businesses to hire minority and women workers, in responsible positions, or lose federal contracts or be taken to court in civil action suits. The ordinary citizen's role in promoting such a law might have been to draw attention to the injustices present before the law was passed by some kind of advocacy effort. Another example of structural change, again in the world of business: ~in the 1960's, many companies had as one of the standard questions on their applications forms, "Have you ever been arrested?" To the person ap-plying for work from an economically depressed area, this question was an automatic "No" to a possible job since many had been arrested. However, relatively few people had ever been convicted. Successful efforts were made to convince companies to change the word, "arrested," to, "con- .victed," thus opening the job market to a large segment of the community who had up to then been ex.cluded. Closer to home, changing structures m~ght involve affecting admission policies in a religious school so that more min.ority students might be able to attend, or, influencing a province so that an essential criteria for being a superior would be that she or he is strongly committed to justice. In both of these cases, an individual's action can have results that change the structures involved and thereby affect many people in the process. Basically, structures, systems and institutions of society are the frame-work in which human relationships--personal, political, economic, cultur-al~ take place. Social justice seeks to assess the worth of social structures and systems in view of how they impact the lives of people in them, or exclude people from them, and calls for personal responsibility for these structures. There are many ways to influence social structures, be it through actions to promote just state or national laws, be it efforts to affect international systems, or by way of altering a policy in one's own institution or com-munity. Whatever the means chosen, certain basic dispositions are neces-sary for such efforts to be realistic and, thus, effective. The first and pri-mary disposition is to be on the side of the economically po, or and politically powerless, as an advocate for their rights. In St. Matthew's gospel (15:29-31), we find Jesus sitting on a moun-tainside. There, "large crowds of people came to him bringing with them ~'i'he author is also indebted to Workshop participants who have given valuable feedback to the ideas expressed in this article. A Spirituality for the Ministry of Social Justice / 689 cripples, the deformed, the blind, the mute, and many others besides. They laid them at his feet and hecured them." What is particularly striking about this scene is not so much the cures, though, of course, these are marvelous signs of God's presence, but that Jesus actually, physically, touched these people: the crippled, the deformed, the blind, the mute--the marginated and outcasts of his time. Today, we, because we are Christians, are called to do the same, to touch the poor and oppressed of our day, those who are often different, from us by economic background, by color or culture, by education, perhaps by some kind of physical or mental handicap. To touch these, people means to have some ongoing personal contact with them, in order tolearn from them--their needs, their suffering, their aspirations, and their richness. To touch these people involves, paradoxically, a healing in ourselves, a deliverance from our prejudices, convictions, and attitudes, an escape from apathy, and an awareness that has deep within it a sense of urgency that justice be done. Such personal contact insures that our com-mitment be an "affair of the heart." Such contact is essential if our ministry of changing unjust .social structures is to be realistic, that is, meeting real needs. This ongoing personal interchange with oppressed people and an alert analysis of the structure we wish to change are basic dispositions for a ministry of changing social structures, be our work in schools, hospitals, a parish, retreat house, mass media, social ministry, or whatever,z Some Basic Principles The cycle of poverty is often described as consisting of: apathy--aliena; tion frustration--ignorance--hunger---despair. These words can also be used to describe our own state of mind and heart as we contemplate unjust arid dehumanizing structures. The problems seem so vast, the structures so complex, that we simply despair of moving at all to influence or try to change them. We need to begin our consideration of an apostolic spirituality for social justice ministry by taking a close look at some basic principles: 1. That each of us can be part of the change process for a more just world: by our choices, by our life-style, by our life-stance. No issue is so ambig-uous, no structure so complicated that we are unable to do something to influence it. ,~ 2. That other people--those we live with, those we work with, our stu- 3Personal contact with oppressed people, is also necessary for one-on-one kinds of service, such as spiritual direction, for the purpose of such ministry is to help the person clarify and deepen his relationship with God and challenge, when appropriate, the way the person lives out this faith in relation to the world. The director can be an excellent resource for helping the person being directed to see the intimate connection between faith and social justice and to discover ways she or he might effectively act to change unjust social structures. It is only by realizing this connection in his own life that the director will effectively communicate this message to the one being directed. 690 / Review for Religious, Volume 36, 1977/5 dents, parishioners, retreatants, fellow workers--can be reached and can change in their attitudes, in their values/in their standard and st.yle of life. Why? Because, like us, they are of good will. True, like us, they suffer from ignorance about those who are poor, are often insulated from those who are economically poor and politically powerless, and sometimes accept myths about the poor as truths. Still, they do not deliberately will the destruction and dehumanization of others any more than we do. They, too, seek hap-piness, peace and justice. And, like us, they sometimes get too caught up in self-interest or ignore the social dimensions of their actions. But if we can change, can become more socially conscious, more committed to justice, so can others. 3. That because of God's personal love for each of us, we are each im-portant in the process of building the kingdom of God, a kingdom initiated by Christ and commissioned to us, his followers, to carry on and build, a kingdom which fosters human dignity and equality, and which values hu-man-. development. , 4. That the Spirit is working in and through each of us even as we take small steps to change structures, and can work in ever new ways as we become more resolutely inserted into the world of the marginated and the oppressed. ~. 5. That other people---other religious women and men, diocesan priests, laypeople, Christians of.every denomination, and non-Christians too-are at work, acting for peace and justice, realigning their life styles, taking a critical stance toward the structures of society. This gives us hope. The Center of Our Commitment We are called to this ministry of changing unjust social structures by Jesus Christ, who works with us and whose Spirit is the source of our courage, wisdom, power and hope. God the Father is the center of our lives, the focal point of our identity: his personal love isthe basis of our worth.4 He is our Rock, our Foundation, our Beginning and our End. He is the One for whose sake ultimately we are engaged in the struggle for justice. ~ The more God is our center, the less chance do the idols that attract us and keep us from a commitment to justice hamper our ministry, idols such as popularity, "success," reputation, endless analysis, and the '.;good life." The more God is our center, the more effective will be our ministry of justice, for it will become ever more clearly his work. Because God is the center of our lives, we can develop the kind of apostolic qualities that are necessary for an effective ministry of justice. ~The author realizes that not all people relate to God, as Father,. as the center of their lives. This is the way the author relates to Gbd. To respect this difference, the word "Father" will only be used this once in the article. A SpiritutJlity for the Ministry of Social Justice Let us now consider some apostolic qualities that can help render our actions more fruitful. Apostolic Qualities for Our Ministry of Justice Because God is the center of our lives, we can be radically open: open to growth--intrapersonal, interpersonal and societal (our relationship to human.environments, structures, institutions and processes, especially of asocio-economic-polifico-cultural character). Open to new ~concepts and ideas, such as social sin and social grace, Liberation Theology and the use of Marxist tools of analysis for studying the structures in our socie[y. Open to face uncertainty and fear as we come into personal contact with the marginated and the oppressed people in our society and the environments in which they are forced to live. Open to face our own prejudice, racism and sexism as, they are manifested in attitude and language. Open to face our value addictions as they are reflected in our consumption patterns--the kinds of things we buy and.~why--and in our life style. Open to the pos-sibility of being misunderstood, even rejected, by those ~ith v~hom we speak about issues of justice, be they members of our family, our com-munity, or our constituents. Because God is the center of our lives, we can ~have a capacity for critical reflection such that no ideology, no system or way of life is "sa-cred" (or defines who we are). None can be free of scrutiny, challenge and, if needed, reform, be it: socialism, communism, capitalism, the American way of life and its values, the Church, our own community or the work of our apostolate, Because God is the center of our lives, we are not afraid to face the fact that we are converts to our ideas of justice and the actions we undertake for justice. Thus, we are capable of being ruthlessly honest with ourselves, neither becoming self-righteous nor bitter or cynical. Being honest in this way enables us to have what Thomas Cullinan calls "patient endurance,''~ a uniquely, Christian virtue, which is centered on Christian hope, without losing a sense of urgency that justice be done. Because God is the center of +ur lives, the focus in exercising our ministry of justice is not on "success" as we usually define it. Our success is in the doing or saying what we know we must say to be true to our convictions and the needs of oppressed people. Like the prophets, the doing or not of some word, some action, is not based on peoples' reac- 5Thomas Cullinan, O.S.B,, If the Eye Be Sound (England: St. Paul Publications, 1975), page 121, This is an excellent work of modern spirituality. In particular it uncovers the theological and spiritual foundations on which a socially committed Christianity must be built. Dom Tfiomas Cullihan, O.S.B., is a monk of the Ampleforth community, in England, and a member ¯ of the Commission for International Justice and Peace of England and Wales. Available: Catliolic Institute for International Relations; I Cambridge Terrace; London, NW I, England. 692 / Review for Religious, Volume 36, 1977/5 tions--be they affirmative or negative--not on how many people like us more or not, not on how many people ag~'ee with us more or not, but on being congruent with who we are before God, as we discern it in prayer and consultation. It is the virtue of integrity. Because God is the center of our lives, we can ~possess an habitual facility of discernment. In our ministry of social justice, there are two basic areas of input for our process of discernment. (1) The first element of our input is grasping the "signs of the times," that is, the cries of the poor and the oppressed of our world, their struggles,, their needs, their aspirations, their problems and the causes of these problems. Such knowledge and, more importantly, unders~tanding comes, as we said before, primarily by way'of some ongoing personal contact with economically poor people and those who are politically powerless and is supplemented by books and articles, films, workshops, or whatever means serves to increase our con-sciousness of the problems. Then each of us must lobk closely at her Or his talents, gifts, personality, ministerial strengths and weaknesses, and the kind of ministry she or he is involved in. In a spirit of prayer and with ~:onsultation, then, the discernment-reflection process gradually, organi-cally, and continually enables eiach of us to make action-choices for justice from where we are. For some, such action will involve integrating, social justice into classes taught or into the administration of a school or a hos-pital; for others, it will mean some kind bf political action or public protest. For some, it will mean homilies or retreat talks that show the intimate relationship between one's ~faith and a commitment to act for justice; for still others, it will involve direct service in an inner-city or rural, community or Third World country. Because God is the center of ou~ lives, we can ask him to fashion in us a heart for the oppressor as well as for the,oppressed. Injustice kills the perpetrator since exploitation, tyranny and oppression are sighs of death, spiritual death. We love the oppressor when we oppose with all our strength her or his spiritually suicidal behavior of oppression. With God's help we can enter every heart. For the po. or, we strive to win rights and the freedom to develop humanly; for the rich, we strive to win moral development. It is important to note, though, that the way in which one manifests one's concern for the oppressor will differ according to the kind of ministry one is involved in. The community organizer's way, for example, will be dif-ferent from the high school teacher's. Each develops a heart for the op-pressor in the context of her or his own situation. Because God is the center of our lives, we can have empathy with those who are economically and politically oppressed. Empathy is the'ability'to see life through the eyes of others. In our ministry of social justice it is seeing life through the eyes of the poor. It demands personal contact with people who are poor. It necessitates our taking a "learning stance" in the presence of oppressed people, listening to their needs, their suffering, being A Spirituality for the Ministry of Social Justice / 693 willing to be continu'ally educated by their life experiences and their contact with human misery. Empathy is the key to understanding and thus to be able to demythologize our views on why people 'are poor. Finally, empathy is the way to true solidarity and effective advocacy. Because God is the center of our lives, we can have a freedom from attachment---in the face of anything which is not in line with our primary goal: the will of God and the building of his kingdom, a kingdom which values and promotes human dignity, equality and development. Having our foundation in God allows us to be free from attachment to. any cause or issue, any insight or pre-conceived plan of action, any request, for action, or even our own fear of acting. It is the "single-heartedness" of the Be-atitudes. Finally, because God is the center of our lives, we can have a capacity for suffering--what Jos6 Magafia says in his book Ignatian Exercises: A Strategy for Liberation, "to rejoice in sufferings because they are the hallmark of every ,genuine liberating commitment.''6 Such a capacity en-ables us to make the fundamental Christian option of becoming advocates for the rights of oppressed people. It is also, obviously, intimately bound up with the preceding eight apostolic qualities and with the effort it takes to keep God as one's center. A capacity for suffering is essential for each person~s ongoing process of conversion, and we are all called to conversion: "It is too easy to throw back on others responsibility for injustices, if at,the same time one does not realize how each one shares in it personally, and how personal conversion is needed first.''r Just what is conversion ? One of the clearest descriptions the author has read is the following from Fr. Pedro Arrupe, S.J, Conversion is getting rid of something so that something else can take its place. It is getting rid of everything that prevents us from being filled with the Holy Spirit. Conversion, then, is a change; a change tfiat takes place deep inside us; a radical change. Let us make no mistake about it: there is nothing supdrficial about conver-sion. It is not, for'instance, deciding, after a somewhat more fervent retreat, to "give something to the poor," or to be a little more generous to one's "favorite charity." This is a praiseworthy thing in its way, but it is not conversion. Conversion is not a giving of something that we can well afford to lose. It goes much deeper than that. It is a putting away of something that we are: our old self, with its all-too-human, all-too-worldly prejudices, convictions, attitudes, values, ways of thinking and acting; habits which have become so much a part of us that it is agon.y even to think of parting with them, and yet which are precisely what prevent us from rightly interpreting the signs of the times, from seeing life steadily and seeing it whole.8 ~Jos6 Magafia, S.J., Ignatian Exercises: A Strategy for Liberation (New York: Exposition Press, Inc., 1974), page 117. rPope Paul VI, 1971, "A Call to Action," page 28. 8Pedro Arrupe, S.J., "Witnessing to Justice" (Vatican City: Pontifical Commission Justice and Peace, 1972), pages 25-26. 694 / Review for Religious, Volume 36, 1977/5 Our call to conversion as we pursue our ministry of social justice is not a one-time happening, it is an essential element of the Cross-Resurrection dynamic that permeates our lives as Christians. And conversion does in-volve suffering as well as joy. With God as:our center, we can have the courage to face our own need for conversion and the suffering that ac-companies it, Such suffering is redemptive. Conclusion We are,' each, called to a ministry of justice, but our ministry must take place in the rootedness of our faith lest we become simply good humanists or philanthropists. Our commitment must be founded in the love of God and the "Good News" of his Son. Although this may seem to be an evident" premise, it is easy to lose sight of once we become involved in actual work. We depend on one another for support, for.challenge and tolerance. And we are nourished in our commitment to act on behalf of social justice by our prayer and the Eucharist: in prayer, for it is here in the quiet moments that we can face the reality of just who our center is-~ourselves or God; in the Eucharist, because it strengthens us to face our timidity and fears, it calls us out of ourselves to be, like Jesus, persons for others. Now Available As A Reprint Prayer of Personal Reminiscence:' Sharing One's Memories with Christ by David J. Hassel, S.J. Price: $.60 per copy, plus postage. Address: Review for Religious 612' Humboldt Building 539 North Grand St. Louis, Missouri 63103 Taking the Long View Francis X. Hezel, S.J. Father Hezel is director of the Micronesian Seminar. based in Truk; Caroline Islands; Trust Territory, Pacific 96942 Not too long ago a gentleman visited these islands offering a new eight million dollar college as a gift to the Micronesian people from the U.S. Congress. His offer met with an enthusiastic response almost everywhere. At last Micronesia would soon have its own four-year college! Not a con-ventional college, but one that would be specially tailored for providing training in vocational skills or whatever else is judged to be educationally relevant. I was dismayed by the uncritical enthusiasm that greeted the visitor's offer, well-intentioned though it was. Don't people here know, I asked myself, that the new college will cost almost two million dollars a year to operate? A tidy sum, considering that the total amount of local revenues generated in the Trust Territory is only seven .million dollars at present. Isn't this gesture, I thought, a bit like making a gift to a poor friend of a good-sized German shepherd to guard his house, letting him know as you walk out the door that the animal eats five pounds of meat a day? tin any case, would a new four-year college of any kind help solve the burning question of how to promote economic development? Diplomas abound in the Trust Territory and marketable skills are on the increase. The real problem, of course, is jobs; and this won't be solved by adding another expensive education mill. As long as the goal is to develop Micronesia's resources and make the islands more productive, a new college with an increased capacity can only make a bad situation worse. If you want a person to spend his life in a fishing boat or on a farm, the worst thing you can do is plant him in a chair for another four years. He will very likely never get out of it afterwards. 696 / Review for Religious, Volume 36, 1977/5 Its the old story, I said to myself. Another."gift" from abroad; more hidden costs, social and economic; and the dependency rut gets deeper and deeper. How is it, I wondered,th~at this familiar story is repeated over and over again, even by individuals and groups that profess a commitment to self-reliance? Surely some of them must see the long-range effects of these projects. Consider the response to the Headstart and Old Age Programs, to use as examples two federal programs designed to benefit opposite ends of the population. No sooner was the Trust Territory made eligible for federal funds under these titles than every district opened an office, applied for government money, and began an earnest search for ways to spend it. The immediate benefits of the two federal programs were all too obvious: food for the young and the old, an income for those on the payroll, travel abroad for program directors and their understudies, and the promise of other good things to come. But how about the fact that the~palates of the young were being ha-bituated to breakfasts of tomato juice and doughtmts? What about the danger of families abdicating their strongly-felt traditional responsibility to provide for the elderly? Or the risk of weakening family and community ties, as still another responsibility of theirs is surrendered to a government agency? Then, of course, there is again the matter of furthering the eco-nomic dependence of Micronesia on a global superpower that has military interests to maintain. Somehow these last questions were overlooked in the rush to expand the district payroll and get money rolling in. A paycheck and cases of corned beef are just a bit more real than such intangibles as family bonds and ,psychological dependence. - Do I sound a trifle "anti-progress," or possibly even cynical?.Then let me make a public confession. Neither I nor the staff of the small private school of which I am director have altogether resisted the temptations of "easy money" from abroad. We are receiving federal funds from the six-million dollar Federal Feeding Program, as are virtually all public schools and a good many 'mission schools as well. To understand how an abomination of this sort ~might have happened, you would have tO put yourself in the shoes of a school administrator who is wondering how he will make it to the end of May. without going broke. Local support groups have not come through, the school accounts are just about exhausted, and bills continue to pile higher on his desk. Just then, in walks a federal program officer with a sheaf of papers in hand who proudly announces that he has funds to cover the entire cost of the school feeding program for the year. To the beleaguered school.administrator it is a heaven-sent answer to a pressing problem. Naturally he signs on the dotted line, heaves a sigh of relief, and then settles back to wait for the first check to come. ~ Taking the Long View / 697 That, however, is only the beginning.'A year later the school admin-istrator has to decide whether he shall continue to participate in the feeding program. He knows very :well that the 25 thousand dollars he receives will not raise the nutritional quality of the food one bit. Healthy food is some-thing that teenaged boarding students must have in ample quantity, no matter hbw financially hard-pressed the school may be. He knows that the Feeding Program of which his school is a beneficiary can only further re-inforce the "handout" mentality of a people long accustomed to looking to Washington to pay all their bills. He recalls with a shudder all that he has read and heard about the stifling welfarism of Indian reservations. But he calculates that an additional 25 thousand dollars a year would allow him to build a garage, a maintenance shop and new water tanks which he thinks that the school may need. And so, dismissing the uncomfortable concern he feels for remote consequences, he signs on the dotted line just as he did the year before. Like the others in the examples cited earlier, he has responded to the immediate need and left the future to take care of itself. Micronesia teems with persons like him (or should I say me?) whose decisions are based on answering today's needs at the expense of the future. Jobs, schools, roads and the like occupy our exclusive attention while the hidden costs of these "improvements" and the nature bfthe funds that finance them go uncalculated. This preocc~ipation with the sho~'t-term rewards might be called the national disease of Micronesia and it has infected every part of society. The employee who drinks up his paycheck, on Friday and Saturday to the sorrow of his family for the following two weeks shows acute symptoms of it. So does the fish dynamiter who pulls in his haul, rubs his belly, and leaves the shattered reef to repair itself---in twenty years time. Then there is the young college student who spends the two days before his semestral exams emptying Budweiser cans with his friends, and a week hence is looking for plane fare home from college. Is it simply an accident that a couple of years ago the theme song of the islands seemed to be "Help Me Make It Through the Night?" The people of an island press for Congress of Micronesia funds to erect a seawall, conscious only of the money that will make its way into their pockets, but unmindful of the damage to their sense of community that loss Of locally sponsored labor projects will inflict. Congressmen vote to ap-prove high-cost capital impr6vement projects to be funded by the U.S. knowing full well that the cost of maintaining these facilities will be a financial burden to Micronesia in later years. Top,level policy-makers cam-paign for higher wages for government employees, thereby undercutting any real hope of inducing young people to take up less lucrative but much-needed work in commercial agriculture and fishing. And ,everyone-- parents and educators alike---encourages the greatest possible number of 69~1 / Review for Religious, Volume 36, 1977/5 high school graduates to go off to college without the least idea of how they will occupy themselves when they return. Entrepreneurs with an eye for a fast dollar build supermarkets, bars aid moviehouses, thus helping to send the annual level of imports soaring still higher. Prominent businessmen who are. instrumental in bringing tele-vision into their islands make a killing on sales ofTV sets~ leaving the social consequences anti'the economic effects on families for others to handle. Political decisions, I fear, are made in much the same way. Nothing can convince me that the people of the Marianas, when they signed their Cove-nant with the U.S. two years ago, were as fond of the American Eagle as the dollar on which it 'appears. Yet money buys good things, as I have already ungrudgingly admitted. Whether, however, it will also purchase an enduring social bliss for the Northern Marianas remains to be seen. I have never heard or read a cogent explanation of what any of the separatist districts wants politically and I have despaired of ever doing so, although it is well-known what those districts expect by way of fiscal gains. I can only assume that they desire for themselves whatever their generous benefactors~ desire for them--whether these bene.factors be America, Japan, Nauru, or the Sheikdom of Aden. Surely it would be difficult to maintain that their decisions are. models of political far-sightedness, whatever else they may have to recommend them. But the rest of us are in no position smugly to point an accusing finger at those districts that have sought greener pastures---or, to be more exact, greener bankrolls--elsewhere. Which of the remaining' districts can hon-estly say 'tha~it would not have jumped at the chance to do likewise, had the opportunity been offered? We all seem to have fallen prey to this obsession with the immediate pay-off. It may be that this is an all too human weakness, but it is a frightening irony that our failings should be rationalizedqn the name of "progress" or "development." If development implies anything at all, it suggests a forward-looking approach---one that is as concerned with to-morrow and 20 years hence as with today. With the coming of foreign currency to these islands a century and a half ago, Micronesians were for the first time able to accumulate a surplus, to hoard, to save and invest. Money created the possibility of a "tomorrow" in these islands. By a strange irony, however, foreign money is now being used to freeze us securely into the present and to anaesthetize us against a concern for the future. Not that money, jobs, education, material improvements, and even federal programs are evil in themselves. The real problem is that these and other short-range benefits are so alluring that they overpower more distant considerations. And when they are offered to any of us gratis, their at-traction is practically irresistible. An announcment is made that some new federal program is offering funds to establish national parks, buy library books, or develop curricular materials for teaching the metric system. We Taking the Long View / 699 run to our desks' and concoct a proposal that will enable us to receive our share of the funds. Why not take advantage of a windfall while it lasts, we reason to ourselves. The trouble is that the objectives we set down for our programs can all too easily be inconsistent with or even run counter to broader develop-mental goals in ttie Trust Territory. There's certainly no harm in securing federal money to build a museum in which traditional artifacts will be displayed., or in providing emergency assistance for' rebuilding houses after a typhoon, or in putting up a new sports center at U.S. expense. But we must not be surprised if the cu-mulative effect oUall this on the community is to teach people that Santa Clauscomes to Micronesia every day of the year. Over many a desk in headquarters is posted the inspiring adage: "Give a person a fish and he has a meal today. Teach him how to fish and he has food for the rest of his life." It is very easy to understand how this lesson can be lost on our people today in the face of the mammoth give-away program that enervates our com-munities even 'as it showers on'them its material "blessings." Buyit~g canned federal programs is a lot like buying canned fish. It is inexpensive, convenient and satisfying---an eminently sensible thing to do. But there, are still those hidden costs to be reckoned, as we know only too well. Whether we weigh these costs in making any initial decision or not, they are bound to catch up with us in the end. Those of us who ~take a dim view of ~anned programs funded from abroad---and I include myself hereto so on the grounds that their long-term costs usually outweigh their immediate benefits. These "costs" can be conveniently grouped under three bro~d headings: social, economic and political, although some would want toadd "environmental" as a fourth heading. Let me now suggest a few examples of each. Regarding social costs we may say this. Programs that introduce into a community a substantial amount of money to build a road, erect a com-munity center or feed schoolchildren all too often bring about the pyscho-logical or social impoverishment of the community that they are intended to help. This happens when members of the community decide that it is more profitable for them to sit and wait for things to happen rather than initiate devi~lopment projects oftheir own. At this point, cooperative work by families on community projects sharply declines, and so does what we commonly call "community spirit." When most of its responsibilities are pre-empted by government agencies and alien institutions, the community simply loses confidence in its own effectiveness to achieve anything of real value. The same may be said of the family. As it relinquishes its respon-sibility for feeding toddlers, schoolchildren and the aged, the ties among its members will almost certainly weaken. The obvious question that must be asked of every development project, then, no matter what the source of funding, is whether its effects will be to increase or diminish the social fabric and sense of purpose of the community. 700 / Review for Religious, Volume 36, 1977/5 ¯ Micronesians commonly refer to their islands as "poor"--that is, as lacking adequate income to provide for themselves much of what they regard as desirable. For this reason, there is usually a mad rush to obtain whatever haaterial benefit~ the U.S. or any other country might offer by way of assistance. What is often overlooked, however,, is that certain gifts may make us poorer rather than richer. Expensive hospitals, water systems and airports are also expensive to rriaintain year by year--and the future budget of a "poor" group of islands is bound to be very limited. Moreover, some improvements can require an expanding network of expensive facilities and social services to support them (or clean up the social mess they have made). Take,the case of a costly new high school that is built of sufficient size, to allow all school-age youth in the area to enroll. Soon after the new school opens discipline problems multiply, since there are clearly a large number of misfits who have been accepted in the cam-paign to make secondary education universal. To keep the poorer students in school, a special program for potential dropouts is funded through a federal grant. A recreation center is built and new staff is hired to moderate the center's activities. Social therapists are trained---at additional expense-- and hired to counsel "hardcore" problem students. Mental health facilities and referral centers are established through still another program. In short, everything.possible is done, at prodigious expense, to keep in s~chool young people who never wanted to be there in the first place, As social services and physical facilities proliferate along with the pro-grams that support them, Micronesians are gradually led to believe that a society without expensive gadgetry and quackery is entirely impossible. To have a school without sliding classroom dividers or a hospital without sophisticated laboratory equipment becomes unthinkable. It is no wonder that Micronesians have come to believe that they can't live without an extravagant subsidy from abroad! Naturally this means that they will have no recourse but to continue living in the shadow of the American eagle--with all that this implies politically and militarily. Very few decisions today are simple decisions. Most have far-reaching implications on the future social, economic and political order in these islands. We know this only too well, of course, but all of us still must adjust to making decisions at times as if there were no tomorrow. Until all of us learn honestly and openly to weigh the long,term effects of our choices, not just count the immediate gains; we will be deluding ourselves

Issue 33.2 of the Review for Religious, 1974. ; Review ]or Religious is edited by faculty members of the School of Divinity of St. Louis University, the editorial offices being located at 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. It is owned by the Missouri Province Educational Institute; St. Louis, Missouri. Published bimonthly and copy-right (~) 1974 by Review ]or Religious. Composed, printed, and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $1.75. Sub-scription U.S.A. and Canada: $6.00 a year; $11.00 for two years; other countries, $7.00 a year, $13.00 for two years. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money order payable to Review ]or Religious in U.S.A. currency only. Pay no money to persons claiming to represent Review Jor Religious. Change of address requests should include former address. R. F. Smith, S.J. Everett A. Diederich, S.J. Joseph F. Gallen, S.J. Editor Associate Editor Questions and Answers Editor March 1974 Volume 33 Number 2 Renewals, new subscriptions, and changes of address should be sent to Review for Religious; P.O. Box 6070; Duluth, Minnesota 55802. Correspondence with the editor and the associate editor together with manuscripts, books for review, and materials for "Subject Bibliography for Religious" should be sent to Review for Religious; 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. Questions for answering should be sent to Joseph F. Gallen, S.J.; St. Joseph's Church; 321 Willings Alley; Philadelphia, Pennsylvania 19106. Directed Prayer and the Founding Charism Norbert Brockman, S.M. Father Norbert Brockman is a staff member of the Marianist Center; 4435 East Patterson Road; Dayton, Ohio 45430. Among the growing movements among American religious in the past few years has been the directed retreat. In increasing numbers, religious have placed themselves under a director who has guided their meditation for periods as long as thirty days.1 The movement owes much to the Jesuits, who have taken leadership throughout the countr~ in reviving an approach to the retreat that is closely linked with their own renewal and spirituality.2 There have been spinooffs from the directed retreat movement that sug-gest that directed retreats are much more than a passing fad, although for some they will take on that character. The first of the side benefits of the directed retreat movement has been that religious of a number of congregations, especially women, are being trained in the method and approach of directing prayer. The Jesuits have established centers for this purpose, and programs for training, using the Ignatian retreat, are well patronized. A congequence of this is the flowering of directed retreats among women religious,, and the better training of for-mation personnel capable of working with mature nuns. Secondly, the directed retreat seems to bring many religious to long-term spiritual direction. Foi" the first time, for many religious, ~it has been possible--in a directed retreat--to consider spiritual direction as some- 1See, for example, Margaret Baker, H.V.M., "My Experience of a Directed Retreat," Review for Religious, v. 31 (1972), pp. 573-7; Sister Christine Freed, R.G.S., "I Feel like Singing Forever," Review ]or Religious, v. 32 (1973), pp. 1379-1384. '-'Thomas E. Clarke, SJ., "The Ignatian Exercises---Contemplation and Discernment," Review ]or Religious, v. 31 (1972), pp. 62-9. 257 258 / Review ]or Religious, Volume 33, 1974/2 thing other than crisis intervention. While one can comment only impres-sionistically, it seems that a real phenomenon of the past three years has been the increased desire among religious for spiritual direction.:' While the pattern is not so clear as to the expectations.of the religious seeking direction, the question of growth in prayer is always a serious considera-tion. The direction of prayer itself has an ancient and honorable tradition in the Church. From the earliest days of Christianity, the spiritual novice submitted himself or herself to a spiritual guide under whose direction growth in the life of prayer was undertaken. The stories of the fathers of the desert reinforce this strongly, and direction in prayer was for them an all-important issue in the relationship between novice and adept Chris-tian. The origins of this are obscure, but it would seem that the earliest forms of direction in prayer come from the baptismal catechesis, where the person responsible for the conversion of a neophyte not only helped in the education of the candidate for baptism, but particularly assumed the task of.teaching them the spiritual life. Together the two shared a period of prayer and 'fasting before the administration of the sacrament." In modern times, with the structure of the annual or other periodic retreat, various forms or styles of retreats came to the fore. The Ignatian r~treat has always had, in this period, a special place. It has been widely used b~, religious whose congregations are not Ignatian in spirituality, and its very basic Christian themes have made it equally.popular among lay-people. Although the preached retreat had become the predominant form, the notion of the directed retreat never died out, and its revival on such a large scale is in reality a return to an earlier Ignatian tradition. The Notion of the Directed Retreat The focus in the directed retreat is on the notion of "directed." It is a retreat in which the pfirticipant works with the retreat master in the man-ner of a s~iritual director. There is normally an hour-long interview each day, during which the retreatant's prayer is evaluated, directions and themes are~ given for further meditations, and the quality of the retreatant's prayer' is developed? As indicated above, although the nature of the directed retreat has ancient roots in the Church, it has been most characteristic o~ Jesuit re-aSee Sandra Marie Schneiders, I.H.M., "The 'Return' to Spiritual Direction," Spiritual Lile, v. 18 (1972), pp. 263-78. 4Michel Dujarier, Le parrainage des adultes aux trois premiers siO(les de l'Eglise (Paris: 1962), p. 377. 5Herbert F. Smith, S.J., "The Nature and Value of a Directed Retreat," Review ]or Religious;,v. 32 (1973), pp. 490-7. This article is available from Review ]or Religious as a separate reprint. Directed Prayer and the Founding Charism / ~259 treats in recent years. The point needs to be made that the nature of this retreat is simply the direction of prayer itself, adapted to the peculiar de-sign of a retreat, a period of time in which a person withdraws from ordi-nary pursuits to develop more consciously and deliberately in the spiritual life. Admittedly, among American religious other values have also entered in,, but this has always been understood as the essential purpose of retreat. For, a religious working far from the center of his province~ in a small community, the value of fellowship is a real one, for example. Some province retreats resemble a tribal gathering in this regard, and others use a workshop model rather than the traditional one of withdrawal for prayer. The comments that follow will be placed in the context of directed re-treats, but they might as easily apply to much of the real work of spiritual direction. Direction in prayer, even the special, concentrated form of di-rected meditation used in directed retreats, is the heart of spiritual direc-tion. An aspect of regular ~direction, even if relatively infrequent, is sug-gestions for prayer, the joint evaluation of movements in prayer, the dis-cernment of these movements, and help in heeding the call to new levels of prayer. The purpose of this article, however, is not to explore the nature and values, of the directed retreat, but to discuss its use to inculcate the values from the founding charism of a particular ~religious congregation. The question of the nature of th~ directed retreat has been explored in depth elsewhere." What has not been investigated at any point is how the tech-nique of the directed retreat can contribute to the deepening of the ~ommit-ment of a religious to his/her °founding charism. Because non-Ignatian development of the directed retreat has been so°limited, the paucity of in-formation on the topic is understandable. What follows here is based on the author's study within the documents of his own order, as well as at-tempts to work with sisters of two other,groups attempting to find better means for developing their own spirituality within their members. The Founding Charism .In recent attempts among religious to heed the directives of Vatican II that they renew .themselves in the spirit of'their founders and foundresses, the emphasis has been placed upon research and the question of teaching the proper spirit of the order to cb.ndidates,r Along with this has gone the concern for finding newer expressions for the origina! teaching of the founder, while remaining faithful to his/her intent. This has produced some valuable materials in some groups, some false starts in others; there ~William A. Barry, ~S.J., "The Experience of the First and Second Weeks of the Spiritual Exercises," Review ]or Religious, v. 32 (1973), pp. 102'-9. See also the same author's "Silence and tl~e Directed Retreat," Review ]or Religious, v. 32 (1973), pp. 347-51; and Smith, "The Nature and Value of a Directed Retreat." rVatican Council II, The Renewal o/Religious LiIe, no. 2. Review [or Religious, Volume 33, 1974/2 have been elements of both renewal and deception in the experience of getting in touch with one's roots. In the directed retreat, the issue changes somewhat. The purpose of the retreat is not to analyze, speculate, or study. It is to experience the meaning of the life of the Lord in a renewed sense. It is to deepen one's prayer, and to deal with issues that affect the spiritual life. When we speak of a directed retreat designed to inculcate the values of the spirituality of a religious congregation, therefore, the point is that the important elements of that spirituality must be assembled in what may be new ways, intended to move the soul through prayer more than grouped in perfectly logical structures. The experiential dimension, and the very goal of the directed re-treat according to one's own charism, is to bring the retreatant to the ex-perience that the founder had in founding the congregation. One must experience the foundation within oneself as a truly authentic, congruent integration of the spiritual life. It should make sense, bring an interior peace, and strongly confirm one's commitment to this congregation at this time in history. Few religious have taken themselves, or been taken, through the experience of the founder or foundress.'By this is not meant that the privations or sufferings of the founder--the more dramatic ele-ments of his/her life--need be reproduced in some sort of role playing. Indeed, the point is the reproduction of the insight and inspiration of the founding charism itself. What elements of the Christian experience brought about the development that the religious knows as his/her spiritual legacy? How were the evangelical counsels and the gospel message ex-perienced by the founder in such a way that the foundation of this group became a means of incarnating these values? If the congregation is the incarnation of the values of the founder--an extension of his/her charism into history--how is it to be experienced, personally by the members and corporately by the community as a whole? The questions above zero in on the issues that the directed retreat can deal with, in terms of the founding charism of a congregation. What is ob-vious, then, is that the design of the retreat must be developmental, and that might well be, as stated above, quite different from the design used to teach the ideas of the charism, or to study them. Critical Elements of a Founding Charism What, then, are the elements of a founding charism that must be con-sidered in designing such a retreat experience? The Spiritual Exercises are a brilliant example and deserve to be studied, even by those whose spiritual tradition differs sharply from that of the Jesuits. The themes, from the "Two Standards" to the last consideration, are highly developmental. Each builds on what precedes, not so much intellectually, but in the context of faith. It is possible to find all the elements of the Christian life from conversion Directed Prayer and the Founding Charism / 261 to union with God. In short, a spiritual path is described. At the same time, the style of the retreat is congruent with the highly personal emphasis on decision and discernment. The Ignatian directed retreat is characterized (usually, although there are exceptions) by lone meditation, usually at some length, by minimal communal aspects, and by minimal liturgical life. The focus is on the individual coming to grips with his/her personal relationships with the Lord, with an acceptance of that Lordship in one's life, and in the development of a prayer life that nourishes and defines that relationship. What then are the elements of a founding charism that are critical to the development of directed prayer in this ~evelopmental sense? Four ele-ments surface in any investigation of this question: method of prayer, ascetical and/or devotional practices, a spiritual system, and theological concepts. These are the elements that the designer of the retreat prayer experiences needs to coordinate. The study that makes this possible should be on the part of the retreat director, and the retreatant should not be called o'n to do other than move immediately into the prayer experience. .Let us, then, briefly look at each of these elements of the founding charism in turn. Method of Prayer The first critical question is whether the founder taught a method of prayer, particularly a method of meditation. In many cases, what will be discovered is that the founder/foundress did .use a currently popular method of meditation, but that it was a matter of convenience in instruct-ing novices, and not an important element of the spirituality of the con-gregation. Here some communal discernment is necessary. In reading the founder's letters of direction, for example, or instructions on prayer, it is necessary to discover the significance of any proper method to the totality of his/her founding charism. If a distinct approach, emphasis, or technique is present, it should be integrated in the directed prayer of the retreat experience, For instance, a congregation consecrated to Mary might well have developed a receptive approach to prayer based on an understanding of Our Lady's fiat, a disposition of total availabi!ity to the Lord. It would hardly be congruent in such a case to suggest.an aggressive, intellectual type of mental prayer. It would surely conflict with many of the themes that the founding charism will c6ntain. Ascetical and/or Devotional Practices This area, like the last, deserves careful work to determine the con-tinuing value of the ascetical and/.or devotional practices of the founder. Things which are merely characteristic of the nationality or culture of the founder may be safely set aside, and tangential devotions may also be ex-cluded. After all, even founders and foundresses are entitled to devotional 262 / Review 1or Religious, Volume 33, 1974/2 expressions which are uniquely personal, and without having these pro-jected onto their religious foundations! In what sense is the devotion in-volved in the direction that the founder gave his/her early members? What is its theological content? A founder or foundress with a great de-votion to the cross, who writes and speaks of the cross in such a way that it permeates the spirituality of the order, is teaching something of greater import than a founder with a great personal devotion to a. patron saint or to a shrine. Similarly, the practice of taking names in religion may have been merely the religious convention of the time of foundation, or it may have had specific meaning~ Other ascetical practices are.to be similarly evalu-ated. In one tradition, the regulations of the founder about the diet may have been a simple indication of poverty within his .cultural context; in another tradition, the manner in which the question is treated might indi-cate that the retreat should include some fasting, if possible, and with cerr tain goals in mind. A Spiritual System The most obvious element is the spiritual system of the foundation. Did the founder have an approach to spirituality which he taught to the early members? What virtues did he consider important, especially, what aspects of the Christian life did he consider characteristic of his founda-tion? What were his interpretation and understanding of evangelical chastity, poverty, and obedience, and did this differ from the prevailing understand-ings of his time? Did the foundation include any other vows besides the three traditional ones, even though these may no longer exist in the con-gregation? What was the value that the founder/foundress was stressing by having additional vows? What was his/her notion of common life and community experience? What is the role of the apostolate in fostering the spiritual life? All these are part of the questions that must be asked in the process of constructing the spiritual system of the founder or foundress, as, usually in most cases, active founders have not written out the spiritual system in clear fashion. Besides exploring the documents of the congregation, however, the living experience of the early foundation is itself of importance. The story of the life of the founder is often of great value in determining what he meant by a certain teaching. Religious orders are, after all, not only com-munities, but a special modality of community--witness communities that show forth the transcendent dimension of Christian life. The witness of the early foundation, therefore, is of great importance as a form of teach-ing. Theological Concepts Usually, theological concepts do not appear in a founding charism as Directed Prayer and the Founding Charism / 263 such. Founders and foundresses are rarely interested in theology except as it reveals the person :of Jesus Or underlies a religious value. Nevertheless, founders are usually very concerned about fidelity to the deposit of faith. A renewed understanding of theological concepts in recent years may make it possible to enrich the understanding of the founder. The founding charism does not really change, but the religious order is called to fidelity to it, not to literal acceptance in the language, cultural norms, and symbols of the early society. As the Church grows in its understanding, of herself and her divine mission, so 'a religious congregation should show signs of growth in its self-understanding.'To utilize a theological concept such as the Eucharist without integrating the better insights coming from a renewed liturgy of celebration would be more than unfortunate. It would be .a denial of the fidelity'of the founder to the Church's teaching, because as he was faithful to ~the Church's expression of eternal truth in his time and culture, so the congregation, today must reproduce that fidelity. Again, renewed Biblical scholarship has made possible far greater sophistication in understanding the gospel message than heretofore. That cannot be ignored in studying the founding charism, merely because it has happened since the founder died! The °emphasis laid upon the experiential above is not to be interpreted as demeaning the importance of the intellectual as preparation for prayer. Anti-intellectualism is not a mark of the Christian, Quite the contrary, and the directed prayer experience will be the richer for the .hours spent by both ~director and retreatant in studying the basic teaching ,of the Church, especially in those areas that touch upon the founding charism. ~Fhe Retreat ~s Reflection of the Founding Charism The first of the elements of a founding charism was stated as the method of meditation or mental prayer. The idea of the importance of the ,congruence of this with~the total spirituality of the founder or foundress was stressed, but this idea can also be expanded~. The entire style of the directed retreat should reflect the founding.charism. The import/race of this cannot easily be exaggerated because of ~he'experiential nature of:the directed retreat. There" is a profound difference between the directed re-treat., as desert experien.ce (silence, lone meditation at great length, and so forth) and the directed retreat as communal',experience (common liturgi-cal celebrations,' some group discussion, and so forth). In among these contrasts are many modalities of directed retreat, of course. The point is that it is important to include those aspects which will most effectively help the retreatant to gro~w into the values which are the subjects of the prayer experiences. The spirituality that emphasizes a deeply communitarian-or service value will not come through successfully in a desert experience. This i~ not to say that the desert experience is not of value for religious f~'om adtive commui~ities~(far from it!), but only that a limited aspect of their spirituality is likqly to emerge in such a context. Review for Religious, Volume 33, 1974/2 Similarly, methods of discernment should be congruent with the found-ing charism itself. What was the method for discerning the will of God used by the founder or foundress? Was it a communal means, or one based on authority? Discernment itself has become an issue, both within the directed retreat movement and in other contexts? It is an integral part of the Spiritual Exercises, and would seem to be an integral part of the work of the director of prayer. Within a given tradition, the method of dis-cernment might well be prophetic or charismatic. More likely it will reflect an authoritarian tone, which would translate into the directed retreat as a form of obedience to the spiritual guide. This type of obedience itself needs to be understood, as it isnot the same as the obedience owed a superior under the evangelical vow. In some traditions, the means of discernment might be very communal, in such a way that group direction might be a compatible style for certain congregations using the directed retreat. This would be alongside the pri-vate interview, which is essential to the directed retreat. A final word should be added on the place of resolutions. Many re-ligious feel strongly that they should come home from retreat with clear resolutions for the future--a battle plan, so to speak. The presumption is so strong with many that it is an issue that should be frankly discussed with the director. It is certainly not necessary for the directed retreat; it is enough that there be an interior renewal and deepened commitment to the spirit of the foundation. Whether there are "results" or decisions on con-crete action for the future should flow from the needs of the person him-self/ herself. Too often it is merely another expression of a workaholic personality. Conclusion This has been a simple and sketchy view of the development of a directed retreat from the point of view of the goal of growth in the spirit of one's own order. As such, directed prayer is a powerful means of growth toward incarnating in oneself the values of the founding charism. It is a means of renewal that not only affirms one's commitment to religious life, but also goes far toward building and renewing the community through renewed religious, standing firmly in the tradition of the one who brought the order into being under God's grace. 8Criticism has been recently expressed by W. Peters, S.J., "Discernment: Doubts," Review ]or Religious, v. 32 (1973), pp. 814-7. See also James V. Gau, S.J., "Dis-cernment and the Vow of Obedience," Review for Religious, v. 32 (1973), pp. 569-74; David T. Asselin, S.J., "Christian Maturity and Spiritual Discernment," Review ]or Religious, v. 27 (1968), pp. 581-95; and John R. Sheets, S.J., "Profile of the Spirit: A Theology of the Discernment of Spirits," Review ]or Religious, v. 30 (1971), pp. 363-76. The last article (that of Father Sheets) is available from Review ]or Religious as a separate reprint. Prayer: The Context of Discernment Charles J. Healey, S.J. Father Charles J. Healey, S.J., is a faculty member of the Department of Theology; Boston College; Chestnut Hill, Massachusetts 02167. Discernment Today In our attempts to seek and find God in our lives and to live out our Chris-tian lives of faith, hope, and love, we are often involved in a process of rediscovery. There is not that much that is new for us in the sense of dis-covering something for the first time. But often the conditions of the times in which we live and our own felt needs combine to lead us to focus on a particular aspect of the spiritual life. Such, I would suggest, is the case in the area of discernment. It is certainly a term that has deep roots in the history of Christian spirituality. But ours is a period that has seized upon the process of discernment--perhaps too quickly and too glibly at times-- in the hopes that it might aid us in our efforts to love and serve God both as individuals and as communities, and to seek and respond more gener-ously to His will in our lives. This renewed interest in discernment should come as no surprise. First of all, there is the very visible desire of many to deepen their own union with God, to establish or reestablish what they consider the essentials and priorities in their lives, and to make any required decisions in a context of faith and prayer. In a time of great change, many are seeking to find strength and unity within themselves not only to cope effectively with their lives and all their responsibilities, but also. to maintain themselves as lov-ing and productive persons. Secondly, many communities are turning to the process of discernment as a method of helping them in their attempts at renewal as a community and as a basis for group decisions. But whether 265 266 / Review for Religious, ~olume 33, 197.4/2 it is a case of individual discernment or corporate discernment, it is impor-tant to stress over and over that the basis of any discernment has to be the deep and intense prayer of the persons involved in the process. The context of any true discernment is prayer. The purpose of this article, then, is to offer some reflections on discernment, using the word in the broadest sense here and focusing on the intimate connection between discernment and prayer. ontex! Is Prayer Discernment really makes sense only when it is situated in the context of prayer. Unless there is a corresponding desire to seek and find God continually in our lives and to deepen our awareness of His reality and presence, discernment can end up just being talk. The seeking and yearn-ing attitude of the Psalmist must penetrate our own lives deeply: "To you, my heart speaks; you my glance seeks, your presence, O Lord, I seek. Hide not your face from me" (Ps 27:8-9). There is, of course, a renewed in-terest and even a hunger on the part of many today in the area of per-sonal prayer; and this accounts in part for the renewed interest in the area of discernment. There are many indications of this all around us at the present time; and many are definitely expressing a desire for praye~r which springs from a felt human need and the presence of the Spirit in our midst, ever renewing, ever arousing. Recently I was listening to a taped conference on prayer by Thomas Merton in which he mentioned at the beginning that he ~did not like to talk a great deal about prayer. This was certainly not from any disinterest, for if there is any constant preoccupation and interest that emerges in his life and writings, it would be with the value and priority he constantly gives to prayer. But he wanted to stress the point that pr~yer for us should be something simple and natural, something as simple and natiaral as breath-ing. It is hard for us to talk about breathing since it is such a normal process of our lives and one wfiich we can easily take for granted. So, too, he feels should be the case with prayer. At times we can complicate it and make an issue or a cause out of it. But usually when we make a~ca~]se or an issue out of something, we oppose it to something else: "This is.prayer, this isn't. This is something sacred, this isn't." The f~us could then shift to the issue rather than the reality, and prayer could then be viewed as something complicated and artificial. Perhaps we can best consider prayer as the simple, natural, continual response of one who is,. convinced he be-longs to God and seeks to grow in union with Him, and the response of one who realizes he is a person possessed by a loving God. And it is in this climate, this atmosphere of prayer tl~at the whole process of discern-ment should be placed. The context is a very normal, full, and serious seek-ing after God. Pray'~r." The Context o[ Discernment / 267 The Process of Discernment ' Discernment, then, should not be considered a cause or an issue nor ev~en' a method in itself. It is a process in prayer by which one seeks seri-ously to know and follow God's will, to hear His call and faithfully and generously respond in the very real life situation of the person concerned. If l~ra~er should be a very human and ordinary experience, so too should b6 discernment. In this sense, it is a very simple process; and yet, on the other hand, it can be difficult in the sense that it presupposes constant efforts at'a deep and continuous union with God through prayer. This re-quires perseverance, patience, and willingness to expend time and energy. It' cannot be turned off and on like a water faucet if it is to be effective; it presupposes a firm basis of faith and the continuous seeking of the presence of the Lord. ~Alth0ugh discernment is a word that can come easily to the lips, it can still remain a rather elusive concept. Perhaps this is because it pre-soppos~ so much else. At any rate, we might recall Father Futrellrs defi-nition that discernment "involves choosing the way of the light of Christ instead of the way of the darkness of the Evil One and living out the con-sequences of this choice through discerning what specific decisions and ac-tions a~e, demanded to follow Christ here and now.''1 Thus discernment focuses on the ongoing attempts to clarify and ascertain God's will in our lives and seeks to specify what actions and decisions are required in the life of "on'e who wishes to follow Christ tothlly. The process presupposes an int'eflse desire, hunger, and willingness to seek God's will and to embrace it generously once one has come to a reasonable certitude regarding it. W~ might say it all comes down to our attempts to hear and respond to:the wo~'d of God in our own unique lives. But. if we are to be sensitive t~lGod speaking to us in the many ways He does.in our liv6s, we must first hear His call; we must listen quietly and give Him frequent opportuni-ties to speak to us. If we fire to b~ sensitive to God's presence and attentive to His touch, there must be an element of stillness and listening. Since this listening~aspect is so important for discernment, we should not be surprised to find this aspect of prayer being re-e~mphasized today.2 Many are ex-periencing the need today to. take time out from all their activities in order to turn within and seek God's presence within, to contemplate Him and to listen to Him in the stillness of their hearts. It is a kind of active receptivity as we let the radical truth of God shine forth with its own life within us. We seek to make the words of the P~almist our own: "In your light we see light." It is in this atmosphere .of stillness and presence that one can best determine God's call, God's touch, God's will. ~John C. Futrell, S.J., "Ignatian Discernment," Studies in the Spirituality o] Jesuits, v. 2, no. 2, p. 47. '-'See, for example, W. Norris Clarke, S.J., "Be Still and Contemplate,"~ New Catholic World, November-December 1972, pp. 246 ft. 2611 / Review [or Religious, l/'olume 33, 1974/2 Building on the Past As we seek to see clearly where God is touching us at a given time and where He is leading us and asking us to respond and follow, it is very help-ful to grow in the awareness of where God has touched us and nourished us0 in the past. Each of us has his or her own unique history in the hands of a loving God, that is, significant events, persons, books, Scripture pas-sages, and so forth, that have been a source of great strength and help. All of this constitutes our own faith experience of God; and the more it is brought to our conscious awareness, the more it becomes our own. Often in discernment workshops or faith sharing experiences, methods and oppor-tunities are presented to help individuals grasp more explicitly what they uniquely possess of God in their lives. One can call this by various names: one's core experience of God, one's beauty within, one's name of grace, and so forth. But it all comes down to the same reality: we seek to realize what we already possess, what is uniquely ours, and where God has touched us and loved us significantly. Once we are more aware of how God has acted in our lives in the past, we can more easily return in a spirit of prayer to be nourished and strengthened and sustained. What has sustained us in ~the past and what has touched us before, can sustain us and touch us again. This conscious awareness also helps us to be more responsive and sensitive to where God is touching us now, where He is leading us. We can begin to see a pattern and a continuity in our lives of faith. Above all, we be-come more aware of the profoundest reality of our lives, namely that which we possess of the power and love of God that has worked within us in the past and continues to be operative in the present. Discernment in prayer, then, is an ongoing process that seeks to find God and His will in our lives; it involves a constant seeking of God and an awaren(ss of His presence in our lives. Through discernment one seeks to hear God's continuous call, to recognize it as clearly as possible in order to follow it as faithfully and generously as possible. It seeks to answer the question: How can I best love and serve God in the present circumstances of my life. It is an ongoing process because our lives, our experience, our work, our relationship with God is an ongoing process. His Word does not come to us in a vacuum but in the concrete circumstances of our everyday lives. As Thomas Merton says in one of my favorite passages from his writings: Every moment and every event of every man's life on earth plants some-thing in his soul. For just as the wind carries thousands of winged seeds, so each moment brings with it germs of spiritual vitality that come to rest im-perceptibly in the minds and wills of men. Most of these unnumbered seeds perish and are lost, because men are not prepared to receive them; for such seeds as these cannot spring up anywhere except in the good soil of freedom and love.3 aThomas Merton, New Seeds of Contemplation (New York: New Directions, 1961), p. 14. Prayer: The Context of Discernment / 269 In a very true sense, it is only the faith-filled person, the contemplating person that is acutely sensitive to these seeds of God in his or her life. And for the soil of freedom and love to flourish in our own lives, we must con-stantly open ourselves to the Spirit of God through an abiding spirit of prayer. Not only must we seek to grow sensitive to God's speaking to us in the external events of our lives, but we must seek to grow in an awareness and sensitivity to the movements within ourselves as we react personally to the signs of His will and presence. How do my present reactions corre-spond to the felt experience of God that has been so much a part of my life in the past? Are my present movements in resonance with that source of peace, that sense of oneness and wholeness before God that I have ex-perienced before, that sense of belonging to God that has been so nourish-ing and sustaining in my life? Are they consistent with the normal signs of the Spirit working within us, the signs of "love, joy, peace, patience, kindness, goodness, faithfulness, humility and self-control" (Gal. 5:22-3)? These are some of the questions one seeks to clarify in order to fulfill the desire to seek and find the Lord and His will. The spiritual director can play an important role in assisting here, for at times we can be too close to ourselves to have the needed objectivity. The director can aid us in clarifying and objectifying our own experiences and interior movements and aid us to see where God is touching us, loving us, and indicating His presence and His will. A Sense of Freedom In addition to a deep and constant spirit of prayer, discernment also requires an attitude of freedom and detachment. The attitude of freedom I refer to is that which allows a person to give to God and His will the central place in one's life;, it is a freedom and detachment from all other things that would either prevent or hinder one's striving to focus On God. It is the sense of freedom that allows God to become and remain the cen-tral reality in one's life. The Psalmist speaks of this centrality with the words: "As the eyes of the servant are on the hands of the Master, so my eyes are on you, O Lord." It is the freedom that allows one to respond generously to Jesus' invitation to Matthew, "Come, follow me," and His words to the disciples of John the Baptist, "Come and see." Come and see and taste the goodness of the Lord. It is the freedom expressed in the words of the prophet Samuel, "Speak, Lord, for your servant is listening" (1 Sam 3:10), and the words of the Psalmist, "Here am I, Lord, I come to do your will" (Ps 40:7-8). We might note in passing that there can be an intimate connection between this spirit of freedom and a lifestyle that is marked by a spirit of simplicity. How does one grow in this spirit of freedom? Ultimately it is through a cooperation with the power of God's grace and love working within us. 270 / Review for Religious, Volume 33, 1974/2 But one important way is through a deepening realization that one is a loved sinner, that one has been touched and healed. A profound convic-tion of God's steadfast love and fidelity can be a very liberating force that enables one to turn to God and seek Him alone and His service in a spirit of simplicity and joy. This freedom grows in a context of lively faith and is nourished in prayerful reflection on God's goodness, mercy, love, and providence. Conclusion In general, discernment in prayer is an inward looking process; the focus is mainly on the movements and experiences of God within us. But the process must never stop here for there should also be an outward dimension of discernment. First of all, as in so many areas of the spiritual life of man, a healthy norm is: "By their fruits you shall know them." There is a confirmatory aspect of all discernment in the external fruits that are in evidence and the good works that are produced. Secondly, the great commandment,of love must always be kept in perspective, and a deepening union with God should lead to a deepening union with one's fellow man. An increasing sense of compassion for one's fellow man and his needs should flow from one's union with God. Finally, the process should lead to an increasing sensitivity to life and all its mysteries, to an increasing awareness of.God's presence in all things, and to our own growth as-con-templatives in action. A Norwegian Outpost: Maria Einscete M. Basil Pennington, O.C.S.O. Father M. Basil Pennington, O.C.S.O., is a Cistercian monk of St. Joseph's Abbey; Spencer, Massachusetts 01562. Our plane put down at Oslo and I soon bungled my way through customs, only .to find--no one. Communications had gotten a bit confus(d and now there was no one there. But everyone I asked seemed t6 know of him: "Brother Robert, yes, the hermit. He lives up in the mountains near Lake Tinn." And so I began my pilgrimage. Ten o'clock the next night I stepped down from a bus in the pouring rain and made bold to ask the young lady who alighted with me the oft repeated question: "Where is Brother Robert? . That way," she answered with a bold sweep of the arm as her hand pointed up a dark rise of conifers. I turned in the opposite direction to the friendly lights of an inn. It was a good choice. There among the youths gathered around the blazing fire was Jan. A couple years earlier he had been up to see the hermit with his pastor. He offered to be my guide. Good to his word, Jan arrived early the next morning with his little Volkswagen which took us as far as it could. Then we began to climb on foot. I was a bit embarrassed when Jan took my bag, but soon I was very grateful that he had--for otherwise I probably would never have made it. We must have climbed steadily, along an old logging trail, for forty-five minutes or more when Jan sudde.nly stopped and pointed back into the woods. We had actually passed our goal: Maria Einscete--Mary's Hermit-age. Maria Einscete was just a simple log cabin, one just like so many others in those forests. Larid in Norway belongs to the owner by hereditary right. It cannot be "definitively alienated. Most families living in the villages or on the lowland farms own stretches of woodland up on the mountains. 272 / Review ]or Religious, l,'olume 33, 197/.'-/2 In better times they kept men up there ,to care for the woods, but now most of these lumberjack's cabins are empty. One of these landlords, a kindly man, let Brother Robert use his abandoned cabin, plant some vege-tables, and dig a well. From the United States to Chile and to Norway Brother Robert, Father Robert Kevin Anderson, is a monk of St. Joseph's Abbey, Spencer, Massachusetts. He entered the Cistercian Order at the Abbey of Our Lady of the Valley back in 1949 when he was 17. He was one of the first choir novices professed after the community trans-ferred to Spencer. Frater Kevin, as he was called in those days, cared for the newly planted orchards and, after his ordination to the priesthood, for the newly planted brothers--as father master of the lay novices. But he had always experienced an attraction toward a more simple and radical form of monasticism. He went on to pursue this, first at St. Benedict's Monastery in the Colorado Rockies, then at the Monastery of Las Condes in the Chilean Andes. It was at the latter monastery that he first embarked on the eremitical life which he found to be his true calling. Later Father Robert sought deeper solitude in southern Chile; but the bishop there had some ideas of his own about how Father was to lead the eremitical life. So Father moved on to the land of his family's origins, Sweden. Here again, a hard-pressed bishop with few priests had his own ideas how a hermit-priest should live. And again Father moved, this time across the border to the diocese of the sympathetic and understanding Cistercian bishop, John Gran of Oslo. Until he could find a suitable site, Father Robert lived in a distant parish. Soon he found what seemed like an ideal place for a hermit: an island on Lake Tinn. But appearances can be deceiving. Living on an island meant dependence on others for all supplies, or keeping a boat for summer and an ice sleigh for winter. Then, too, the fine summer weather brought traffic to the lake. Father lifted up his eyes to the mountains, and soon ascended to Maria Einscete. The Hermit Life o| Father Robert Although feature articles and TV presentations have made Father Robert known throughout Norway and even throughout Scandinavia, he yet receives few visitors. The Norwegians respect and are inspired by his life of prayer and presence to God. They do not want to intrude. Besides, the ascent is difficult and the way known to few. The Catholic pastor, whose parish extends for several hundred miles, calls in from time to time. And of course, the good sisters find their way there at times; also, the search-ing young--from as far away as south France or America. Priests have occasionally come for retreat. And a pious convert lives not far from Father's mailbox and enjoys having him in to say Mass in her front room. A Norwegian Outpost: Maria Einscete / 273 But usually Bror Robert (as the Norwegians call him) is alone with his goats and his God. He goes down to the road to the mailbox every few days--and the owner of the neighboring box watches to see that the mail is collected, a sign that all is well with their hermit. Once a week or so, on skis in winter and a motor bike in summer, Father will go to the village for supplies. All the villagers know and love their hermit. They expressed real joy when "Brother Robert's brother" came to visit him. From time to time Father goes to Oslo to speak to the Dominican nuns, the only con-templative community in Norway. And once a year he goes south to the French Abbey of Mont-des-Cats to see his spiritual father. This was one of the conditions the bishop placed on his presence in the diocese as a hermit: that once a year he would spend some time in a monastery. Father Robert's life is very simple. He prays the hours quite as they always have been celebrated in the monastery, and offers Mass for all man-kind. He does some wood carving, mounts ikons, and practices the ancient Norwegian craft of weaving baskets from birch roots. He also translates books. He is a gifted linguist and has mastered both new and old Nor-wegian, as well as the local dialect. These occupations, along with Mass stipends, help him to keep body and soul together. At the time of my first visit Father Robert had been living in his log cabin for about a year. The only facilities were the woods. He had dug a well nearby and so had plenty of good water. But he confessed to me that he spent most of his time during that first winter chopping firewood--for his cabin had no inner walls and was very difficult to heat. The Spencer community helped him then to get a logger's caravan, which is not only much more snug and easier to heat, but which Father was able to locate higher up on the mountain where he can benefit from much more sunshine. The view from the new location, looking out across Lake Tinn to Mount Gaustaf, one of the highest peaks in southern Norway, is simply magnifi-cent. As the rays of the sun play on clouds, mountains, lake, and forest one is ceaselessly awed. This is indeed a Godly place--an ideal place for a hermit. The Monastic Presence of Father Robert This extension of Spencer Abbey and of the American Cistercian Re--' gion, this foothold of Cistercian life in Norway, is certainly something for which we should be most grateful and praise the Lord. The effectiveness of Father's monastic presence cannot be fully evalu-ated but it is certainly significant. This is rather surprising in a country where most are at best nominal members of a state church, and the few, very scattered Catholics tax the handful of devouted priests and religious who seek to minister to them. The latter, without exception, seemed to ad-mire and respect Father and find inspiration in his fidelity to his particular calling. But the Lutherans, too, revere him and seem to be grateful and 274 / Review for Religious, Volume 33, 1974/2 happy .that this man of God is in their midst. They relate stories of her-mits and monks who lived in this land before the Reformation and the Danish oppression, even of a particular hermit in the area of Lake Tinn. Even for these apparently religiously indifferent, ,the man of prayer living alone on the mountain is a sign of hope, of something better, higher, tran-scendent. And when the final option comes, hopefully, with perhaps only a vague and confused idea of what he stands for in their minds, and the grace flowing from his prayer in their hearts, they will reach out for that Transcendent Reality. Blessed be the Lord God . . . he has raised up a horn of salvation for Norway. Now that there is a Cistercian bishop and hermit, in Norway may we not soon have a regular cenobitic foundation? It is time the Cistercians returned. The Cistercians first directed their steps to Norway back in the twelfth century, in the Golden Age of the Order. And there are still significant remains ~of their presence. On the Island of HoevedCya in the Oslo Fjord, just a short ferryboat ride from the capital, are the ruins of an abbey founded in 1147 from Kirkstall,. The whole outiine of the regular build-ings is there. The walls of .the church reach up ten and fifteen feet, and higher at the comer tower. Through the insisterice of 'Bishop Gran the government now preserves this site as a national monument. It is a very beautiful site indeed. But historical sites, no matter how beautiful, are not enough. The Church of Norway, like every other, needs for its fullness the presence of living and thriving contemplative communities. Guided by the Lord, Brother Robert has made a beginning. May the Lord prosper what he has begun. Reflections on Bangalore Sister Mary-John Mananzan, O.S.B. From October 14-22, 1973, the Second Asian Monastic Congress was held in Banga-lore, India. Sister Mary-John Mananzan, O.S.B., attended the meeting and gives here her impressions of the Congress. Sister Mary-John is Dean; St. Scholastica's College; P.O. Box 3153; Manila, Philippines. This will not be a report on the Bangalore Congress in the usual sense, but rather a reliving of significant experiences and a sharing of insights gained. No amount of faithful reporting can capture the atmosphere of such a meeting. But .perhaps the sharing of one's impressions can give a glimpse into the dynamics of the ievent much more than a complete but detached description 9f the proceedings. Personalities Let me begin with the significant people who made an impression on me. Among the observers to the Congress were two Tibetan monks who rePr, ds.ehted thee Dalai Lama. They were Lama Sherpa Tulku and Lama Samdong Tulku. The one word that ke'eps coming to my mind to describe them is "genuine." I was struck by their authenticity, their trueness to them-selves, their utter lack of pretense. They went about with serene dignity, quiet friendliness~ and unfailing self-mast6ry. They talked with perfect frankness about the problems of their people in exile with feeling but with-out the slightest rancor againsl~ the invading Chinese. And with disarming simplicity, one of them asked in our small group discussions: "Please ex-plain to us what you mean by a personal God." The theological jar~gon did not seem to satisfy them, so during the coffee break I ventured an explana-tion which ran something like this: "Lama Sherpa, do you sometimes talk to the Absolute Reality?" 275 276 / Review [or Religious, Volume 33, 1974/2 "Yes," he replied. "Do you think he understands you?" "Yes." "Well, that is more or less what we mean when we say that God is a person." He seemed to be more satisfied with this explanation. The lamas had a way of expressing their ideas in an unusually effective way. During the discussion on prayer Lama Samdong Tulku made the following remark: "I.got the impression that when you pray, you send your words to the Absolute Reality. We, we push ourselves to It." Another personality which, for me, stood out, was Abbot Primate Rem-bert Weakland himself. He was a most excellent presiding officer; more-over, his introductory and concluding talks showed his keen intelligence, his versatile scholarship, and his sobriety of judgment. He was most human. He joked with the seminarians of the Kristu Jyoti College where we stayed as though he were one of them but without losing his dignity. In fact I ob-served in him something I seldom observe in many superiors today--an unembarrassdd awareness of his authority and an unapologetic reference to it when he considered it useful to do so. Among the non-Asians who had adopted the Eastern way of monastic life, the one I considered most credible was Father Bede Griffiths. He went about in a most unobtrusive, unostentatious way without the slightest effort to edify or to preach. I find this significant because I felt that there can be a tendency among non-Asians who have insights about the indigenization of monastic life and liturgy which are in themselves authentic, to be over-zealous and therefore tactless in their efforts to conscienticize the people whose culture they have studied and adopted. I believe that there can be a very naive, uncritical adaptation to indigenous culture which, if cohpled with a lack of delicacy in strategy, could alienate the people because it ap-pears to them to be another and a subtler form of paternalism. When this is further accompanied by efforts to edify, then the people are positively repelled. Then one provokes reactions which may sound extreme and de-fensive, but are not wholly unjustified like: "Why do they give themselves to be more Eastern than the Easterns?" The adaptation of the Eastern forms of monasticism by monks and nuns in Asia is an important venture; but this must be undertaken with utmost delicacy, tactful strategy, and with what perhaps for Westerners will amount to an almost intolerable amount of patience. I was enriched by the friendship with Vietnamese monks and nuns who shared with me their spiritual adventures. They have left their b!g monas-teries in the hillsides and have come to live among the poor in the center of the city of Saigon. The nuns take in laundry and typing work to support themselves and the monks take turns in tricycle driving. Reflections on Bangalore / 277 The Theme of the Congress The theme of the Congress was: "The Experience of God." This was divided into subtopics .such as: Monastic Experience of God in Christianity and Other Religions; The Experience of God: Methods of Realization; The Experience of God in Community Life; The Influence of Asiatic Religious on Monastic Structure; The Experience of God and Social Responsibility; and The Contribution of Christian Monasticism of Asia to the Universal Church. These were discussed in small groups as well as in the general assemblies. Again I will not make an effort to summarize the discussions but rather pick out those which had an impact on me. First of all, I regained my respect for the word "monastic." Due to certain historical factors, the word "monastic" in certain circles had come to mean deportment, a pattern of behavior and a fuga mundi attitude. In the Congress, the main emphasis was on the single-minded search for God. There is a monastic dimension to every human being. For those who have come to an awareness orbit and who wish to fulfill this dimension of their being, there should be monastic communities whose structures are flexible enough to share their way of life even on a temporary basis. At this point, it is good to mention.what Bishop D'Souza expressed as the petition of the Indian hierarchy. The Indian hierarchy, he said, is asking the monastic communities to be: 1. eschatological signs (monks and nuns should primarily be men and women of God) 2. centers of liturgy 3. havens of serenity 4. examples Of simplicity of life and refinement 5. model communities for Christian living 6. houses of undiscriminating hospitality One thing that was realized in the Congress was the contribution that the non-Christian form of monasticism can give to the traditional Christian monastic" life. There are several elements of the Eastern form of monasti-cism which have been forgotten or not emphasized enough in the Western tradition. There is, for example, the importance of the techniques and meth-ods in the search for the Absolute. The role of the body in prayer that is very much emphasized in Yoga and Zen could'be given the same impor-tance by Christian monks and nuns. The existential view of the Absolute and the unified view of reality of the East could balance the more con-ceptual and dualistic view of the West. The importance of the guru in Eastern spirituality can likewise revitalize the role of the spiritual director. Father Raymond Pannikar summarizes the unique role of the East thus: "Just as Africa's contribution to the Church is sensitivity to creation and that of the West,. the discovery of the value of history; so the unique con-tribution of the Asian is to develop the dimension o] the spirit." 278 / Review ]or Religious, Volume 33, 1974/2 Shared Prayer The Congress was not just a series of intellectual discugsions on the experience of God: It was for many participants something of a spiritual experience in itself. Contributing tO these was, first, the shared liturgy which the different regional groups prepared, giving the ~vhole community an ex-perience of a variety of. indigenous liturgy "Indian, Vietnamese, Korean, Chinese. There were likewise opportunities to meditate in the, Zen' way, the Yoga way, the Tibetan Buddhist way, and in Christian shared prayers. Amid the variety of methods, ceremonies, symbols, °and gestures there was the unity of hearts in worship.~And then there were the interpersonal en-counters which occasioned the sharing of spiritual experiences, the creating oLbonds which gave the promise of lasting friendships.~There was thus the wonder of discovery of the other in each other. There were no resolutions, conclusions, or statements at the end of the Congress. As Father Abbot Primate said, Bangalore was more humble in its tone than the Bangkok Congress. Its open-endedness is a challenge to further reflection and to further action. And this challenge was expressed in the delegates' message to their communities which reads as follows: Message to Our Communities Together with Father Abbot Primate, Rembert Weakland, we, , gathered here at Bangalore for the Second Asian Monastic Congress, salute you with an Indian greeting:which echoes in our liturgy, SHANTI, PEACEF ,~ We would like to share with you the atmosphere of joy, openness and fraternity that prevails in this community, which grow out of peoples of dif-ferent backgrounds, not only of race and culture, but also of religious tradi-tion. We are fortunate to have at our meeting Cl~ri~tia'n monks and sisters of various countries, Tibetan lamas, Buddhist and Jain mdnks and Hindu swamis and sanyasis. We lived together, 'praying and discussing in mutual enrichment. We are amazed to realize that, amid very real differences of opinions and experiences, there is an overwhelming convergence of concern: THE SINGLEMINDED SEARCH FOR GOD. It is in this conce.rn ~that we experience a strong bond of unity. We consider it our task as monks to commit ourselves wholehea.rtedly to this search, and it is in this context that we accept the world around us and feel h sense o.f sol!darity with it. We have a role in bt~iiding up the city of man. This consigts in pointing out to man the path to God. In particular, we are to share with the poor in theii-°striving for human dignity and liberty. It has become clear to us that to realise these goals i.n our times calls for a radical openness.and flexibility in our religious life and structures. We are in a moment of challenge. If we fail to respond, we lose our right to exigt as monasteries. Your delegates will bring home to:you reports of the proceedihgs of the Congress. Understandably, these will kive but a glimpse into what really happened here. But, for many of us, this Congress has been a: real spiritual experience. ,.Your delegates can communicate this experience more effectively than any written .report. It is our earnest prayer that all the communities scattered throughout Asia will put into effect the insights gained during this Congress. Tliis may mean breaking away from fixed patterns, settink out like Abraham ihto ff new land. Reflecffon~ on Bangalore / 279 We strongly recommend openness to our brothers of other religious traditions who, as we have experienced here, have so much to offer us. We urge the rethinking of our way of life so that as many people as possible may have the opportunity of sharing with us our experience of God within the content of living and vital communities. Let us maintain the bonds of unity which have been established among us through our delegates. During these days we have thought of you and prayed for you. May our continued unity in prayer be fostered by renewed contacts with one another. Toward a More Authentic Sharing in Community Laurent Boisvert, O.F.M. Father Laurent Boisvert, O.F.M., is the editor of the excellent Canadian magazine for religious, La vie des corntnunaut~s religieuses and lives at 5750, boulevard Rose-mont; Montreal 410, Quebec; Canada. The article originally appeared in the March 1973 issue of La vie des communaut~s religieuses and is printed in translation here with the authorization of that magazine. The translation was made by Sister Clarisse Marie, S.N.J.M.; General Administration of the Sisters of the Holy Names of Jesus and Mary; 187 Chemin de Cap-St.-Jacques; Pierrefonds 940, P.Q.; Canada. The sharing of material goods, based on the needs of each individual or moral person, tends to express and intensify the fraternal bond which unites us as religious. However, in everyday living this sharing meets with ob-stacles which compromise, in varying degrees, its fraternal character. A review of them will help us to become more conscious of them and so favor, I hope, the building of that community of justice, peace, and love which all of us desire and which alone can tnaly be called "fraternal." It is not rare to hear religious ask themselves: How does it happen that our lives are so little changed by the many conferences, sessions, and work-shops in which we participate? These same religious insist that we present them not so much the fundamental values of religious life which they say they already know, but rather a way of integrating them into their lives. The reflections which follow relate to this first step: the "how" of living a more genuine fraternal community life, a step which consists in over-coming in oneself the chief obstacles to its realization. False Mental Attitudes When we insist, before community groups, that a distribution of goods 2110 Authentic Sharing in Community / 2111 be made according to the needs of each, some religious express amazement. It seems useless to them that we should come back to so fundamental an issue, and one that everyone accepts. No one can deny, however, that in spite .of acceptance in theory, certain religio.us, and a number sufficiently large to warrant the mentioning of it again, demand for themselves the use of all kinds of things, basing these requests, not on real need, but rather on the fact that other religious have and enjoy the use of. them. If someone has such and such a thing for his work, goes out so many times during the week, or wears clothing of such and such a quality, etc., others use the example of such religious to justify having the same things and acting in like manner. If one group needs two cars, another group made up of the same number of people will perhaps demand one, just because the first group has two, How can we explain this dichotomy between the theory of sharing goods according to need, and the contrary practice illustrated by the examples just given? The reason is, it seems to me, that the criterion for the distribution of goods, recognized at the intellectual level, has not yet penetrated the mentality of all religious nor modified their attitudes and their conduct. Certain religious accept the idea of pluralism in the forms of sharing, but their reactions are those of people accustomed to a uniform type of sharing. They still lack that which, for all of us, is most difficult to realize, namely a change of attitude. No modification of structures, how-ever radical, can dispense a religious from the effort required to bring.about this conversion. It is easier and faster to set up pluralistic structures for sharing than it is to transform a person accustomed to uniformity so that he becomes capable of understanding, of respecting and of favoring diversity on the level of persons and their needs, and of making the necessary applications. All of which helps us to understand that if, in our congregations, the adaptation of structures has in large measure been accomplished, the con-version of our ways of thinking has not. Some years of effort will still be necessary, years of patience and of tolerance, before the transformation of mental attitudes and of conduct becomes a reality. In spite of everything, some people will never know such a transformation, because they believe that such a change is an evil and not a benefit to be pursued. Charity re-quires that we respect them, and that we learn to live with them, in the wis-dom and great-heartedness of compromise which, under its° positive forms, is love. Inability to Estimate One's Needs Accurately It is not sufficient to want to share a community of goods according to the real needs of each one. For the actual realization of this principle one must be able to evaluate tfiese needs honestly and accurately. Some religious are more or less incapable of making such an evaluation. For some, the reason lies in the formation they received as young religious and the long 2112 / Review ]or Religious, Volume 33, 1974/2 practice of a poverty based on dependence. They had only to ask and to leave ,to ,authority to judge the legitimacy of their request. Once the su-perior had given an affirmative answer, they never questioned themselves again about their use of the things granted. -This dependence,, judged in our day excessive, has atrophied the sense of responsibility"of some and made them quite unable to determine their own needs: Today, when au-thority leaves them free to choose such and such a thing,, to do or not do such and such an. action, to go or not to go to such and such a place, they prefer no action at all rather then assume responsibility for it. Long and difficult will be,the liberating process which will one day enable them to judge their own needs, if~ such will ever be possible. ~ C-Certain religious, coming from poor families and having, lacked some of the basic necessities during their childhood, make up,for lost time and accumulate without reason a surplus of goods. They:even admit that they ask for things to make up for the lack of them experienced in the past.And so they fill their closets with items.for, which they have,no real need, but which give them a sort of psychological security. In this Way they com-pensate for the time when they sutIeredreal want. ~ ,, For other religious, the practice of a poverty consisting of going with-out, of detailed restriction for use; of meticulous control and uniformity, has brought ab6ut another ,excessive reaction in that they,are constantly asking .for things they don't really need and of which they never .seem to have enough. At the other extreme are those who considered this former practice of poverty the ideal one, and so refuse to accept any form of com-munal sharing based on a pluralism of real needs. Using False Criteria Again, for some religious, the relative incapacity of identifying their real needs results from the use of false criteria. They will say, in, order to justify a trip: all my brothers and,sisters went to such aoplace, though an-other might say~ with just as much truth: I cannot make that .trip since none of my brothers and sisters have ever been there. Can the single fact :that one's relatives have visited Europe constitute a ,valid reason for asking for a trip overseas? Or again, can the simple fact that one's parents have never taken:~some scenic trip within the province or state:~be sufficient reason for denying oneself ,such an outing? In both cases, the use .of the "family" norm, instead of helping, hinders the discovery of real needs. That one consider the situation of one's family is certainly not wrong, but to use it as the sole means of defining orie's Own needs and the ~type of relaxation one has a right to seek is certainly without justification. These .conclusions apply .likewise .to one's social and professional posi-tion. There are people who count on the life style of ~this double milieu to determine personal needs. If they: live inca neighborhood where~each family averages one or two color-television~, sets, a summer cottage', a snowmobile Authentic Sharing in Community / 2113 or~ two, etc., they think that they too have a right to these same things and wi!l use them, under the illusion that they are living their commitment to po~verty.,lf th~ey work in the.~schools or hospitals and if the majority~of their companions go to Florida every year, wear a new outfit every day, etc., they come to believe that such is Lequired of them too, and in their minds these things become necessities that must be satisfied. The fallacy .of such ~rea.soning comes,from the setting up of one's .social or professional sur-roundings as an absolute ~in determining personal needs. It ought to be evi-dent that even if all the teachers of the school have a car, and if all the families in the area have two television sets, I do not necessarily need the same things. It also ha.ppens that this met.hod of evaluating needs ac.cord-ing to a social or professi0nal milieu soon involves various forms of dis-crimination, ail.harmf.ul to .the ,building of a fraternal community. Let us add that economy, valid as it may be, often prejudices one?s judgment of personal needs. To know how to economize is a quality that most people of average means acquire through° force of circumstances, That religious should possess, it is nother surprising nor embarrassing.;Waste-fulness and .extravagance, as well as carelessness, have always been,.con-sidered faults. The error, in the case of the religious, is to purchase things, not because ~one may need them, but because they are on sale and that per-haps one day they will be useful. It is also true that this intention of econo-mizing has a way of multiplying needs. The Influence of Numbers ,, In visiting a number of local commu~nities I ~have ~liscovered that re-ligious in small groups have their real needs satisfied much more easily than do religious in.larger gr.oups: Although not universal, this situation is repre-sentativ, e of a number of congregations. Of course, there are many cases in which it is reasonable and necessary ¯ to take numbers, into consideration. For example, if the local authority in a community of one hundred persons is planning an outing which includes transportation and lunch~ it is obvious that one must consider the number of those who wish to participate. The influence of numbers can, however, become harmful to community sharing when., a particular type .of logic prevails as sometimes happens in larg~ groups, though it. may also be found in more restricted ones, too. For example, two or three religious.desire to obtain skis in order to satisfy.a real need for relaxation, so they go to the local authority with their req.uest only to receive this answer: I cannot authorize such an expenditure; just think of the money involved if the sixty religious of the house were to come asking for skis! This reasoning characterizes a mentality which cerl~ainly is not pluralistic ,'and which fails to respect personal needs. That two or three religious desire some skis in no way implies that all the others need or even wish them. The falseness of this reasoning is even more evident Review ]or Religious, Volume 33, 1974/2 when we realize that the community is made up for the most part of older people or of those who are ill. On pushing this kind of logic to the extreme, one ought to refuse a wheelchair to a sick person who really needs one because everyone else might want one too. This type of reasoning may also exist among some members of the community group. They refrain from asking for what they really need be-cause they say: If everybody were to ask for such a thing, the community could not afford it. However, it is nowhere written that all the religious of a house must have the same needs at the same time, and that to satisfy them one must buy sixty canes or sixty wigs at the same time! Why, then, should we suppose this uniformity and always act in view of the total num-ber? Wherever this kind of logic dominates, whether on the part of the superior or of the members of the group matters little, it makes impossible the practice of community sharing according to need. The Moral Weight of Salaries The religious earning a high salary seems to have a special facility for getting what he needs and often more than he needs, while the one who makes no financial contribution is sometimes too embarrassed to make known real needs. Other variants of this phenomenon are these: The re-ligious in a salaried service who works overtime may think it his right to keep and to use as he pleases at least a part of the extra money so earned; the one who has won a grant or money award will not fail to exploit his chance of obtaining favors; the religious who receives an "old-age pension" and the one who regularly draws some form of income may also use these to obtain personal advantages. The moral weight of money earned by a religious' likewise risks in-fluencing the decisions of the superior. Does he feel as free and no more obligated in evaluating the requests of the one who hands in a substantial check than he does in judging those requests made by members who make no such contribution? It would not be surprising if, in the first case, he finds a particular facility in saying "yes" at once and with a smile, while in the second case, he has a tendency to ask questions about the necessity of the items requested and to multiply his reflections on the observance of poverty. In allowing a lapse of time between turning in one's check and making a request for what one judges useful or necessary, the religious can help those in authority to avoid showing favor and granting to him as to the others only what he really needs. At the provincial level we occasionally see this tendency in operation in those cases in which authority tends to discriminate between local groups of varying incomes. Groups with significant revenues sometimes receive more easily the authorization for extra expenditures than another poorer group, though the actual needs of the two groups may be identical. If such is the case, it is evident that discrimination is practiced in dealing with local Authentic Sharing in Community / 285 groups, a situation very detrimental in the realization of a truly fraternal community. The Matter o~ Gi~ts It also happens that the reception of gifts sometimes prevents sharing according to need. The religious, benefiting from the generosity of family or friends, is often better provided for than the one who must depend solely on the community. In order to justify the keeping or the use of things received, the religious reasons that he got them gratuitously when he ought rather to be motivated by real need. If our poverty permits us to accept gifts, they must nevertheless be used for all without discrimina-tion. This means that the religious may not have more because he receives more, but that all needs be judged by the same standard and that all be treated in the same manner. Whether the .goods to satisfy our needs comes from within or from outside the community is of lesser consequence. Two other observations must be made here in regard to gifts. Certain religious still declare that the refusal of anything offered to them by their parents, friends, or others, always constitutes a failure against poverty, indeed an injustice to the congregation. As it stands, this statement is inaccurate. The refusal of certain goods offered is sometimes required by our commitment to poverty. Such is the case when an individual or moral person does not need that which is offered, and in addition, the donor re-fuses any transfer of his gift. Such is likewise the case when, in response to a real need, a religious is offered something which can in no way be justified by the norms of simplicity. The second observation bears on the "intention of the donor." The intention clearly expressed by the donor does not suppress or replace the authorization required for the keeping and the use of goods. A religious cannot go to Europe simply because his parents have given him~the money for the trip. If competent authority refuses him" the permission and if the intention of the parents about the destination of their gift remains fixed, there is nothing left for the religious to do but to refuse or to return the money. However, in the majority of cases, it is not necessary to be scrupulous about respecting the intention of the donor. Many people offer us small gifts (the notion of "small" varies considerably, of course) and say to us: This is for you, for your personal needs, clothing, recreation, etc. If we took the time to explain our way of life to them as a community sharing a common fund, they would probably be quite happy to allow one of our companions to benefit from their generosity.Though we rarely explain this to them, we can ordinarily, without any qualms of conscience, pre-sume their understanding acceptance and put in the common fund what-ever we receive. 2116 / Revie.w for Religious, Volume 33, 1974/2 On the contrary, the intention of the °donor must be respected when the gift is made in the form of an inheritance or legacy. Let us make clear, however, that the religious to whom these goods have been offered alway~ has the right to refuse them. He even has the duty to do so in a case in which the, acceptance of an inheritance or legacy, involves obligations ~otaily or partially in violation of his religious 9ommitments. We must also understand that. authority does sometimes have a word to say in our ac-ceptance or refusal of such goods. The Moral Weight of Competence, Position, and Conduct In this matter of sharing, the professional status of religious some-times operates in his favor. Experience shows that in certain cases the religious~ ,possessing special qualifications obtains what he needs more easily than does his confrere who lacks such competence; he may even receive a ~urplu~ while the other is deprived of basic necessities. We have no intention of condemning competence; but under pain of closing our eyes to reality, we must acknowledge that this competence does sometimes exercise a moral influence on those presenting their needs, inclining them to ask for more than they really need. It may also influence those whose role is to insure .a just distribution of material resources in their application of the principle of real need. Experience0shows us that a past office may become another pretext for keeping and us_ing certain goods. The religious whose work required a specialized library, for example, may have a strong inclina.tion to keep it even after he no longer occupies the position which once required it. The one who needed a car for his work will be tempted to continue to keep it even after he is transferred to another office which in no way requires its use. Certain personal itnd marginal benefits connected with having a car make it very .painful for him to give it up. Again it may happen that one's present position Fay serve as an oc-casion for the granting or obtaining.of favors either for self or for others. Thus a superior, as soon as he is named,.,may ask for a ~'oom with a bath attached. Is this to help him fulfill his office"moi'e efffctively? Is such an installation really needed for his work? If not, how can he justify requesting it for himself while refusing it to others. It is no more justifiabl~ for a superior to use the pretext of his office to receive and to keep as long as he wishes all the magazines that come to the house. How can one approve such action? If he were in charge of formation and if, with the consent of the community or of authority, he had a prior right or even exclusive right to the use of a magazine published for formation personnel, nobody would complain. But no one can accept, and with reason, that an individual in virtue of his office, keep for himself as long as he likes the newspapers and magazines :meant for the use of all. Such practice is an obstacle to fraternal sharing. The one whose function Authentic Sharing in Community is to build community ought to be the first to ~remove from his own life anything that might compromise it. Let me add as a last moral influence a particular type of conduct in which a few religious indulge when making a request to authority. Their tone, gestures, and manner in general can be so high-handed that it be-comes almost impossible for the superior to refuse, even when he judges superfluous the object requested. When dealing with such persons he per-haps says to himself: It is easier to grant them what they want at once than to put up with the endless scenes and references to the matter that they will make if it is denied them. The superior may even justify his action by saying that he consented in "order to avoid a greater evil. All the same, that will not prevent those in the community from believing that at times a dif-ficult disposition does get results. While we understand the delicate posi-tion of authority in these instances, we must also recognize that such con-duct on the part of a member of the group can be an obstacle to fraternal sharing as it prevents the application of the principle: each according to need. The Influence of Social Convention According to current styles and in varying degrees, social convention may also influence both the religious in determining his needs, and the su-perior whose role is to assure that fraternal dimension of communal shar-ing proper to a religious household. Ordinarily we find it easier to ask for those things~ accepted by social convention than for those outside it. The superior in turn has a tendency to authorize more quickly those things it approves than those which are indifferent or contrary, to it. In this way social convention sometimes exerts a destructive influence on the charitable quality which ought to characterize our sharing from a common fund ac-cording to individual needs. . In considering the influence of social convention on religious, it cer-tainly explains at least in. part their attitude toward smoking, for example. The religious who smokes normally receives the necessary tobacco even though the expense occasioned ma~, be as high as two or three hundred dollars a year. The need to smoke, createdand developed by him, no longer requires critical evaluation but is taken for granted; and when the com-munity budget is prepared, there is no hesitation about'setting aside im-portant sums for it. ~ : It is not at all,certain, on the other h~nd, that the philatelist would so easily be allotted a similar sum for the purchas.e of new stamps. How does it happen that we consent so easily to satisfy the needs of the one who smokes but refuse those of the stamp collector? The pressure of social con-vention would seem to be the exp!anation. Under pain of being considered out of step with the times, religious cannot ignore social convention completelyi but by conforming to it with- 2811 / Review for Religious, Volume 33, 1974/2 out discrimination they can create needs the satisfaction of which amounts to real slavery and causes surprise and even scandal to others. Religious ought to be free enough, for example, in the matter of dress to avoid mak-ing an absolute of an outmoded costume and to consider relative those fashions which social convention seeks to impose on them everyday. This relativity can be expressed in one's choice of classic styles, simple and few in number, and much less subject to frequent and costly change than those passing fads which are here today and forgotten tomorrow. If it is normal for religious to be aware of social usage and to observe it when in their exterior relations they judge it necessary or useful, they must make the necessary effort to prevent it from entering so deeply into their lives as to create an endless chain of new needs. Let it suffice to men-tion the use of alcoholic drinks. Rare are those social functions, meals, and evenings from Which these are absent. If the religious is not on his guard, in multiplying his social relationships, he risks developing an acute need for alcohol. In this case, satisfaction can never be regarded as liberation, but rather a most insidious form of personal slavery. A Lack of Empathy Lack of empathy is particularly noticeable on those occasions when a religious must submit to a superior or to other members of his group his personal needs in view of an evaluation or control. It may happen that one's first reaction is to make comparisons with one's own needs, forgetting that each one is unique and therefore different; And so the superior says: I don't understand why you want to buy this secular outfit; I don'~ wear one and I've never suffered from not doing so. Or again: I never went to hear such and such a singer; I don't see what advantage you can get out of an evening so spent. Such a person never tries to put himself in the position of the one asking in order to be better able to understand his needs. He seeks rather to impose his own values on the other person or again to convince him that he does not have such a need because as superior he himself never experienced it. Without exactly realizing it, the superior may set himself up as a sort of prototype whom the others would profit by imitating. In following this sort of logic, ought he not require others to be hungry at the same time he is and with the same intensity, to be sleepy when he is, and to require the same number of hours of sleep? People incapable of this empathy are quite unable to evaluate the needs of others. We might as well say at the same time that they do not know how to exercise the service of authority, since they will never be able to understand those whom they are supposed to help. They may think they understand others, but as a matter of fact they understand only that which they can project on others. In general the person with little empathy is intolerant, not through ill will, but through his inability to put himself Authentic Sharing in Community / 2119 in the position of others. In wishing them well, he may even impose on them things that may cause them serious harm. Exclusive or Prior Right to Use The use of certain equipment may be necessary for a religious in the fulfillment of his office. It is considered essential for his work and he could not give it up without compromising the task confided to him. Such usage is valid and his confreres readily accept his use of what is neces-sary; but if they see that he has reserved for his exclusive use things for which he has no real need, at least at certain times, feelings of discontent-ment and a sense of injustice are not slow in surfacing. An example will help to make my point clear. Let us suppose that my work requires the use of a car quite regularly. On the days when I don't have to make any trips, those times when I travel by plane, am I going to lock up the car when I could just as well let others use it? If I put the car in the garage and the keys in my pocket, and if I force my com-panions to take the bus for their trips when the use of a car would be much appreciated and a real convenience for them, can I say sincerely that I am living the principle of fraternal sharing? In order to justify my conduct, I can no doubt find many reasons: A car is something one doesn't lend to just anybody; I must keep the things I need for my work in good condition; no one knows how to take care of them as I do; it is often a costly business to lend one's equipment; thb community has other cars for general use; etc. Underneath these reasons, all of which contain some element of truth, there is perhaps another which I won't admit: an undue attachment which makes me a slave of this thing. Deep down I prefer its safekeeping to communion with my brothers. In fact, my refusal to put the car at their disposition, far from favoring inter-personal relations, risks destroying them altogether and setting up barriers which are difficult to break down. If, after such conduct, I dare to repeat that goods should be oriented toward the well-being of the group and the strengthening of mutual relations, I must admit that in practice I sub-ordinate persons to things. If in my work, instead of this exclusive right to the use of equipment, I exercise what may be called a prior right to its use, I will quickly come to realize to what degree this type of use and the mentality which it de-velops favor fraternal union. Nobody denies that there are certain incon-veniences in this kind of sharing, that one risks finding one's things out of order, not in the same condition as one left them, etc. However, be-fore committing myself to sharing, ought I wait until no such risks are involved? If so, I mi~ght just as well say categorically that I refuse to share. Of course, everyone recognizes the existence of an occasional case when it would be better to keep one's tools exclusively for personal use. Such exceptions, however, do not modify the general rule according to 290 / Review ]or Religious, Volume 33, 1974/2 which the religious ought to exercise a prior right rather than an exclusive one to the use of those things necessary for the accomplishment of his duties. The first recognizes and favors fraternal sharing, while the second usually cuts it off abruptly. The Proprietor's Mentality Every religious making use of community goods can say, and he has reason: This property belongs to me; it has been put at my disposition by a moral person called the "province" or "institute." He may be inclined per-haps, in ~order to justify his poverty before those who do not believe in it anymore, to exaggerate the inconveniences of such a situation and to keep silent about the advantages which it affords. Sometimes he will even cover up his possessive attitude with regard to certain things saying that they do not belong to him and therefore he cannot lend them. Under pain of deny-ing the evidence, we must admit that some religious seem to have a pro-prietor's mentality with regard to goods belonging to the province or in-stitute. Such a mentality is an obstacle to fraternal sharing. If, in order to illustrate my idea, I use the community treasurer as an example, it is not that this mentality is more widespread among them than among other religious, but because frequent reference is made to them when this topic is discussed. In fact, it often happens that the treasurer acts as if he were the proprietor of the community's goods. He feels free to ask ques-tions, even indiscreet ones, about the sums of money requested, while actu-ally it is his business simply to hand over what has been authorized. He scolds others for expenditures which he has no right to judge. He may even insist on an itemized account which normally is given to the superior. When he gives out money, his gesture is marked by a pained expression as if part-ing with it hurt him physicallly. If we describe it at its worst, we might say that in keeping the purse-strings, he seems to keep the whole community on a,.leash. This caricature, although rough!y drawn, is not entirely the fruit of the imagination. If I have exaggerated some situations, I have reproduced others with an accuracy that no one can deny. It is not surprising if religious, subjected to caprices of this kind, no longer dare ask the community even for what is necessary, but arrange to obtain it outside, or keep a part of their salary or gifts received, in order to satisfy their needs. The changing of the name "procurator" to "economist," "treasurer," "controller," or whatever, does not remedy the evil. The real problem is not one of vocabulary, but of one's way of thinking, and it is this that must be changed. The bursar must recognize, in theory and in practice, that the property confided to his administration belongs to the community., that his task consists in managing it with competence, and in distributing it amiably to religious whose needs have been approved by authority. His office must not be the scene of daily contention, but rather a place where love operates under the guise of both gift and welcome. Authentic Sharing in Commitnity / Let me express sincere appreciation to all those religious who fill their post as treasurer with competency, interior detachment, and in a spirit of service. Everyone knows that theirs is often a thankless task, and one we could not do without. In accomplishing it with that joy and tact which love knows how to exercise, they can do much towards the realization of the ideal of fraternal sharing according to the real needs of each one. Fear, Embarrassment, Shame, Scruples in Regard to Asking Strange as it may appear, there are still some religious who are unable to express their real needs, who prefer to deprive themselves of what they need rather than ask for it. These religious, either by temperament or for-mation, have developed in themselves a fear, an embarrassment, shame, or even scruples about asking. Among them are those who are not earning, and on this account dare not mention their needs. Some of them think of themselves as a burden to the community. While helping these religious to free themselves from whatever prevents them" from asking for what they need, authority must take the initiative, offering them and even giving them whatever they may need. If this is considered an exaggeration, it is better to fail on the side of kindness and attention than on that of indifference and privation. It is always easier to notice the people who abuse than those whom we abuse. There also exists on the part of some a certain shame and embarrass-ment about asking which may be the result of our manner of community living and sharing in the past. I understand the uneasiness of those of thirty, forty, fifty, and more who still ask local authority or the treasurer for stamps, letter-paper, tooth-paste, soap, etc., but such a practice of com, munity sharing can no longer be justified in the name of poverty. Though long since outmoded, it has not yet totally disappeared. In my opinion it would be so much simpler, so much more adult and reas6nable, to put all these things for common use in a place where each one could take what he needs as he needs it. It is useless to complain of possible abuse in order to refuse such an elementary practice. The existence of such abuse is inevitable, whatever the manner of living the principle of common sharing. Would it not be better that the abuses accompany an adult practice of sharing instead of a childish and embarrassing one? In conclusion on this point let me say that one of the gravest abuses of the practice of religious poverty is that form of dependence which encourages and even develops personal irresponsi-bility. The Application of Various Formulas for Sharing Though there are several formulas for the sharing of go~ds, I do not in-tend here to present the advantages and inconveniences of each. I wish only to point out that the manner of applying any valid formula is able to trans-form it into an obstacle to fraternal sharing. Take for example the individual 292 / Review ]or Religious, F'olume 33, 1974/2 budget. It is, for religious in general, a practical manner for determining needs and when approved, of receiving whatever is necessary to meet them. This does not mean, however, that such a formula is best for all the religious of an institute, or of a province, or of a local community. There are some people who find a personal budget more of a useless bother than a help in practicing religious poverty. Why impose it on them then? On the other hand, why forbid it to the rest of the community just because some do not find it helpful? In ~. word, fraternal sharing is not free when the individual budget is refused or imposed on all alike. In those communities in which, in order to respect personal needs, the community budget is made obligatory and the individual budget optional, uniformity may compromise the quality of fraternal sharing. As regards the community budget it is rare, thanks be to God, to hear people use the argu-ment of uniformity to obtain more, to grant or to refuse permission. Wherever uniformity is the sole criterion for making requests or granting authorization, fraternal charity in the treatment of local groups is often ignored. Though two communities may be made up of the same number of persons, it does not follow that the needs of one be identical to the needs of the other. To respect each group in its uniqueness requires ordinarily both diversity and plurality in the manner of treatment. It is the same for individuals. How can anyone justify uniformity in the amount of money granted annually to religious who make use of a budget? Let us take the matter of clothing, for example. The one who is small and well-built will surely have an advantage over another less well-proportioned, with bulges here and there, not to mention fiat feet! Some would remedy this situation by asking that the first person hand in what he has left over, and that the second ask for what he still needs. However, one must admit that the latter remains in an awkward position as it is always harder to ex-tend the hand to receive than to turn in a surplus. In the end, would it not be simpler and more charitable to leave each one free to evaluate his cloth-ing needs and to ask for the money necessary to take care of them. The individual budget plan by which a uniform lump sum is given to all religious also presents, in actual practice, certain facets detrimental to fraternal sharing. Let us suppose that each religious of a local community receives $2500 annually, and that it is left to him to allocate this sum as he sees fit. Such procedure risks creating unjustifiable inequality. Religious whose parents live a few miles away will spend very little to goto see them regularly, while another having parents living at a distance, can visit them only rarely and under pain of seriously jeopardizing his budget. Isn't this a form of discrimination? Another weakness inherent in this plan is that the religious who can economize will manage to procure all sorts of valuable objects (record-play-ers, tape-recorders, etc.) and will have the clear impression, even the con- Authentic Sharing in Community / 293 viction, that these belong to h, im. Of course, he will feel free to take them with him on changing residenc~. As a last obstacle to fraternal sharing, let me add the refusal a priori of approving several different plains and allowing them to be used within the local community as the memlSers judge best. One would respect individual needs more surely if some wer~ permitted to use an individual budget, while others were given an allowan+e for expenses, and still others received the money necessary as the need arose. There are some very deserving religious who do not have any use for a~ individual budget or for a regular allowance and who desire to continue to~ practice poverty by asking for things as they need them. We violate the fraternal quality of our sharing if we impose on them a plan which burdens rather than frees them in their service of God. Conclusion The practice of fraternal sfiaring to which we are bound bestows on our I . community of goods its evangehcal and religious significance. Indeed, it is in order to strengthen the fraiernal bond which unites us and to express it before the world that we have chosen to put all our possessions into a com-mon fund, and to share them according to the real needs of each one. The obstacles that this sharing mebts in practice prove that it is difficult for all of us, because of our sinful condition, to observe perfectly that which we desire with all our hearts. However, the rehg~ous who recognizes the diffi-culties and makes an effort to leliminate them from his life, demonstrates his faith in those values for whic~ the fraternal community stands and his de-sire to collaborate construct~ve, ly in building it, depending on the support of Jesus Christ, thecenter of oui" lives, for a more perfect realization of it. The General Chapter of Affairs Joseph F. Gallen, S.J. Joseph F. Gallen, S.J., a specialist !n canon law for religious, writes from St. Joseph'.s Church: 321 Willing's Alley; Philadelphia, Pennsylvania 19106. Pre-chapter Preparation : Pre-chapter preparation, despite its evident need, was almost univer-sally unknown before post-Vatican II general and provincial chapters. The delegates'to the general chapter should be elected hbout a year before the assehably of the chapter. This will make it possible to have the pre-chapter committees constituted predominantly of chapter members from the begin-ning. The superior general and his council, or a committee appointed by him, could have already inaugurated the work by securing the proposals from the members of the institute and having them arranged according to subject matter. These could be given almost immediately to the pre-chapter committees. The delegates may be elected earlier than a date determined in the constitutions, e.g., six months before the assembly of the chapter. This determination of time is a very accidental aspect of the law, and a rea-sonable cause excuses from it. The more fundamental content of such a law is to elect the delegates at a time that will give the best possible preparation for the chapter. I think myself that a committee of more than five is gener-ally less efficient. If the quantity of the work so demands, several parallel or sub-committees can be designated. As many as possible of those on a com-mittee should be competent in the field of the committee. Each institute should know from its experience of recent chapters and from the problems now facing it just what committees are needed. There should be a steering or co-ordinating committee. Other committees have been on the religious life, vows, constitutions, government, liturgy, formation, apostolate, finances, 294 The General Chapter o] Affairs / 295 retirement, and habit. Canon law has no legislation on committees. There-fore, it depends on the particular institute to determine the committees and their work; the members and chairpersons may be elected or appointed or be designated partially by both election and appointment; the chairpersons may be elected by the members of the particular committee. Manner of Pre-chapter Committee Preparation The one directing the pre-chapter preparation gives the proposals or chapter matter to the chairpersons of the pertinent committees, who in turn distribute them to the individual members of the committees to ~work up, dividing the matter as evenly as possible. Let us suppose that the following proposal has been assigned to an individual of the government committee: the term of office of the superior general should be reduced from six to five (four) years, with only one immediate re-election permitted. The committee member is to work up a report on this proposal in the manner of a secretary, an objective researcher, not as a supporter or antag-onist of the proposal or as a policy maker. The chapter makes the decision on enactments and policy, not the committee. The first thing the committee member does is to write down the number of the proposal, if these are num-bered. Identical and almost identical proposals are to be treated together on the same report. The committee member therefore next notes on the report the number that submitted it, for:example: 36 handed in this proposal for a five and 15 for a four year term. He then expresses the proposal in one statement or in parts but both in such a way as to permit a yes-no discussion and a yes-no decision. He next, under the heading~of sense, gives any ex-planations of the proposal, always being complete throughout the report but as ~clear and brief as possible. Submitted proposals, are almost, always wordier and more obscure than the example given above, but the term "im-mediate" in the example above could be briefly explained. He could well conclude the section on sense by a statement such as the following: The pi'oposal contains two ideas, a five (four) instead o1~ a"six year term andonly one immediate re-election. The heart of his report is in the following sec-tion, in which he gives all~ the reasons for and then all the reasons against the proposal, noting when any of these reasons has greater weight for or against the four than the five year term. He ends the report with his recom-mended decision: to be accepted, to be rejected, to be accepted with modi-fications. It is evident that the reasons for the acceptance or rejection are the favorable or unfavorable reasons he has already listed. He should add his reasons for suggesting modifications. Copies of this report are distributed to all the committee members. They are to be given adequate time for its study. When a sufficient number of reports are ready, they are to be dis-cussed in a committee meeting. The committee confirms, rejects in whole or in part, and corrects the report of the individual member, which thus becomes the committee report. The committee vote on the report and its :296 / Review for Religious, Volume 33, 1974/2 distinct parts should be included on it, e.g., 3 for, 2 against. Reports for all the proposals to be discussed in any period of sessions should be ready be-fore that period begins. These should be distributed to the capitulars at least on their arrival so that they can be properly studied. The failure to have such reports is a primary cause for the many unreflecting, inefficient, and slow general chapters we have had in the post-Vatican II years. Any religious experienced in chapters should see the need of reports of the type described above. They are demanded by evident facts. The primary such fact is that a chapter should make its decisions from convictions based on solid reasons. This will certainly not be attained unless there is a thorough investigation and study of the facts and reasons. It is also a sufficiently evident and most pertinent fact that many of the capitulars will not study the proposals beforehand. The reports will help to lessen their uninformed voting. Many capitulars will not be able to understand some proposals with-out such a report, for example, those who have had no experience in han-dling large sums of money can find financial proposals difficult to understand, and a religious who has not been in the novitiate since he left it thirty years ago will find. many ideas on formation most difficult to grasp. Proposals handed in by chapter members during the chapter should be processed through the pertinent committee in the manner described above. Subject Matter of the General Chapter of Affairs The norm of the practice of the Holy See for this has been the more im-portant matters that concern the entire institute. If the matter is not more important or does not concern the entire institute, it appertains to the ordi-nary government of the general, provincial, or local superiors. In the con-crete this matter has consisted of the proposals submitted by the members, provincial chapters, and the general capitulars during the time of the general chapter. The first observation is that the proposals under one aspect can readily be insufficient. Almost universally the proposals on a particular matter do not touch, at least adequately, all the more important aspects, difficulties, and problems of the particular field. Quite often they are concerned only with its accidental and lesser aspects. Very frequently also the admittance of a proposal will demand as a consequence or antecedently presume another proposal which has not been submitted. In all such cases, the pertinent com-mittee should add the required proposals, noting on each its committee source and the reasons why it was submitted by the committee. It is not very intelligent to have the submitted proposals as the subject matter, with-out designating anyone to point out and supply for the omissions and the lack of balance. In such a system, it can be almost a mere accident that the general chapter faces all the real problems of the institute. There has to be a way of rejecting very expeditiously the proposals that are less important and general or otherwise evidently inadmissible. Each The General Chapter of Affairs / 297 committee should list all such proposals submitted to it, and very early sub-mit this list to the co-ordinating committee. The latter should go over the lists and have them duplicated and distributed to the chapter members. Sufficient time should be granted for the proper study of the lists, and the chapter is then to be asked to reject all of them in the one vote. The per-mitted recourse against rejection should be of the following type. If a capitu-lar, not the one who submitted the proposal as such, believes that any such rejected proposal is worthy of a committee report and chapter discussion, he should hand in this proposal with his reasons for its repeated presenta-tion. The verdict on confirming or rescinding the rejection should not be made by the original rejecting committee but by the co-ordinating com-mittee. This will avoid having the same committee as both judge and de-fendant in the recourse. Greater Reduction of Matter Is Necessary The reduction of the work of the general chapter has to be much greater than the mere immediate rejection of proposals considered less important, less general, or otherwise evidently inadmissible in the past. No general chapter can s.atisfactorily handle a thousand or two thousand proposals. This is true even if the pre-chapter prepa.ration is most thorough and com-plete, The number of proposals that confronted very many post-Vatican II general chapters was prostrating. Nor is it sensible to think of more fre-quent general chapters; we have too many now. Not a great number of them have been religiously effective, and there is nothing in multiplication that augurs greater effectiveness. Perhaps the remedy is to cut down very severely the work of the general chapter to the particular matters that are very highly important and urgent and to give much greater attention to policies than to enactments and changes of enactments and laws in particular matters. Present Mentality Few will now even question the statement that we are faced by a crisis of authority. Pope Paul VI has often spoken~ of this crisis, for example: To mention another: there is the excessive emphasis on the right of the indi-vidual to do as he pleases, which leads to the rejection of any and all limits imposed from without and of any and all authority, however legitimate it may be (May 25, 1968, The Pope Speaks, 13 [1968], 222). In this way a mentality is spread which would like to claim that dis-obedience is legitimate and justified in order to protect the freedom that the sons of God should enjoy (January 29, 1970, ibid., 15 [1970], 54). Since therefore it is a visible society, the Church must necessarily have the power and function of making laws and seeing to it that they are obeyed. The Church's members in turn are obliged in conscience to observe these laws (December 13, 1972, ibid., 17 [1973], 376). This mentality of hostility tO authority and law is one of the very im-portant and urgent matters that a general chapter must face and strive to 2911 / Review ]or Religious, Volume 33, 1974/2 change, but it is also a fact that makes one question the enactment of many laws at present. Matters Excluded from the Competence of General Chapters Possessing Experimental Authority These chapters obviously cannot change ( 1 ) divine law, whether natural or revealed; (2) and without the previous appro'~al of the Sacred Congrega-tion for Religious and Secular Institutes these chapters may not put into effect anything that is contrary to the common law (canonical prescriptions, laws of Vatican II, and other laws and decrees of the Holy See); nor (3) make any change in the purpose, nature, and characteristics of any institute or in the Rule of an institute (Ecclesiae sanctae, n6. 6). Proposals These are made by the members of the institute and by provincial chap-ters. All are to be encouraged to make proposals; all are equally to be counseled to make only good proposals, and this means good for the entire institute. A proposal is to be judged by its content, but an obscure and un-duly long proposal is a certain indication of insufficient thought. The insuffi-ciency in this: case frequently extends to the content of the proposal. To find l~roposals a religious, should go over the life of the individual members and of,the community immediately with God, the community life, and the life of work. He should go through all pertinent books, e.g., the constitutions. He is to evaluate and to find ways to correct and improve the life of sanc-tity, the apostolate, the present policies and trends of the institute, its public image in the Church and in.general. He should evaluate, all innovations of the post-Vatican II years. Have they succeeded, failed, and in each case to what extent? Have the members of the institute become better religious, better participants in the community life, better apostles? What are the big problems facing the institute today? What is their solution? What is the re-ligious' effectiveness of superiors, their councilors, those in charge of forma-tion, of the works of the al:iOstolate? Is the tenor and style of life in the houses conducive to the religious life, the apostolate, a religiously satisfy-ing community life? Are your proposals solid, progressive without being im-prudent? Do they all propose freedom from something that is difficult and demands sacrifice? Proposals must be signed only and to the extent that this is com-manded by the law of the institute. A final day, well ahead of the opening of the general chapter, must be determined for the handing in of proposals. All, including general capitulars, should hand in their proposals during this tim& The general capitulars retain the right of making proposals during the chapter: Toward the close of the chapter, a date is to be determined be-yond which no proposal will be accepted. All of these provisions are to enable the committees to process the proposals properly and in due time. The General Chapter o/ Affairs / 299. The right to make proposals is determined by the law or practice of the particular institute. Those who do not have this right may suggest proposals, preferably in writing, to ~those who do enjoy the right. The latter may but are .not obliged to accept merely suggested proposals (see Review ]or Re-ligious, 23 [1964], 359-64). Position Papers and Questionnaires These were the high hurdle and wide stream obstacles in the procedure of. so many special general chapters, and few of these chapters landed fully on the opposite bank. Position papers were also at times a means on the part of committees of appropriating to themselves the policy making func-tion of the chapter. Questionnaires were frequently the substitution of a none too reasonable head count for a vote given because of convincing reasons. A background paper or questionnaire is only rarely necessary or advisable, e.g, an intelligent vote, for or against a particular proposal can demand a brief historical description. If so, the background paper should be prepared.~ Authority of the Superior General in Pre-chapter Preparation The superior general, assisted by his council, has authority over the entire pre-chapter preparation. This is evident from the fact that, outside of the general chapter, there is no one else on the general level of authority and from canon 502, which places the institute under his authority (see Ecclesiae sanctae, no. 4). Frequently at least a superior general gives ample delegation to. another religious to direct and supervise this preparation, e.g., to the Chairperson, of the steering or co-ordinating committee. However, the superior general can always lessen or~'withdraw such authority, lie may also always step in to correct and guide particular matters, individuals, or committees. Post-Vatican II general and provinc, ial chapters have often been vanquished in the pre-chapter preparation. The game was lost before it began. The superior general is not arbitrarily to interfere in or hamper the, work of the committees, but he should be completely aware of what is going on in all committees. He should be very sensitive to a too conservative or a too leftist~ approach and, even more practically, ~to a group that is unduly and wrongly influencing the pre-chapter preparation. ' Attaining a:Universal Voice in Chapters Especially since about 1965 we have had a constant clamor that the religious of temporary vows or other commitment be permitted to be dele-gates to the general and provincial chapters. This has been an outstandingly unreal issue of recent years.The clear fact has been that the young were talking in the chapters and pre-chapter preparation. The voice that was not being heard was that of the older and of many middle-aged religious and chapter members. This has been true also in other discussion groups, for example, local community discussions. Our need and problem of the-mo- 300 / Review ]or Religious, Volume 33, 1974/2 ment is to hear the older and the middle-aged religious. I doubt that this can be attained at this time except by having the chapter discussions start with small discussion groups. Each group should be composed of religious of all ages. This system would demand a sufficiently competent chairperson and secretary in each group, the report by the secretary of the group, and the distribution of copies of the reports of each group and of the composite report of all the groups before the common discussion of the matter in the whole chapter. The attainment of the most accurate and efficient procedure in this matter demands a very thorough study. Discussion groups are a time consuming means. They could be employed only for the more serious mat-ters. My own sincere judgment, based on the observation of chapters, is that such a means is necessary to hear the voice of the older and of many mid-dle- aged religious, especially of sisters. Part of the factual basis of this judg-ment is the lack of the older and middle-aged voice manifested very gen-erally in post-Vatican II chapters, that is, the effects that.revealed an inex-perienced, imprudent, and exaggerated origin. As far back as 1901, the Roman Congregations governing religious have refused to approve those of temporary vows or other commitment as dele-gates in the general and provincial chapters. Chapter Principles The preceding section on proposals lists fairly adequately the aspects and fields that can give rise to proposals. Proposals can also be drawn from the principles that should guide chapters, communities, and individuals, which we shall give in this section. The supreme principle is that all should seek the greater good of the Church and of the whole institute, not merely of some part of it or of some group in it. Seek the good not merely of the young, but also of the middle-aged and the aged. A high degree of differ-ence in some aspect of life that is verified in any particular country or re-gion should receive its proper consideration. This is to be true not merely of the United States but of any other country, of Germany, France, Italy, England, Japan. Differences do not exist in all aspects of life. The American has no less need of prayer and mortification than the Italian. Obviously no nation is to give the impression of being superior to all other nations. All should retain all the good of the past and be willing to accept all good ideas of the present and of the future. It is equally the duty of all to oppose anything that is useless or harmful to the institute or its members. Any false principle such as disobedience, especially if public, to the govern-ing or teaching authority of the Church should be immediately rejected. The goal in prayer is not freedom but a more universal life of constant prayer. The Holy Spirit guides practically all of us by the ordinary way, and this implies that our problems, difficulties and their solution are at least gen-erally ordinary. Little will be gained from a study of oriental mysticism or concentration or from emphasizing the charismatic. Much will be gained to The General Chapter o] Affairs / 301 the extent that it is realized that the difficulties in prayer are the very ordi-nary things of the lack of desire for sanctity of life, the unwillingness to make the sacrifices that such a life demands, the lack of a realization that prayer demands a constant effort, an impersonal spirituality, a poor introduction to mental prayer, a complicated system or machinery of mental prayer, a neglect of spiritual reading, a life that is merely activist, natural, secular, and similar ordinary things. If a chapter accepts open placement, how can the institute staff missions, colleges, hospitals, schools, homes for the aged? Can there be a generally satisfying community life when there is unlimited home visiting and unlimited going out for diversion? W.hy always leap to the new, the youthful, the leftist? Certainly sometimes the old, the moderate, the conservative is the true, the relevant, the practical. Why run to manage-ment consultants before you have tried a thorough investigation, study, and planning on your own? If any advisers gave false and imprudent advice, this advice can be the perfect mirror of what was wanted. List everything that your institute has adopted in renewal and adaptation. How many of these have helped the members to become better religious, better apostles, better Catholics? It is certainly not easy to start all over; neither is it any too comfortable to be on a plane that is speeding to certain extinction. The dominant thought of any chapter has to be the spiritual, the su-pernatural, the eternal not only with regard to the personal lives of the in-dividual religious but also to the apostolate and community life. Natural development and fulfillment and social work are important but not primary, nor are they the soul of the religious life or of its apostolate. Reject ideas and proposals that are disproportionately expensive. All experimentation in the Church and much more its worship should be carried out in a manner that is adult, mature, dignified, restrained rather than undisciplined and reckless, and not marred by the extremes of either the right or the left. The common saying is that religious dress is not an important question. This is true of religious dress in the abstract and considered merely in itself. In its effects and ramifications, religious dress, especially of women, is certainly an important question. In the past the error was to identify the old with the true, the good, and the relevant; the same error is verified now with regard to the new. Re-evaluate every post-Vatican II experiment and change. In-vestigate every question and adopt the solution that the facts demand or counsel; do not start off with a new structure or theory. The goal is only secondarily to renew and adapt the institute; the primary purpose must be to influence the religious to renew and adapt themselves. The thrust is pri-marily personal, not institutional. There is one essential test of past, present, and future experimentation. Does it produce greater sanctity of life, a deeper and wider community life, a greater spiritual effect in the apostolate? One of the most important qualities demanded in superiors and chapters today is the courage to stand with the wise and oppose the foolish. How many of your schools, colleges, and other institutions are very secular? Can you 302 / Review ]or Religious, Volume 33, 1974/2 justifiably allow this to continue and progress? Take anything and every-thing that is good and helpful from psychology and sociology, but never forget that they are no substitute for revelation, morality, or spiritual theol-ogy. How many factual studies were made that proved the later difficulties and defections of religious were found especially in those who entered im-mediately after high school? Honestly face the vocation problem and any of its causes that may exist in the individual and collective lives of your re-ligious. It is possible to emphasize the dignity of the married life without denigrating the religious life. Is the life style of your religious in conformity with the deep totality of the religious consecration? Do all things conduce to greater sanctity, better community life, and a more spiritual apostolate? Are we complaining about the lack of inspiration in the religious life after we buried it in selfishness, materialism, and naturalism? Adopt only what gives at least solid probability of success; otherwise your conduct is at least ordinarily imprudent or even rash. Procedure in lhe Chapter The chapter procedure should be kept as simple and uncomplicated as possible. The need of recourse to parliamentary procedure should be infre-quent, and each institute is now in a position to list the few parliamentary rules that are practical. The secretary of the chapter is to post the agenda for the sessions of a day at least on the preceding evening. It can be the understanding that the proposals or matters are to be taken in the order of the reports distributed to

Issue 20.3 of the Review for Religious, 1961. ; CONGREGATION OF SEMINARIES Ecclesiasti .al Formation Prot. ,N., 2121:60 LETTER TO THE EPISCOPATE IN THE THIRD CENTI~NARY YEAR OF THE'DEATH OF ST. VIN, CENT DE PAUL ON CERTAIN PROBLEMS OF EC-CLESIASTICAL FORMATION. Your 'Excellency, On June 5th of last y.ear, the Sacred Congregation of Studies, prompted by the wonderful example of the priestly life as typified in the holy Curd of Ars, addressed a letter to the episcopate. [For the text of this letter, see REview Fort R~I.~ctous, 18 (1959), 321-27.] The,.purpose of this letter was to recall to mind some fundamental princi-ples 'of ecclesiastical formation, the lack of which might irrevocably affect the sound preparation of the candidate foi" the priesthood and thus his success in the sacred minis-try. The radiant figure of St. Vincent de Paul, whose name in the third centenary 6f his death has resounded in every corner of the world, induces us to continue and complete our thoughts on this matter. The occasion presents to us anew the life of a saint who/it can be said, was a perfect pattern of Jesus Christ, the Eternal Priest. It offers an ex-ample which merits the earnest consideration of all those who are engaged in preparing students for the priesthood, preparing those who have answered the call to fashion themselves according to the model of the Master. Do not think that w~ are presenting an anachronism; if the spir-itual conditions of the clergy and of ecclesiastical training are happily" very different from, those under which the saint carried out his ~igorous reform, nevertheless the guiding principles which were the leaven of his multiple activity ever remain valid. His activity was impir(d by the eternal value of the Gospel message. The heroic charity which permeated his whole life ca~ not be explained or understood in its full significance un-less we realize that it had its origin in his great concept of the priest and the duties of a priest. ÷ ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 I6! ÷ ÷ $ac~ed Congregation o] Seminaries REVIEW FOR RELIGIOUS In a time of dire calamity which he felt deeply in his heart, he knew how to confront miseries with comfort and to help all those in need. Through his w~ork of refor.m he had already enkindled in the clergy that zeal which fosters in the faithful the.well-springs of charity. It car/be safely affirmed that there are few ~who l~ave felt to the same extent as St. Vincent de Paul the shpernatural value of the priesthood and its essential importance the Church as the source of Christian life. He had in com-mon with his great contemporaries of the French school a most tender devotion to the mystery of the Incarnation and to the Priesthood of Christ; nevertheless, inspired by his own pastoral experience, he gradually develgp.ed spirituality of his own which was directed immediately towards the practical pastorate and was sustained by an ever.more earnest zeal for,the salvation of souls. His out-look ~ras determined by concrete cases and showed itself in various ways, but it was always based on this funda-mental principle that the priest is the man whom God has selected and called to participate in the Priesthood of Jesus Christ. His task is to continue the work of redemp-tion and, animated with the spirit of Christ, carry still fur-ther .the work which Christ has done and in the way He has done it. For St. Vincent de Paul, our Divine Lord is above all the Savior of mankind and the priest must be another savior who continues His mission of salvation. Therefore he clearly saw. tha_t, the firs5. qualit~ies a prie~st should possess are an ardent charity and apostolic zeal and that if the love of God be the soul of priestly activity, the object of that love must lie in the salvation o~ rfien. See how the saint emphasizes effective love of God: Let us love God, my brethren, but at the cost of our toil and the sweat of our brow. For it often happens that' the various affective acts of the love of God and the interior motions of tender heart, even if they are good and. desirable, are none the less suspect if ,t.hey do not result in effective love. Our Lord Himself says: 'In this is my Father glo~ifidd: that you bring forth very much fruit" (Jn 15:8). w~ must be on our guard be-cause there are many who think that when their exterior de-portment is correct and they are: filled with great sentiments tqwards God that they have fulfilled their duty; but.when they are confronted with the practical work of the apostolate their inadequacy is made manifest. They flatter tti~mselves with their lively imagination; they'are content to converse sweetly with God in pra~er; they even talk the language Of the~ angels; but outside of this when it is a. case of working for God, when.is a case of suffering, of mortification, of instructing the poor, of going in ~earch of lost sheep, of being content'under l~ri~,tions, of a~cepting illness and bther misfortunes, alasl they are not to be counted on, their codrage~fails. Nol Nol We must not deceive ourselves: our whole jqb consists in working.1 a St. Vincent de Paul, Correspondance, entretiens, documents, 162 edited by P. Cost~ (Paris: 1919--25), 11, 40-1. .We c~n say, then, that St. Vincent de Paul sees the priest in- the light of his ministry for souls, souls who are buried in.ignorance of the truths of the faith, souls who are in a state of sin. Or better still, he sees the priest in the light of his service of Christ Himself~' th~it Christ whom the saint kriew how to perceive clearly in the suffering members of the Mystical Body, .even though immersed in the most ab-ject spiritual and bodily misery.- His intense activity consisted in the continual oblation of himself for love of the.God whom he saw and loved in his brethren. Was this activity separated from prayer and from union with God? Such a thought would be the great-est affront to the saint bf charity, since the fire he en-kindled. in others, he had first drawn from the heart of God Himself. We can not do better than to continue the above quotation where We see how graciously the saint treats of the point in'question: ~ There is nothing more conformable to the Gospel than for us to accumu_lafe light and strength for our own souls in prayer, spiritual reading, and solitude, and then to bestow on men this spiritual food. In doing so, we are following the example of our Lord andHis Apostles; we are uniting the task of Martha to that of Mary; we are imitating the dove which itself takes a part of the food.it has gathered for its own nourishment and gives the.rest to feed its young. This is what we must do. This is how we must prove to Gbd that wd love HirfiNthrough the mh.dium"of~ our good works? The aspect'under which he loved to think of the Savior is that foretold, by the Prophet and used by Christ at the beginning of His public lifein reference to Himself: "The spirit~of the Lord is upon me. Wherefore he hath anointed me to preach the gospel to the poor, he hath sent me to heal the contrite of heart, to preach deliverance to the cap-tives, and sight to the blind, to set at liberty them that are bruised, to preach the acceptable year of the Lord and the day of reward" (Lk 4:18-19). The poor, those in tribula-tion and distress, were indeed the special care of Vincent de Paul even if he did not exclude any social class from his apostolic work, seeing it to be his duty as a priest to work for the salvation of all. But to the poor and humble he cer-tainly showed his preference. For them his love was bound-less; it was a love which has given us the most glorious pages, in the annals of Christian charity. They were his principal concern in his reform of the priesthood. "Make good priests" a favorite expression of his meaning "Make holy priests"--signified for him a bringing back of the clergy particularly to their mission of preaching by which th, ey would rescue the people from their ignorance of the truths of the faith and lead them away from sin. By means of this he established an indissoluble link between the See the preceding note. ÷ ÷ ÷ Ecclcslasticai Formatio~ VOLUME 2~ 1961 163 ÷ Sacred Congregation ot Seminaries REVIEW FOR RELIGIOUS 164 priesthood' and the laity: good priests mean a good laity; ignorant or sinful priests are their ruin. From this unify: ing principle, "As the priest, so the people," were derived all St. Vincent's projects for the formation and sanctifica-tion of the clergy: the Congregation of the Mission, for ordinands, the Tuesday conferences, clergy re-treats, and especially the establishment of seminaries. his innovations bore the stamp of God's approval, for hav-ing first given himself up to humble and unceasing prayer he then went forward with his plans slowly and carefully so as not to jeopardize, as he used often say, the work of God. That was in fact characteristic of the man: to ensure that in every undertaking, big or small, he followed will of God, avoiding all forms of impatience which is detrimental but especially so in the carrying out the designs of God. This accounts for the qualities of en-durance which characterized his work. He sought God's will in all things, straining with the single-mindedness a saint towards the perfection which was his ideal for priests. Selection and Evaluation of Candidat.es The reply of St. Vincent to those who were proposing one of his own nephews for sacred orders out of motives not altogether praiseworthy is well known. He s~tid: "F~my part had I known at the time when I haft the rashness to enter the ecclesiastical state what I subsequently learned, I would have preferred to work in the fields than to go forward to such an awe-inspiring state." If we can see here evidence of the saint's constant and profound hu-mility, we can also see an indication of his very great reverence for the priestly vocation. In those unfortunate days when men entered the priest-' hood for motives, other than the wish to serve God and save souls,. St. Vincent's only preoccupation was to prevent from such an unworthy course those "who make the just weep tears of blood." Clearly the reason for his care was that "God gives the graces needful for this hgly state only to those whom, in His goodness, He calls,''3 "Those who enter there without His call would seem to be lost.''4 In these and similar quotations there is obviously evidence of Jansenistic pessimism; we know well St, Vin'-' cent's undying hatred for the harm caused by this teaching and the part he played in its condemnation. Of course, th~ fact is that he saw the priestly vocation through the eyes a saint--in other words, in its true supernatural light. Each priest is individually chosen by God who gives St. Vincent de Paul, op. cir., 6, 155-56. St. Vincent de Paul, op. cit., 5, 569. qualities necessary for his state and the graces to live up to its obligations. It was, therefore, with the express inten-tion of testing the genuineness of vocations and making them effective for leading souls in the path of justice and salvation, that the saint applied 'himself with:unflagging zeal to the establishment of seminaries formed on the Zri-dentine decrees. His first difficulties and reverses in no way daunted him. ., The seminary is of necessity a place of selection and for-mation where~the Church lays on superiors the onus of picking out those really chosen by God in, order that these may be'brought to the height of perfection demanded of them fbr the profitable exercise of their ministry in the world. Selection and formation, therefore, are two essen-tial factors of a seminary which can not be changed. The Church d~mands that this be recognized at all times and under all circumstances. She is guided by Divine Wisdom in the adoption of new methods and their adaptation, de-ciding with loving care how to meet changing conditions. She can never afford to compromise, her fundamental at-titude when dealing with seminaries; according to their state, she flourishes or declines. 'The priesthood is such a high calling, it demands so fine a character, it confers such great powers that it must be the result of a special choice, a special vocation from God. This special vocation is essential to those who are to receive the dignity and exercise the prerogatives of the priesthood. It follows that both the student and the Church should make it their business to find out what the will of God is in each individual case: the student that he may not lightly intrude himself into a state of life so exalted and to which he can lay no claim, the Church that she may not take the risk Of conferring orders on one who has not the necessary requirements. The Church has the strict obligation to seek the signs of a true vocation in all who feel themselves called to the sanctuary. She must make sure, at the same time, that they have the quali-ties which will enable them worthily and efficiently to ful-fill their office. We know that whenever God lays on men such exalted duties and responsibilities, He gives to those so chosen sufficient graces to enable them to carry them out worthily. The candidate puts himself, forward for the judgment of. superiors. It is for the superiors to judge and act accordingly. This scrutiny begins from the time a student first enters the seminary. It ends either with his ordination or with his dismissal as soon as it becomes apparent that he is un-suitable. Each superior in a seminary has his own particu, lar sphere but each, by reason of his sacred trust, has a twofold office. He is to be an educator in the daily task of making a new man out of each of those entrusted to his ÷ + + Ecclesiastical Formation VOLUME 20~ 1961 165 + 4. 4. Sacred Congrega6on oy Seminaries REVIEW FOR RELIGIOUS charge; and he is to be a judge as to whether they are corresponding to the graces they have received, as to their progress or otherwise, as to the evidence of further physi-cal and spiritual develolSment, and. as to their resistance to or inability to profit by the work of formation, it task which can not be shirked. The superiors, in their ac-tions, must be guided by the light of God to whom hearts are open and whom all hearts obey. To evaluate a vocation properly, it is indispensable know the student's whole personality. Taking qualities and abilities singly, considering weak points and defects in isolation, it is possible to be seriously mistaken. These elements must be considered under the aspect of a per-son's whole character-only thus can~ they be viewed their proper light. If we are to reach a-correct judgment on the vocation of candidates for the priesthood, we must not base that jtidgment on first impressions of a particular facet of their character. Rather, we must strive to see the whole person and thus we can reach a balanced estimate of the particular elements which form the,total character. There is a fundamental element in every person from which all the facets of his character spring.It follows, therefore, that the. superior's energy must be directed a profound study of each individual student, maximum importance to,the resourceful energy of the mind which is called will power. For example, some brilliant personalities at first make ¯ very favorable but often they are inconsistent characters who lack the necessary stability and will be unable to face tomorrow's temptations and the great trials of life ahead. They will fall victims to fatal weaknesses altogether much for their defective will power. At other times a. close scrutiny can reveal as' unjustified'the esteem held up then for .the piety or at least the devotional piety of youth who~ otherwise showed no great strength of:'charac-ter. We speak of that apparent piety which is the uncon: scious refuge of the intellectual and spiritual pauper who, once his environment is changed, will stand revealed in his weaknegs, We would insist that superiors watch closely over un-stable natures to see whether this weakness springs only from the youth of the students concerned. This will especially apparent in adolescents. On the other hand, may be a permanent defect of character, as in a youth who will apply himself to a hundred tasks without seeing through to its completion. He may be a pefson of nervous temperament, always vacillating and undecided, who puts one in mind of the: basic neurosis underlying these symptoms. Such characters as ~these, the products of, a world in ferment almost to the point of frenzy, can be blamed for their condition, but they are certainly the most suitable candidates for the ranks of the priest-hood. This requires a strong and even temperament, one ready to endure any sufferings and to take any risks for the advancement of God's kingdom. Therefore, both the who!e.personality and the. many individual traits must be thoroughly.examined, with par-ticular attention being paid to psychological and emo-tional stability. The superior is dealing with the realms of the spirit where the meeting.~of God with man is the inti-mate personal; responsibility of each individual; he must tread warily, making constant use of humble prayer, ap-proaching God with reverence, waiting and listening and sensitive to the-manifestations of His will. Supernatural means must always take the first place, but the aid which the sciences of the educationalist and the psychologist af-ford should not be forgotten. When one's own experience does not suffice, a specialist should be called in. This, of course, must involve no compromise of the faith and nothing which is contrary to Catholic morality must be countenanced. We can never be too careful in such deli-cate matters; this is especially~true because, as competent psychologists tell us, the mental maturity of modern youth frequently lags behind his physical growth---a trap for the unwary who would content themselves by judging from appearances. . In this matter, the Code of Canon Law, c. 973, §3, clearly lays down that there must be "a moral certainty based on positive arguments" . of the candidate's suitability. That is the judgment to be formed before a superior can with a safe conscience advance his candidates to holy orders. If it is impossible :to arrive at this moral certainty, the other rule must be applied, the r_ule stated by Pope Plus XI with equal clarity in his encycIical,letter .4d Catholici sacer-dotii of December 90, 1935: ", . in this [the Pope is speak-ing of dismissal from seminaries] they should keep to the most secure opinion, which in this case is the one most in favor of the penitent, for it saves him from a step which could be for him eternally fatal.''~ The. reason for this clefir~and uncompromising attitude must be evident to all who have at heart the good of the Church whose well-being depends on the qualities of her ministers. In her age-long wisdom, the Church has satis-fied herseIf of the real worth of these qualities, all the more so in view of the heavy burdens she places upon her ministers. Daily, every priest has an enormous weight of pastoral responsibility to bear. The various urgent prob-lems which clamor for his attention create tension and fatigue. He is beset with dangers at every step he takes in a world which is losing its Christian values and submitting ~Acta Apostolicae Sedis, 28 (1936). 41. ÷ + ÷ Ecclesiastical Formation VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation ~o! Seminaries REVIEW FOR RELIGIOUS 168 to a paganizing influence. In view of this, it is no wonder that the Church exercises the greatest caution in the choice of those who are to be her priests. For the sake of her good name in the world and for the common good of the faith-ful, she can not afford to advance to orders even a single one whom she deems less suitable, such is the damage she might suffer at his hands. The unsuitable student of today is the unworthy priest of tomorrow. The Church must train up young men of sound moral fiber, ready to re-spond to the highest ideals, men of deep-root.ed convic-tions, prepared for sacrifice arid self-oblation. Only then does she feel confident in presenting them to her divine Spouse for the seal of ordination. Canon law carries a warning for those who have not a true understanding of the "tutiorism" clearly set forth in both general and par-ticular terms in many papal documents. They can not escape the penalty for defaulters with regard to the canon mentioned above. In fact, they are running a grave risk of "sharing in the sins of others:" All laxism must avoided and no other method or moral system may be countenanced which departs.from the line laid down, es~ pecially when it is a matter of making a final decision on student's ability to observe clerical celibacy. Undoubtedly, some otherwise sound moralists hold opinions which can hardly be reconciled with the "tutiorism" of papal pro-nouncements and repeated above. Unfortunately, there is no escaping the fact that 'in spite of the strict instructions of the Sacred Congregation of the Sacraments (Quara ingens of December 27, 19~0, and Magna equidem of December 27, 1955) not a few candi-dates without a true vocation have been admitted to holy orders. It is not a question of mistakes due to human falli-bility, since on examination of the hist6ry of many ship-wrecks, one becomes perfectly aware that clear indications of a lack of vocation to the priesthood could have easily been noticed during the period of training in the semi-nary. Besides, the Sacred Congregation itself has been able, through periodic apostolic visitations ordered in the vari-ous countries under its jurisdiction, to verify the.fact that not infrequently the fault lies in an inadequate sifting of candidates and the retaining in seminaries of students of little promise either from the human or from the supernatural point of view. It would seem that the policy of many superiors is guided by ~the sad state of dioceses which are hampered by a serious lack of priests. How can one act differently, one hears it asked, when we have not the necessary organization for pastoral work---even for the bare. administration of the sacraments? Is it'not per-haps better to have priests, even if they are not the best type of priests, as long as they provide ior the basic spiritual needs of the faithful? Such a utilitarian concept of the priesthood constitutes a denial of the very essence of the priestly vocation and the priestly ministry. Even if it is true that the efficacyof the sacraments does not de-rive from the goodness of the~minister, yet it is no less a fact that the building up of Christian life is closely bound up with the holiness of God's priests. Their mission, as seen from the Gospels, consists precisely in enlightening their flock and protecting them from corruption, not only iby means of grace, but also by the personal example of 'their lives (see Mt 5:13-14). We must not reduce the priest to the level of a mere bureaucrat of the things of God by ignoring his personal qualities and depriving him of the glory of his intimate union with Christ, a union which consists not only in sharing in His powers but also in copy-ing His virtues. This would be to deny in practice the in-escapable demands of the Catholic priesthood and its transcendent dignity. Preoccupation with numbers regardless of quality is clearly seen to be a mistaken policy. The admission to the sacred ministry of men who are only mediocre is a corrupting influence not only on the zeal of their fellow priests whose apostolic effort is thereby lessened but above all on thd intensity of the religious life of the laity. This last, of course, is a necessary condition for the birth of good and numerous vocations. It is' well to remember that in the ordinary course of events the appearance and develop-ment of priestly vocations d~rive from the personal action and example of the priest as from their instrumental cause. It is an undeniable fact that vocations flourish where there are real men of God~' SuCh men who believe in and love the sublime things they handle show forth in all its pure beauty the ideal which they preach. Acting as poles of attraction, they enkindle the spark of the divine call in generous souls who respond to living example rather than to mere words. Let it therefore be quite clear that preoccupation with numbers, whenever it tends to compromise quality, is self-destructive, slowly but surely drying up the sources of vo-cations and paralyzing the work of divine grace. It shows a weak faith, as we see from the vigorous words of Pope Plus XI, quoting St. Thomas Aquinas: Bishops and religious superiors should not be deterred from this needful severity by fear of diminishing the number of priests for the diocese or institute. The Angelic Doctor, St. Thomas, long.ago proposed this difficulty and answered it with his usual lucidity and wisdom: "God never abandons His Church; and so the number of priests will be always sufficient for the needs of the faithful, provided the worthy are advanced and the un-worthy sent away." . We reaffirm that one well-trained priest is worth more than many trained badly or scarcely at all. For ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 169 4, 4, Sacred Congregation o~ Seminaries REVIEW FOR RELIGIOUS 170 such would not be merely unreliable but a likely souxce of sor-row to the Church,° This Sacred Congregation, therefore, demands with all the force that accrues from its high mandate of watchful-ness, that the most exact and scrupulous care be taken in the choice of candidates. We exhort all those responsible for the task of selection not to minimize in the slightest degree, the wise rules laid down in this matter by Holy Church. Are we to allow ourselves to be overtaken in this respect also by'the children of darkness? We are well aware of the great care these latter exercise in the selection and training of those of their disciples who show the greatest natural gifts and display an ability to influence others; their intention is to use such men to permeate the masses and gain them for their own ends. It is a principle both human and divine that the fate of institutions depends on quality and not on numbers. "Gidedn, with an im-mense host at his command, a host seemingly ready to face any danger or difficulty, hears it said to him by the Lord that in great enterprises, one must count on few, not on many. Selection is the rule of existence, of progress, and of perfection.''7 Let us, therefore, rest our hopes on those alone who are chosen by the Lord. Filled with the spirit of Christ, these men will be the vigorous band who by the integrity of their lives and their burning zeal for souls, will,lead the people of God back to the pure.sources of Christian life, thus ensuring the growth of a vigorous generation of priests. The Training of .Seminarians "To devote oneself to making good priests and~ to co-operate to this end as the secondary, efficient, and instru-mental cause, is to fulfill the very task of Jesus Christ. Our Divine Lord during His life on earth seems to have taken it as His very special work to train twelve good priests, His Apostles; with this end in view, He deigned to stay with them some years to instruct and train them for this sacred ministry." Teachers in seminaries must, then, be intimately united to Christ and must give themselves com-pletely to Him, for their work is the priestly work par excellence, "the most difficult, the most sublime, the most important for the salvation of souls and the progress of Christianity.''s "To make'more perfect priestsl Who can understand' the sublimity of this work?"9 "To make good priests is the greatest achievement in the world; it is ira-e Ad Catholici sacerdotii, Acta Apostolicae Sedis, 28 (1936), 44. ~ John XXIII, "Discourse ~to the Students of the Roman Colleges," January 28, 1960, in Acta Apostolicae Sedis, 52 (1960),272. sSt. Vincent de Paul, op. cir., 11, 7-8. * St. Vincent de Paul, op. cir., 11, 9. possible to conceive anything greater or more impor-tant." 10 For St. Vincent de Paul, therefore, those who have the task of educating candidates for the sanctuary can only be described as the perpetuation of Christ in th.eo~ighest realms of the priesthood. Such m~n carry on the teaching work of our Savior, instilling into the youths called to fol-low Him, those principles which He Himself taught to His Apostles before He sent them out tO procla.,im the message of salvation before men. It follows from this that in the mind of the saint, the seminary must be nothing other than a school in which the students, by means of a fitting preparation, learn those things both human and divine which they will need later if they are to bring forth the fruits of salvation. But they must learn these lessons from their superiors who, for them, stand in the place of Christ and who must be capable of instilling in them the spirit of Christ. The saint's spirituality is vigorous, Some have even con-sidered it hard, but such people have stopped at the mere letter of his vehement teaching without considering the thought behind it. It is true that he never tires of preach-ing reunciation, sacrifice, and detachment from family and from worldly goods; he demands the unconditional surrender of the will; he condemns in no uncertain terms indolence and laziness; he. brands pride as the chief ob-stacle to the triumph of grace in the soul of the priest. He insists on penance as the undoubted means of bearing fruit in the sacred ministry; he exalts the value of suffer-ing, renunciation, sacrifice, and detachment fromrfamily, the complete submission of one's own spirit in order to possess the spirit of Christ. Here we have the pure teach-ing of the Gospel, untainted by compromise or human considerations. It is from the Gospel that the Vincentian method of seminary training gains its strength and vigor. If the saint demands renunciation and sacrifice, he shows them in the light of the love of Christ and of souls. He preaches death too but only as the gateway to a richer life; he too takes the shears to the vine to prune it, to cut away all that is disordered and superfluous, but it is in order that the plant may have a more vigorous growth; he too preaches immolation in union with Christ, but it is as a way of coming to the triumph of the Resurrection at Easter and to the fullness of the Holy Spirit at Pentecost. Because he was intolerant of any form of self-love, including that kind which is more subtle and capable of cloaking itself ambiguously under the most plausible pretexts, he had a heart as vast as the ocean, a heart which was most t~nder, always ready to sympathize with every form of misery, ~°St. Vincent de Paul, up. cir., 12, 14. + + + Ecclesiastical Formation Sacred Congregation of Seminaries REVIEW FOR RELIGIOUS 172 and to beat with a zeal which in him was a devouring flame. Worthy friend of St. 'Francis de Sales, he possessed the delicate virtues of meekness and forbearance; he could rise on the wings of the supernatural over the limitations of human nature and yet stoop with understanding to its weaknesses. He was the Good Samaritan who saw in hu-man nature the humanity of Christ. For this reason he looked upon it with serenity and kindness, seeing it as the necessary foundation on which the dignity of redeemed mankind had to be built. But being conscious of its weak-nesses, he would allow it no more than the role of a means, never that of an end: "For he that will save his life, shall lose it; and he that shall lose his life for my sake, shall find it" (Mt 16:24-25). It is often repeated, and not without truth, that prior to making priests, the teachers in our seminaries should make it their first care to train upright men. The purpose of this assertion is to emphasize the importance of human qualities in the full priestly personality. This is the sincere mind of the Church. She demands precisely the presence of notable natural gifts in formulating a positive judg-ment on the worthiness of candidates, and these are the foundation, the starting point, of the ecclesiastical forma-tion. A vocation does not involve the rejection of the hu-man qualities of man. On the contrary, it places the high-est value on what he is by nature and by grace. The God who gives the divine call is the same God who has be-stowed the gifts and who waits for the day when these talents show their increase (see Lk 19:22 ft.). Grace does not destroy nature; but, according to a Thomistic princi-ple so very fertile in the field of theology, it restores, puri-fies, elevates, and transforms nature. Moreover, it can even be said that, in the ordinary course of events, nature con-ditions grace inasmuch as the action of grace is facilitated where human qualities abound, whereas it is stultified where human qualities are lacking. Consequently, any-thing which is contrary to nature has no part in Christian and priestly virtues; and any educational system which dis-dains natural virtues, even though it be presented under worthy pretexts, would be unreasonable and confusing and fraught with dire consequences. It could become the rock on which the frail barks of many vocations, guided by inexpert helmsmen, would founder. Much more en-couraging is the exhortation of the Apostle: "For the rest, brethren, whatsoever things are true, whatsoever modest, whatsoever just, whatsoever holy, whatsoever lovely, what-soever of good fame, if there be any virtue, if any praise of discipline: think on these things" (Ph 4:8). A wise teacher, then~ conscious of his responsibilities with regard to his students and in the eyes of the Church, will consider with religious care the individuality of each one and will know how to accept, stimulate, and develop the precious per-sonal gifts of each character. However; there has arisen today even in ecclesiastical circles an excessive tendency to ghrink from these duties as educators and to submit ~' ~l~e iiadividualism df oi]r mod-ern youth who seem intolerant of all discipline. There is much talk of how the child must be prepared for future responsibility by reducing restrictions in the field of edu-cation. In the community as a whole, self-government, the vital spirit of democracy, and group decisions are widely praised. This involves an ever decreasing guidance or so-called "interference" from superiors. They accept, that is, if not in theory, at least in practice, the conclusions of certain authorities whose theories, though much in vogue, are nonetheless reprehensible: We may rightly include under this category, those modern theories which, though presented under different names, agree in regarding it as fundamental in all forms of education that children should be allowed to mold their characters entirely at their own will and discretion, Advice from teachers, or elders is rejected and no account is taken of any law of assistance, human or divine. '. Unhappy illusionl Claiming.to emancipate the Child, they enslave'him; they make him a slave to arrogant pride and irregular desire, to a pride and passion which, if their system is true, are to be approved as the needs of an autonomous human nature?a Such theories owe their origin to an over-optimistic con-cept of human nature. They do not appreciate the frailty and inadequacy of man, nor, in his fallen state, his need to be ruled if he is to achieve self-control. This is above all the case with adolescents and young people who are natu-rally immature and often lured by merely transient en-thusiasms and torn by conflicting emotions. "The same thing is not possible for one who has a virtue and for one who does not have it; so too the same thing is not possible for a boy and for a perfect man".''~s If they lack singleness of purpose and perseverance, our students will never be able to control their impulses. In all kindness they must be made to accept subjection to rule and to realize the force of law. In this way, they will acquire deep-rooted habits which will neither stifle thei~ conscience nor restrict their liberty, but which are, on the contrary, the source of freedom and a guarantee of its ex-ercise. There is no doubt that the authority of the su-perior should control the liberty of the student but always in an atmosphere of mutual confidence, active collabora-tion, and charitable understanding. Thus[ the student's development will not stop short at mere p~assive submis-sion, bu.___~t will go to the very roots of his personality. n Pius XI, Divini illius Magistri in Acta Apos,tolicae Sedis, 22 (1950), 69-70. = St. Thomas Aquinas, Summa Theologiae, 1-2, 9.6, 2. + + + Ecclesiastical Formation VOLUME 20, 1961 173 Sacred Congregation of Seminaries REVIEW FOR RELIGIOUS Therefore, we can not approve of the attitude adopted in some institutions where there is not the necessary in-sistence on the fundamental value of the rule in the for-mation of young men for the Church: Discipline is the rule .of life and the way of virtue. If a rule life is necessary for men in general, how much more necessary is it for those called to the priesthood. Therefore, the discipline of the seminary and the observance of rule, even on minor points, should be close to the heart of every student. Superiors are necessary just as Supervision is necessary, but clerics should behave and fulfill their duties without the need of a superior to watch over them.= ~'o ask young students still in the process of formation to carry out their many duties without the help of a full and'detailed rule, to refuse them the benefits of a well ordered discipline, is to leave them a prey to uncertainty and to deprive them 6f an atmosphere which would be most helpful to their own personal efforts. The daily "bearing and forebearing" of a rule observed in detail will bring much fruit. It will develop reserves of will power; will prepare characters of strength and perseverance; and it will foster balanced and methodical minds, minds which will be able to remain master of themselves and control the situations which inevitably arise from the clash with the difficulties of life. We repeat therefore: It is one thing take care that our students, while being obliged to carry out their duty even to the smallest detail, are imbued with right principles both human and divine such as will en-able them to assume responsibili'ty in the future; it is an-other to exclude or compromise the actual value of the obligation. If discipline is to be fully effective, individual teachers must not operate in isolation. On the contrary, one must work together with his colleagues, taking c~re, however, not to intrude unduly in the province of any other. With this collaboration and guided by like con-victions, all can work for the progress of the seminary as a whole. We do not intend to evolve these ideas fully here. But, unfortunately, we must take notice of the fact that natu-ralism seems to have penetrated even into some institu-tions for ecclesiastical training. This has been partly due to those who universally condemn the past as unsuited to the task of forming new generations of young priests and who eagerly search for "up-to-date" methods. Yet an-other cause is the rather fatalistic passivity of those who indeed regret in their heart of hearts this dangerous in-novation in the field of education but still accept it as the inevitable consequence of living in our times. In these instances, there is evidence of a gradual decline which ~ St. Plus X, "Discourse to the Seminaries of Milan," October 14, 174 1908, in Enchiridion Clericorum, n. 827. seems to be affecting every aspect of ecclesiastical educa-tion. The common factor in the whole process seems to be an apprecxable lessemng of the supernatural element. The true foundauons of genmne oecclestast.lca! education prayer, intimate union with Gbd, a spirit of mbrtifica-tion, humility, obedience, withdrawal, and. s.eparauon from the world are retreating ever more into the background to be.replaced by externahsm under the g~ ~se of chanty. The intention is to '~'understand" our' era and the new generation. In reality, it only means givi~ng way to its Shortcomings. One has the impressi6n that teachers, far from exercising restraint, have encouraged and even be-come. obsessed with what is novel and untried. They are concerned rather to grant what would most ~tplease the stu-dent than to insist.on what wouldbe most beneficial, and they have not the courage xo ask.for self-dehial and sacri-rice. ! ¯ But Christ asks for both ~self-~en~al and s crifice. "Deny yourself'.' (Mr 16:24) is at the root of all Hislteaching, and ~t contains the,key to the secret of Christiari vocation and above, all the priestly, calling. The priest is the man of sacrifice, chosen to fill up by his own suffering, sacrifices, and his daily self-immolation that which ~s wanting m the sufferings of Christ (see Col 1:1 2 ) . H . eI ~Socalled to,bear fruits of grace; but without the Cross therelcan be no re-demption (see Heb 9:22). He is called to be alshining'light, but this can only be if he is aflame,with the spirit of self-sacrifice. We need hardly say that this liker~ess to C~hrist, Priest and Victim, must begin in the semirlary.We well realize how long the road is and how strong the resistance of human nature, for many "follow Jesus to the breaking of bread, but few to the drinking of the chalice~of His Passion.TM It is essential, therefore, that ou} students be-gin their self-denial and sacrifices from the loutset. Thus they may come to understand the truth and joy contained in these, words: I But blessed is that man who fir thee, O Lord; abandons all things created; who offers violenc~ to nature and through fervor of spirit crucifies the concupiscence of. the flesl~, so that with serene conscience he.may offer to thee pure prayer and become worthy to be admitted among the choir of angels, having ex-cluded himself both exteriorly and interiorly[ from all the things of earth.~ ., Above all, we must insist on the conflict which Christ Himself emphasized, between His ~spirit andI the'spirit of the world, the world for which Christ did[not wish to pray since it was already permeated wit[i the[spirit of evil and hardened against grace. Therefore His o~n must not :: ~.hKOemma~S,~.'~e:sP.i~, Zmitation o, Christ, ~, 1,, 1. " " P'o , o ¯ I 4. + Ecclesiastical Formation . VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation oy Seminaries REVIEW FOR RELIGIOUS be of this world, just as He Himself was not of it (see Jn 17:9 and 14-16; 1 Jn 5:19). They must appreciate that they are consecrated ~o the things of heaven and that al-though taken from the world, they are no longer of it. Only as they detach themselves from the attractions of the world, from its principles, from its methods and from its facile compromises, will they become the salt of the earth and the light of the world. They must be made to realize that a priest does not cut himself off from his own times simply because he refuses to accept their fallacies. In a word, "the man dedicated to the Church, walks indeed this earth, but his mind and heart must look to heaven.''le Likewise in the delicate question of the students' as-cetical training, it is necessary to move slowly and with discretion and to maintaina gentle but firm hand: "ford-ter in re, suaviter in modo" or, to quote our saint, "firm-ness and constancy regarding the end, sweetness and hu-mility regarding the meansY This simply means that we must go back to the' life and teaching of our Savior which, if well presented, exert an irresistible attraction on the minds of the young. Nothing can equal these pure founts. Our students must be led to a spirit of intimacy with Christ, they must live according to that spirit which brings truth and freedom. They must believe in Christ with that strong faith urged by St. John (14:1), that faith which im-plies an unquestioning acceptance of His word, complete. confidence in His help, and a loyalty and correspondence with grace, even to forgetfulness of self. Through 'their daily contact with their Divine Master, they will be im-pelled to be more like Him (see 2 Cor $: 18), to assume His spirit, and thus gradually to achieve "unto a perfect man, unto the measure of the age of the fulness of Christ" (Eph 4:13). This seems to us to be'the royal way, in fact, the only way, in which our students can be made into the apostles of the future, "perfect men, furnished to every good work" (2 Tim 3:17), who will contribute successfully towards "the edifying of the body of Christ" (Eph 4:12). In fact, zeal for souls has always been nourished by a deep spiritual life and by a mortification which is wholly directed to- Wards personal holiness. But there is always a danger of destroying in a short space of time what has taken much labor to prepare. We are referring especially to the impatience, so common these d~ys, whereby our young students are submitted too easily and without the necessary precautions to trials which are beyond their strength. The aim of this, it is said, is that they may become aware of the surroundings 1e John XXlII, "Discourse to. Roman Colleges," in ,4cta Apos- 176 tolicae Sedis, 52 (1960), 262-70. advocate this method deceive themselves inl thinking that I in this way they are securing students against the dangers they are bound to meet with and that at ~he same time they are arousing in them at an early stage, [ m action and by action," the spirit that must animate their future apostolate. Yet they flatter themseh, es th~,t the diocese will thus be supplied with better priests; priests who from the beglnmng of their pastoral work will b'~e able to pro-duce more results and better results; priests who are .in the public eye, leaders of men, who are inla position to bear faithful witness to the Gospel. This policy of haste is not only based on a!mistaken ner-spectlve, ~n so far as it gxves first place to what must neces- I sarily take second place both in importance and in se-quence; but m addmon ~t presupposes somethang whxch does not exist at all, namely, a sp~rxtual, ~nt~ellectual, and moral maturity that is essential if this exper~.ence of which we speak is to be of profit. What is more, it distorts the nature and aim of the seminary as conceived by the Church's legislation. The seminary is not a~ad never can be a place for testing theories and still le~ss a training ground for dangerous and compromising actxwues. It can be nothing other than a home for deep ~piritual and intellectual formation. O1: course, the futureI apostolate is and, must be a source of inspiration, but anyI practical ex-perience must come by degrees and only when the student has reached the requisite standard. Such is th~ mind of the Popes. They are so concerned with keeping the true aim of the seminary intact that they visualize a particular in-stitution with the specific task of initiating the young priests into the various fields of the apostolat6. In this way the transition from the quiet of the seminary is brought about naturally and, with a more adequateI preparation in theory and practice, the danger of eventual spiritual unbalance is precluded,x7 | TO destroy the whole balance of the life~of our semi-naries and their proved worth on the plea of a~n imaginary "apostolate of action" must of necessity do ~mmense harm~' Indeed, it is to be feared that, if priests of t~e future are trained by such a method based on activity, they will not be able to perform really fruitful apostolic ~lwork. They will not be able to surmount difficulties andl discourage-ment and will fall an easy prey to the moral ihstability of ttle restless and treacherous world in which ~ve live. Ex-perience teaches that the bridling of the passions is an interior achievement that must be accomplished in the secret depths of the soul. It takes place slowly ~nd only by a~ See Menti Nostrae (Acta Apostolicae Sedis, 42 [1950] 691-92) and the motu proprio Quandoquidem (Acta Apostolicae S~,dis, 41 [1949], 1.65-67). 4. Ecclesiastical Formation VOLUME 20, 1961 ÷ ÷ ÷ Sacred Congregation oJ Seminaries REVIEW FOR RELIGIOUS means of reflection and recollection. If we allow our stu-dents to throw themselves into external activity, if we leave them free to indulge in that kind of enthusiasm which could easily lead them away from their strict but necessary life of piety and study--even if it is to gain experience of the apostolate---does it not mean, perhaps, that we are drawing them away from their day to day formation which is nourished on prayer, study, and sacri-fice? And at length when their training in the seminary is at an end and they have to face the serious reality of life without sufficient preparation, is it not to be feared that passions suppressed but'not truly subjugated will return? The results of such an education can be observed while still in the seminary. A weakening of piety, a lack of in-clination for all forms of study and especially for specu-lative thought, a discipline that is undermined at its very foundations, and, above all, the appalling superficiality that is found in various branches of education--surely these things are incapable of producing true apostles for the Church. Here we can appropriately quote a saying of St. Vincent de Paul. It can serve as a general rule of- be-havior but it has a special value :when applied to educa~ tion. "Good works fail because people act in too great haste, because they act on their own impulses. This haste has the effect of obscuring the mind and reason and pre-sents the object as possible and opportune. It is not so, and subsequent failure makes it evident.''is Accordingly, rather than use doubtful methods to train a priest just for the present, we must make every effort to form one who will be a priest forever. Conclusion I Your Excellency, before concluding this present letter' in which we have sought to express our concern on cer-, tain matters, we can not but address a last word to the teachers in our seminaries. Whatever position they hold, they are well aware of the seriousness of their duties and of the great responsibility "they bear before God for their students, whom they are seeking to train for the high office that awaits them. In this .unremitting yet hidden toil, which often brings little human satisfaction though it earns much merit, they must never forget their great aim. We are all fully convinced of the importance of en-vironment. Therefore the good will of the students must be encouraged and they must be helped at every stage, of their path towards priestly perfection with all the a.ssist: ance they require. Above all, we would wish that the golden words of Pope Leo XIII be engraved in the hearts of all: 178 nSt. Vincent de Paul, op. cit., 4, 122. n their own field, a personal example of a full, priestly life. l'he example of those in authority, especially for the young, is he most eloquent and persuasive way of convificing them of heir own duties and of fostering a love of wrtue. It is good then that teachers in our semin~aries should se outstanding for their natural gifts, w.hich can win for hem the esteem and trust of their pUpils.°But~ at the same ime, they must realize that natural qualities hnd achieve-nents are of httle use ff they are not ammated by a deep plr~tual hfe. Only th~s can ensure that their work will be ,f real value and bear fruit. The Dlwne Maste.r who dwells n our hearts and speaks to us there "Christ is our ! eacher and He is within us"=0--will be ev, er ready to ,less, increase, .and perfect their work which, by the "rovidence of God, is destined to spread thd mystery of ~Iis Love. We are certain that Your Excellency will ~.ee that this etter be brought to the attention of the superiors of your emmary for their careful cons~deranon. At the same ume, -¢e gladly take this opportunity of express~,ng tO Your ;xcellency our feelings of highest esteem. Rome, Sep-ember 27, 1960.] Yours devotedly in our Lord, JOSEPH Cardinal PIZZARDO, Suburbican Bishop of Albano, Prefect. DINO STAFFA, Titular Archbishop of Caesarea in Palestine, Secretary. Leo XIII, Fin dal principio in Acta Leonis XIII, 22, 254-55. St. Augustine, In lo, 5, 19 (PL 35, 1557). ÷ ÷ ÷ Ecclesiastical Formation VOLUME 20, 1961 179, JAMES I. O'CONNOR, S.J. Some Aspects Religious Authori9 ÷ ÷ ÷ James I. O'Connor, S.J. is professor of canon law at West Baden College, West Baden Springs, Indiana. REVIEW FOR'RELIGIOUS In the Church there are different kinds of authority, One form of authority is called jurisdiction and is the pub lic power of ruling or governing others. It is called publit because it is a power belonging to a perfect society for tht direction of its subjects to the end for which the saic society was constituted. Thus defined, it is a power which belongs both to the State and to the Church. If we narro~ our consideration to jurisdiction in the Church, we can de fine it more fully as the public power of a legitimate su perior, granted by Christ or by His Church through ~ canonical mission, of governing baptized persons to tht achievement of their eternal salvation. This power, native to the Church by reason of its con stitution as set up by Christ, can be and is shared by tht immediate or constitutive parts of the Church by reasor of a canonical mission for the attainment of the purpose o~ the Church. Immediate parts of the Church are diocese: and the clerical exempt religious institutes, As a result! local ordinaries and superiors in clerical exempt religiou: institutes possess true jurisdiction, although the bases art different in each case: in the first case, it is territorial; ir the second, personal. Other moral persons in the Church do not possess juris diction because they are not immediate divisions of tht Church; that is, they are subject to the authority of ar immediate section; "examples of such are parishes, none exempt religious institutes, and so forth. Consequently~ such divisions are sometimes called mediate sections of tht Church. If such a division has jurisdiction, it is by specia~ grant, not by reason of its nature. Within the perfect society which is the Church, w~ find also other societies which are imperfect in the sens, that they are not self-sufficient and are not independen'li although they have a purpose of their own which, how. ever, is a means to obtain the purposes of the Church. Ex amples of such societies are religious institutes. Therefore, ander different aspects, clerical exempt re'ligious insti-tutes are both immediate and mediate sections of the Church whereas all other religious institutes, are mediate ~ections only. Just as the Church in itself and in its cons,ututive divi- ,ions has authority to govern its subjects (and such power I s called jurisdiction), so also the mediate secuons must have and do possess authority for their proper govern-ment. Since this latter authority ~s not jur~s~hct~on, It ~s :alled dominative power. Both types of powerlor authority are set down in canon 501, §1 of the Code of Canon La¯ w: 'The superiors and chapters, conformably to the consu-tutions and to the umversal law, have dominative or .z°vernin~'o~-r~°wer over their sublects,o and .in eve~ ~ exem p t :lerical institute, they have ecclesiastical jurisaiction in both the internal and external fora." ~i UP to the present century, by way of to juris-cfion as a 'public power to govern, dominhtive power as often called a private power. It was calledI dominative power because it was understood as the power or force .~xercised not only on the matter or content ~of the com-mand- theth "ing to be done or not to be done--but also ~n the will of the subject so that the will oflthe subject igree with that of the superior. Perfect s.u~bjection or ibedience brings the intellect of the subject xn,to harmony qith that of the superior insofar as such subjection may )e possible ~ in view o~ the evidence presented to the in-ellec~. By way o[ further distinction, a third kind 6f authority vas recognized by some writers. They called ~it domestic ~ower or authority. This is the power, for exar~ple, ~vhich ~ religious superior exercises over lay peopleI who work or the community; it is also the power of a ~resident of ~ commercial firm, or the supervisor of a hospital floor or . he head o[ a department has over the employees, It is the ~ower or force over the matter or content of the command ,nly--the thing to be done or not done; there ~ no power ,ver the will, much less over the intellect of th~ employee. While these were the usual distinctions of r~ligious au-hority, they did not cover all the authority of a religious uperior, even in a non-exempt institute. A r~,ligious su- ,erior has authority over many things which ,do not fall .nder dominative and domestic power as described above. 7h ose powers all deal w"~th phy"sical persons~, iwith in" d~- iduals. Some illustrations of a religious superior's au-orxty not exercised over lnd~v~duals as such, at least dl-ectly, are the following: admission to the no,~t~ate and ~ religious profession; limited power to dispense from n.pediments to such admission; administration, of the re- .g~ous community as such; administration of the tern- Religious Authority VOLUME 20, 1961 + 4. 4. James I. O'Connor, S.J. REVIEW FOR RELIGIOUS 182 poralities of the entity over which one has authority, example, to contract loans, negotiate sales, lease property and so forth. What kind of authority is this in the case a superior in a non-exempt religious institute? For centuries it was very disputed among canonist., whether such authority was part of the dominative powel of religious superiors.1 Spearheaded by Father (now dinal) Larraona,~ the opinion that such authority was anc is part of the dominative power of a religious superiol gained ground in the present century. As a result, the olt description of dominative power as a purely private powel had begun to fall by the wayside and certainly seems belong there in view of a rather recent reply from tht Holy See. The power in a society has to correspond to it nature. That nature is public since religious institutes art set up by pontifical authority .as a public state of life More%ver, the Church through lawful representatives r ceives-the vows of such religious and these vows are publi both in themselves and in their effects (Canons 488, 1° 1308, §1). Canon 501, §1 acknowledges only two kinds o authority in religious life: jurisdiction and dominativt power. Since in a non-exempt institute the authority is no jurisdiction and since the power over such things as tern poral administration is not a private power, dominativt power must now be classified in two forms: public ant private. Relative to jurisdiction, many questions can arise; fo~ example, kinds of jurisdiction, delegation and subdelega tion of jurisdiction, conferral of jurisdiction in cases whert a doubt is had as to whether a person possesses or cat possess jurisdiction, conferral of jurisdiction on a persor who objectively does not have it but is commonly believec to have it. All these, as well as some other aspects of juri diction, are nicely provided for in canons 196 to 209. N such provision was made in canon law for correspondin' questions pertinent to dominative power. Nevertheless the same questions.and problems can and do arise fo non-exempt religious superiors. All the discussions which proposed solutions to suc] vexing questions were finally brought to an end by al affirmative reply of the Pontifical Commission for th Authentic Interpretation of the Canons of the Code c Canon Law. An affirmative answer was given on March 2~ 1952, to the question: "Whether the prescriptions c 1Those interested in this dispute and the development of th notion of dominative power are referred to a study by the preser writer, "Dominative Power of Religious Superiors," which was pul fished in The Jurist, 21 (1961), 1-26. ~ "De potestate dominativa publica in iure canonico," in Congressus luridici Internationalis, v. 4 (Rome: Pontificium Insl tutum Utriusque Iuris, 1937), 145-80. canons 197, 199, 206-09, concerning the power of jurisdic-tion, are to be applied, unless the nature of the text or context of the law prevent it, to the dominative power which superiors and chapters have in rehg~ous institutes and in societies of men and womenliving in 'common with-out public vows?''a Many religious superiors seem never to'.have heard of this reply, much less of the canons cited, their wording, and their interpretation. Therefore, we shall :first give an Enghsh translauon of those canons, substa, tuung dorm-native power for jurisdiction so that it will be easier to read, understand, and, later, comment upon them. Canon 197, § 1. Ordinary dominative powei: is that which the law itself attaches to an office; delegated]power is that which is committed to a person, §2. Ord:'.nary power can be neither proper or vicari-ous. Canon 199, §1. One who has ordinary dom,inative power can delegate it to another totally or partial,ly, unless the law expressly provides otherwise. §2, Moreover, dominative power which ,has been dele-gated by the Apostolic~ See can be subde~egated for a single act or habitually, unless the delegate was chosen be-cause of his personal qual,ficauons or subdele.gatmn is for, bidden. §3. Power delegated for a whole class of. cases by one who has ordinary power but is subordinate t0 the Roman Pontiff can be subdelegated in individual cases. §4. In other cases, delegated dominative power can be subdelegated only if subdelegation is expressly permitted. §5. No subdelegated power can ~n turn be subdele-gated unless the power to do so has been expressly granted. Canon 206. If several persons have been d~legated suc-cessively, that one must execute the busines~ whose com-mission was given first and has not been expressly re-voked by a later rescript. Canon 207, §1. Delegated power ceases to exist: by fulfillment of the commission; by lapse of time or by exhaustion of the nut Lber of cases for which it was granted; by cessation of the reason for the delegation; by revocation by the delegator together with lirect notice to the party delegated; or by renunciation on the part o[ the one d, elegated to-gether with direct notice to and acceptance ~by the dele-gator. However, delegated power does not cease with the expiration of the authority of the delegator ekcept in the tw~ cases mentioned in canon 61 . 8Acta Apostolicae Sedis, 44 (1952), 497; T. Lincoln Bouscaren, S.J., Canon Law Digest, v. 3 (Milwaukee: Bruce, 1953), 73. + 4. 4. Religious Authority VOLUME 20, 1961 183 4. 4. ]ames I. O'Connor, $.]. REVIEW FOR RELIGIOUS 184 §3. When several persons have been delegated cor-porately, if one of them loses his power, the delegation of all the others also expires, unless the contrary appears from the tenor of the delegation. Canon 208. In accordance with the norm of canon 183, §2, oidinary power does not expire with the expiration of the authority of the person who conceded the office to which the power is attached. However, it does cease with the loss of the office and is suspended by appeal made ac-cording to law, unless the appeal happens to be made with-out suspensive effect, saving the provisions of canons 2264 and 2284. Canon 209. In common error or in positive and proba-ble doubt of law or of fact, the Church supplies dominative power for the external forum. We shall now give some commentary on each of these canons as well as illustrations of their application and non-application. Canon 197 The word ordinary here is a technical term and is not to be confused with our everyday usage of the word as meaning usual, regular, habitual, and so forth. For power to be ordinary two things must be verified: 1) the power must be given by the law itself, whether that law be the Code of Canon Law or the constitutions, which are the particular law of the religious institute; 2) the power con-ferred by this general or particular law must be attached to an office in the institute. An office, as canon 145, §1 tells us, is a function permanently established by divine or ecclesiastical ordinance, conferred conformably to the sa-cred canons, and carrying with it some participation in ecclesiastical power of orders or jurisdiction, or (now in virtue of the 1952 reply) dominative power. Thus, the power of a superior to govern the house or the province or the whole institute is ordinary dominative power be-cause the power is conferred in canon 501, §I of the code and is attached to the office of superior, no matter who may be the incumbent .in the office. The details of that power are partly spelled out in later canons of the code and partly in the constitutions. Some examples of ordinary power from the code are: government of the community over which one is superior; administration of the temporalities of the entity in which one holds office; admission to novitiate and to religious profession; limited prolongation of postulancy, novitiate, and temporal profession; anticipation of renewal of tem-porary profession; change of cession and disposition of one's property; admission of outsiders into cloister in certain instances; egress of religious from cloister under certain conditions; exclusion from renewal of temporary vows or admission to perpetual vows; in all communities, the conduct of the preparatory process fo~/ dismissal of perpetually professed members and, in diocesan law in-stitutes, also that for dismisSal of temporaiily professed members. Not every superior ~has all these powers: some be-long only to the superior general; others ark had also by provincials; still others are possessed by the 16cal superior. Just which superior, alone or conjointly with! another, has these powers must be learned: from reading ~he code and the constitutions. ~i. Some common examples of ordinary power from par-cular law, that is, the constitutions, are: reception of isitors; going out to visit; making trips; dispensation from disciplinary articles of the constitutions; and ]o forth. The details determining the exercise of such po.wers will, in each case, have to be gleaned from the constitutions. Delegated power is defined in the canon. It is any power ~or ta bueth iomriatyg iwnehdic, hw iist hnoout to crdoinnsairdye.r Dinegl etghaet ep~lr psoonw eorf cthane ~lelegate whereas ordinary power can be conceived even though nobody holds the office to which the law attaches ~1 e authority. Ordinary power ~s inherent ,to the office; ~elegated power must always be invested in aI person. r Delegation is conferred by word of mouth or in writing wh l"ch may be the written law itself or some other form of ocument or rescript. A rescript ~s s~mply a written reply to a question or petition. Delegated authority must always be given expressly. Express conferral may be explicit or implicit. Explicit :lelegation is had when the superior in so many words nforms another that he is hereby given suct~-and-such a ~ower or faculty or authority. Implicit delegauon is ~ower of authority or a faculty which ~s not conferred in o many words but which is contained witl~in another ~ower or faculty explicitly conferred which, m turn, can ~ot be exercised either at all or, at least, not ade-quately unless the other power or facul'ty is also ~ossessed. In such a case that other power or faculty s implicitly conferred. Thus, for example, a supe- "ior delegates a subject to investigate a t~oublesome ~tuauon and take care of it. This is explicit delega-ion. When the investigation is made, the delegate finds hat the effective way to correct it is to revoke ~ delegated aculty of the party concerned or to impose a penance. qowever, the superior did not tell the delegate he had he power to revoke in one instance or to punish in the ~ther. Nevertheless, since the superior delegated the per-on to take care of the situation, implicitly ~e thereby lso delegated to him all the power necessary to effect that vhich was explicitly delegated. Delegated authority is not to be confused with pre-÷ ÷ ÷ Religious Authority VOLUME 20, 1961 185 + lames I. O'Connor, S.]. REVIEW FOR RELIGIOUS 186 sumed authority. In the case of presumed authority, the person making the presumption can not contact the party having the authority. Further, after weighing all the cir-cumstances and what is sincerely believed the superior or official would do if asked, he draws the conclusion that the authority would be granted if the superior or official could be contacted. Such action is very different from the express grant of authority made by the superior or official to a definite 'person or group of persons. What power can be delegated will be taken up under canon 199. Ordinary power is said to be proper when it is possessed and exercised in one's own name. Hence, the authority given by the code or constitutions to the superior general, the provincial, and the local superior is both ordinary and proper. Vicarious power is ordinary because the law, especially the constitutions, provides for the office of vicar and the authority of the vicar is determined and conferred by the law itself. However, vicarious power differs from proper power in that the former is not exercised in one's own name but in the name and according to the mind of the superior whose vicar this party is. As a result, when the superior can not discharge his office, for example, because absent from the community or because confined to his room by sickness, and so forth, the vicar becomes acting su-perior and has most, if not all, of the authority of the su-perior. But this authority must be exercised as the supe-rior himself would exercise it. Consequently, the vicar may not take advantage of his position to change the policies established by the superior, even though the change may be desirable. Likewise, he can not grant a re quest which has been already refused by the superior. Moreover, as soon as the superior is again able to discharge his office himself, the power of the vicar ceases because the function of the office of vicar ceases. Vicarious power and delegated power are alike in that in both cases the power is not proper and so is exercised in the name of another. These powers are unlike in tha! vicarious authority is annexed by and spelled out in the law whereas delegated authority depends totally on the will of the delegator as to what authority is possessed. Th~ two forms of power also have different norms as to when and how they are terminated as will be seen by comparin~ canons 207 and 208 as well as what was said above abou~ the cessation of vicarious power. In the light of these distinctions between delegated, Vi carious, and proper power, it seems worth while notin~ that in orders and congregations having a hierarchica form of government, the local superior in regard to hi own community is not a vicar or a delegate of the pro vincial or general superior. This point is explicitly se down in article 312 of the Normae drawn u~ by th Sacred Congregation for Religious. Some . superiors seem not to be aware of the position legally held by the local,superior. This Is especially, true when, the major su-perior drops in~ on the local community either merely for a stopove;,or for a canonical v, isitation. ThE local superior is and remains the true superior of the lo~al community and still possesses and has the right of exercise of all the authority cgnferred on a local superior byI the code and by the constitutibns; The Norma~ in article 265 e~plicitly state thav a provincial or general superior ,can not at the same time be a 19cal superior. A very immediate~and logi-cal ~onclusion follows from tha~t premise: Itherefore, the major suoerior can not take over the functions of a local superi~r.'O'ne,can not.lawfully discharge tl~e function of an office one'does not and ~n h~t ha~. , The only ~xception to this ge~aeral rule islthat in which the local c~mmunity is composed only of m~mbers of the provincial or general curia. Even ~n such cases, ff the com-mumty ~s large, as it ~s in some orders and congregauons, a special religious ~s appointed to be the local superior of the house since such work would notably interfere with the prlnc~paJ wo.rk 9f the major sqpenor m the admxms-tration of the province or institute. A word of caution o~ught to be injected here. There are some "active'-' communities which seem n_ot ~to be obhged by, the~above norms because their local superiors have on!y thg authority th,e top sup.eripr grants the~m. However, such communities do not have the government olan of the ordinary order or congregation. Theirs is [1~ monastic form of government inowhich there is only lone superior who is the equivalent of the abbot or abbess in a ~trictly monastic con~munity. What look like local-~ommunities are not such, canonically; they are not separate moral or jund~c.al~persons. As a result, the superiors" of such houses, are not true superiors in their own right but are vica~rs qr delegates of the one and only true superior. Their authori~ty, then, is only what th,,e one superiorl gives them. Canon !~9 . This canon sets down the rules governing tlie' delegation of authority. In the first place we are told that everybody who has ordinary dominative power can delegate any part of it or the whole of it to another person unless the law, namely the code or the constitutions, expressly declares otherwise. In the absence of a contrary reqmre, ment ~n the law, the delegator may delegate any person competent [or th e assi"gnment, whether the delegated party be a mem-ber of t e ~nst~tute or not. Hence, a qualified s~uperior can delegate the priest who comes to say the community Mass to receive the vows of one of.the commumty. ,Whale the canon does not put a time limit on the duration of the Religious Authority VOLUME 20~, 19bl 187 James 1. O'Connor, $.J. REVIEW FOR RELIGIOUS delegation, even when all the authority of a sup6rior or official is delegated to another, it is usually p~inted out'by moralists and canonists that such unlimited delegation of all authority is an abdication of one's own resppnsibility. Therefore, delegation of total authority should be granted for a fiXed time only and, ordinarily, for a comparatively short time. ' ~ Delegated power can be used in any legitimate way un-less the manner of use was also defined at the time of dele-gation. When delegation is made, the terms of delegation should be clear to both delegator and delegate so that all doubts and misunderstandings can be avoided. In this first paragraph of canon 199 the solution is of-fered to many problems of superiors. So very often supe-riors, and especially local superiors, complain that the), have no time to be a real superior, to be a mother or father, ~s the case may be, to the members of the community be-cause their time is largely taken up with granting routine permissions, distributing articles, for example, writing supplies, dentifrices, ~ind so forth, so that there is very lit-tle or no time left to help subjects with doubts, questions, and problems. One way of getting that necessary time is to delegate some one or more persons in the community to grant those routine permissions, to distribute articles to the members of the comm~unity, to handle the mail, and so forth. Heretofore some superiors doubted whether they could use such a means as delegation) Whatever grounds for doubt" existed earlier, there is certainly no basis' for such doubts since the 1952 reply of the Code Commission. In as much as the right to delegate is granted by law to all having ordinary power, this power to delegate is itself part of that ordinary power and the superior needs no approval of a higher superior if he chooses to delegate his authority. It may be that a superior in one institute can not delegate to the same extent as a superior in another in-stitute because of a limitation contained in the constitu, tions which is not found in the second set of constitu(ions. Such a limitation, however, has to be found in the law; otherwise there is no restriction except, as previously noted, in the case of delegation of total authority for an indefinite period of time. Occasionally a superior is afraid to delegate authority because he fears the delegated party may use poor judg-ment, abuse authority, and so forth. This simply means that the superior should be as careful as possible in" the selection of the person to be delegated. Sometimes this is the only real way to find out what a given person will do with authority. Secondly, if such faults occur and the dele-~ gate does not amend after advice and correction, since the authority belongs to the superior, just as that authority Could be delegated, so also it can be revoked at any time the delegator judges it should¯ Conseq.u1e tnht dyl, e e e-gator never has to feel that once authority is delegated, it is gone forever from his control. The second situation in which delegation is allowed by general law is that in which~:tileHdly See d~leg'a~t~s an in-fervor, who, ~n turn, may pass on delegation to a third party. Such delegation of delegated power is called sub-delegation. Subdelegation can be granted either for a soli-tary case or for all such cases unless the Holy See's con-ferral of delegauon exphcltly states that the delegate has been chosen because of his personal quahficat~ons or un-less the Holy See exphcltly forbids subdelegauon. To date, there is no general grant of delegation of dom~na-ttve power by the Holy See to all'religious superiors. An examrfle of such a general grant of delegatei:l ]urtsd~ctton ~s the brochure of qumquenmal faculties to local ordi-naries, some of which can not be subdelegatedA Another occasion in which subdelegationlcan be made is found in canon 199, §3. Here the original delegate re-ceives his authority from a person who posse.sses ordinary power 'but who is a. subordinate, of the Holy See. More-over, the delegate must have authority over a whole class of cases or business. In this situation, the del~egate has the authority from the code to subdelegate t~artt or all of his authority to a given individual for all cases! or only one case, or he can subdelegate many persons forI one case. There are or can be a number of instances in which this law can be applied. Perhaps the best exampl~ is that of a hospital administrator or a college or university president, The ultimate responsibility for the hospital br school be-longs to the superior. However, because ofI the load of work involved in functioning as a religious superior,' espe, clally of a large commumty, and also funcuomng as the I administrator of the hospital or the president of the col-lege or university, the work-load is split andlthat part of the superior's authority which pert~ains to thee operation of the hospital or school is delegated to another who serves as admtmstrator or president.5 Th~s ~s delegauon by a person hawng ordinary power but subject to the Roman Pontiff. It is conferred for a whole class of cases or busi-ness, namely, operating the hospital or schooi. If need or usefulness should dictate, the administrator ~r president | t T. Lincoln Bouscaren, S.J. and James I. O'Conn!r, S.J., Canon Law Digest, v. 4 (Milwaukee: Bruce, 1958), 69-82. I . ~ Such split authority can give rise to many problems. A suggested method for dividing the authority in the case of hospitals can be found in an article by the present author, "The Hosp.~tal ~n Canon Law;" in Hospital Progress, 41 (February, 1960), 361-87. Most of the suggested division of authority can be applied to col!ege and uni-versity presidents by simply substituting "president" for "adminis-trator ¯" I Religious Authority VOLUME 20, 1961 189 ]ames L O'~,o~nor, S.]. REVIEW FOR RELIGIOUS 190 has the authority from the code to subdelegate part or all of his authority in~ an individual case. Another example, in a different line, is that in which the local superior is delegated by the superior general or, if competent, by the provincial, to receive the vows of all~ who make profession, temporary or perpetual, in the hduse of that superior: This, again, is delegation for a whole class of cases, namely, the reception of vows. Such a local superior, if impeded from receiving the vows him-self, could subdelegate another, for example, one of the community or the priest celebrating the vow Mass, to re-ceive the vows on this particular occasion. Apart from the two cases provided for in §§2-3 of canon 199, §4 prohibits subdelegation of delegated authority un-less Such delegation is expressly permitted by the original delegator. Subdelegated authority can never be again sub-delegated unless an express grant to that effect was .made when the first subdelegation was given (canon 199, §5). Canon 206 Canon 206 supposes a' situation where, for example, three sisters receive delegation for the same task: Sister Felicitas on January 2; Sister Mary on January 3; and Sis-ter Josephine on. January 5. While all three have delega-tion, which one has the right and obligation to exercise her delegation? Canon 206 replies that the person whose commission was first given has the right and duty; in: our case, that is Sister Felicitas, An exception to this rule is made if a later commission contains a revocation of the earlier grant; for example, if in Sister Josephine's appoint-ment there is also found an explicit revocation of the dele-gation previously extended to Sisters Felicitas and Mary~ Canon 207 ~ Canon 207 lists the ways in which delegated power ceases to exist. Only §1 and §3 are quoted above because §2 can not apply to purely dominative power. Only a brief commentary seems useful here. I) Fulfillment of commission: the delegated authority ceases as soon as the job for which it was given~has been completed. 2) Lapse of time: authority was delegated to December 31, 1960 inclusive. With the end of 1960 the delegated authority also ended. 3) Exhaustion of number of cases: delegation, was ex~ tended to receive vows on five occasions. After the fifth occasion the delegation is lost. 4) Cessation of the reason for delegation: Sister Felicitas is delegated to govern the convent of St. Helen, December 26-31 because the local superior is to be away to attend a series of special conferences. On December 24th word is ~ceived that the director o the con erence has taken eriously sick and the conferences have been ~alled :of[. As result, the superior does not go away Dece.mber 26-31. ince the reason for Sister Felicitas' delegation .has now eased, her delegation also ceaseS. .5) Revocation by the delegator roger er wxth direct no-ice to the delegate; of great imp ortance in~ this stpi ula-ion is the word direct. An example: Brother Hilary has ¯ een delegated by his provincial to negouate the, sale of a ,fece of community property. Before he has time to com- ,lete the transacuon, he hears from a fellow rehg~ous who appened to pass through the prownclal's re.s~dence 'that he provincial said he was writinga letter to Brother Hil-ry revoking his delegauon. The same day l~e hears this ews, Brother Hflary happens to have an appointment to lose the property deal. Does he still have~delegauon to do :~? He does, because he himself has not received dire~t otice from his provincial of the revocation ofldelegation; e merely heard of it from an unofficial sourc.e. If the fel- :~w religious was commissioned by the provincial to in, ~rm Brother Hflary of the revocauon, then Brother s elegat~on would cease as soon as he was informed by h~s eligious confrere. ~6) Rentinciation on the part of the delegate ~together ,ith direct notice to and acceptance by the:del~gator: Two ~ings are to be noticed in this instance: dire~t notice to nd acceptance by the delegator. Direct ha~ the same -~eaning as above regarding revocation. In addition to the irect notice, for instance, Brother Hllary reforms his pro-incial by letter or phone that he is renouncing the dele-auon g~ven him, there must be acceptance by lthe delega- ~r. Brother Hilary does not lose his delegation unless his rovincial accepts.,the renunciation. | . After listing all the ways a given individual@ay lose his elegation, the canon goes on to add a situation in which elegation is not lost, even though, at first glance, it might -em delegation is lost: An illustration will l~elp: Sister enigna, a local superior, has been delegated by her ,other general to receive all vows pronounced in her con-znt. Mother general went out of office Januu~ry 5th be-muse she died that evening. On the morning.+f January ,~h, Sister Benigna received the vows of some s~sters in her ~mmunity. Later that day she learns of mother" general!s eath. Now Sister Benigna wonders if she had ~lelegation ~ recexve the vows that morning. Sxnce no hm~tat~on was ut on her delegation, her authority continued on Janu-y 6th and still continues after that date unless the new ,other general revokes the delegation. The law on this point makes an exception in the two ~ses mentioned in canon 61 which reads: umess ~t should opear otherwise from appended clauses, or unless the re~ I ÷ ÷ ÷ P~ligious Authority ¯ VOLUME 20~ 1961 19l ÷ ÷ ÷ ]ames I. O'Connor, S.J. REVIEW FOR,RELIGIOUS script confers on some person the power to grant a favo to particular persons named in it and the matter is stil intact." Examples of "appended clauses" are: "As long as I a. superior general"; "As long as I wish." With her remova from the office of superior general, both appended clause cause a cessation of the delegated authority. The "As lon as I wish" can be had only if she is competent to grant th delegation. With removal from office she is no longer co petent to have such a wish effectively; therefore, the del gation ceases. The second exception supposes delegation, for exampl to permit Sisters Gervase and Protase to take a trip t Europe. For one or other reason, the delegate has not ye done anything about granting the permission to :the tw sisters named. Unexpectedly, the delegating superior die Since the matter of the delegation is still intact, that i has not been touched, has not had even a beginning o execution, the delegation ceases. Hence the erstwhile del gate is no longer competent to grant the favor and Sister Gervase and Protase are out of a European trip. Canon 207, §3 considers the case where two or more pe sons have been delegated as a single body to carry ou some commission. Brothers John, James, and Joseph hav all been delegated as a unit to transact some business fo the community. Brother Joseph renounces his delegatio by direct word to the delegator who, in turn, accepts th renunciation, Unless the contrary appears from the orig nal delegation, the delegation of Brothers John and Jame automatically ceases. Canon 208 In canon 208 the code turns to the question of cessatio~ of ordinary power. It repeats the norm already mentionec in canon 183, §2; namely, an ecclesiastical office is not los by the loss of authority in the party who conferred th~ office, Therefore, canon 208 draws the logical conclusio~ that authority attached to an office by the law, that i~ ordinary power, is not lost when the party who conferre, the office loses his own authority. This norm is similar t. that for delegated authority at the end of canon 207, ~§1. In the present instance, the case supposed is that, fc example, of a local superior who was appointed to offic by a competent higher superior. The term o~ the highe superior ends before that of the local superior appointe~ The local superior's power, derived from law through hi office, continues even though the party who put him int the office has now lost his authority. Ordinary power ceases when one loses the office t which such authority was attached. The power is su pended, that is, it is possessed but can not be used, if i! possessor lawfully appeals a decision to a higher superior, unless the nature of the appeal is such that it does not prevent immediate execution of ~the original deCision. Ap-peals in judicial processes usually produce suspension of the decision; otherwise, for example, in purely°fid~ainis, trative decisions, appeal or, more exactly, recourse does not suspend the decision (canon 1889). The norm set down above does not derogate from the provisions of canons 2264 and 2284. The first of these canons stipulates that an act of dominative power is il-licit if placed by an excommunicated person. Further, if the excommunication has been pronounced in either a condemnatory or a declaratory sentence of a judge, the act is also invalid. An exception to that law is contained in canon 2261, §2; but both it as well as canon 2284 can ap-ply only to priests, not to sisters and brothers. Canon 209 The last of the jurisdictional canons made applicable to dominative power is of .extreme importance, even though it is not usually of frequent'application. It solves situations which earlier caused very serious problems. Canon 209 supposes a situation where, in the objective order, a superior certainly lacks dominative power or has it only in a doubtful way, In the latter case, the doubt must be positive and probable, that is, there must be good arguments in favor of possession of the authority but there must also be good arguments against its possession. The source of the doubt may arise from a lack of clarity in the law itself or from the lack of certainty that a given fact or facts exist. An illustration of a doubt of law is found in canon 105, 1° concerning the necessity of having a consultive vote of councilors in order that the superior may act validly. As it stands, the canon says: "It is sufficient for valid action if the superior hears the councilors." It is disputed among canonists whether such a hearing is required for valid action because, contrary to its usual language, the canon does not say required. As a result, since the law itself is doubtful, even if the superior did not consult the council where consultation was prescribed in the general law or in the constitutions, the superior's exercise of dominative power is certainly valid since', in virtue of canon 209, de-fect of authority is supplied by the Church in such an in-stance. A doubt of fact means that with regard toa given event there are arguments for and against its existence. If the fact is required as a condition for possessing dominative power, the Church again supplies the authority needed. To illustrate: On May 15, 1960, Brother Joachim was ap-pointed provincial by competent authority. Some time + + + Religious Authority VOLUME 20, 1961 ~93 + ÷ ÷ James 1. O'Connor, $.]. REVIEW FOR RELIGIOUS later it comes out that at the time of his appointment Brother Joachim seems not to have completed his thirtieth year of age. If that is true, then, without a papal dis-pensation he is not a validly appointed provincial and, furthermore, lacks the dominative power of a provincial. An investigation of the matter shows some documents as well as testimony of relatives and friends indicating he was born August 16, 1929. However, other reliable sources give the year as 1930. Further investigation does nothing to solve the doubt regarding Brother's-birth date. If he was born in 1930, he did not possess one quality required by canon 504 to qualify'as a valid provincial. The doubt in this problem has nothi~g to do with the meaning of the law; it centers on whether or not a given fact occurred in one year or another. Hence, it is a doubt of fact, Since the doubt is both positive and probable, that is, capable of proof both ways, the Church supplies the dominative power brother needed for all his actions. As a result, they are all valid and licit. As for the future, brother should, of course, be reappointed by competent authority since it is not certain that the original appointment was valid. The third instance in which the Church supplies domi-native power is that in which there is no doubt either of law or of fact but because of some externally perceptible circumstance a person is commonly believed to be a valid superior when the real truth is that this person is not, Such a condition of affairs is called common error. From the evidence available and in accord with limited knowledge, the community forms the judgment that Sis-ter Lioba was duly elected superior general on February 11, 1958. She proceeds to exercise all the powers granted such a superior in the code and in the constitutions. One day in the summer of 1960 Sister Sophia, one of the gen-eral councilors, is attending a canon law lecture at the end of which she is very disturbed and consults-the lecturer. The consultation reveals the following facts as certain be-yond all doubt. Sister Lioba pronounced her temporary vows on August 17, 1937; she made her perpetual profes-sion on August 15, 1940. During the annual retreat of 1956 something the retreat master said raised the question whether Sister Lioba had valid perpetual vows. The above sets of dates of her professions, in virtue of canon 572, §2 in conjunctibn with canons 574, §1 and 34, §5 which re-quire a full three yea.rs of temporary vows, from date to date, in order to have a valid perpetual profession, clearly prove she was not validly professed of perpetual vows on August 15, 1940. Consequently, on August 15, 1956, with the full reali~zation of the invalidity of the 1940 profession, she pronounced her perpetual vows. At the general chap-ter on February 11, 1958, she was elected superior general. Because sister certainly had perpetual vows then; because it had been almost twenty-one years since sister pro-nounced her first vows; because the casting and counting 3f the ballots had been canonically performed; and be-cause the presiding local ordinary declared the elections met all the requirements of ciin6n law, all the sister's 6f the zommunity concluded that Sister Lioba was their new su-perior general. Sister Sophia's disturbance of mind was caused by a ;tatement of the lecturer that, among other qualifications, a :religious, in order to be a valid superior general, must have been validly professed a minimum of ten years, in-cluding the time of temporary vows (canon 504). Mother Lioba, although in the community since 1935, as of Feb-ruary 11, 1958 had valid vows for only just under four and a half years (August 17, 1937-August 17, 1940; August 15, 1956-February 11, 1958). Therefore, Mother Lioba is not really the superior general. Ignorance of the law on this point, even though it excused from all sin because nobody knew any better, does not prevent the canonical effect of the non-observance of the law, for the reason that canon 504 does not provide for ignorance as excusing from the effects of canon law (canon 16, §1). That is all bad enough. However, since a validly chosen superior is required for valid admission of candidates to the novitiate, to tempo-rary and per.petual' professions, to negotiate contracts of sale or loan, to appoint provincials and local superiors, and so forth, what about the validity of all those admis-fions, contracts, appointments, as well as all other actions whose validity depended on a validly chosen superior? Prior to the 1952 reply, cases like this with their chain reaction of multiple invalidities were something of a night-mare to canonists who in various ways sought to find a legal remedy to prevent' such awful consequences. The ;urest way to take care of such cases was to request from the Holy See what is called a radical sanation (sanatio in radice). Now in virtue of the 1952 reply, in such circum-stances, namely, where common error is had, the Church mpplies the dominative power necessary for the acts ~laced by such a "superior." Consequently, as regards the ictions of Mother Lioba, all those requiring dominative 3ower in order that they be valid, are all valid by supplied iuthority. As in the case of Brother Joachim, so also in :hat of Mother Lioba the status as superior should be vali- ]ated if possible. In the present instance the easiest way ~zould be to petition the Holy See for a radical sanation. These considerations should make for a better under- .tanding and appreciation of religious authority or dotal: ~ative power and especially of the application of certain urisdictional canons to that authority. + 4- + Religious Authority VOLUME 20~ 1961 195 FRANCIS N. KORTH, S.J. Total Dedicatio in the Worl ÷ ÷ ÷ Francis N. Korth, S.J., is professor o[ canon law at St. Mary's Col-lege, St. Marys, Kansas. REVIEW FOR RELIGIOUS ]96 The apostolic constitution, Provida Mater Ecclesia, o February 2, 1947, focused attention upon a new, otficiall~ approved type of totally dedicated life in the world namely, the life in secular institutes. Members of these institutes bind themselves to the practice of evangelica poverty, chastity, and obedience according to their con stitutions for the purposes of personal sanctification and of apostolic work. Secular institutes are the third corn ponent of the juridical state of perfection-to-be-acquired as that state exists at present in the Church; the othei two components are the various kinds of religious insti tutes and of societies of common life. Outside the juridical state of perfection-to-be-acquired, there exist other groups many of them in a stage of development or growth, whose members dedicate themselves totally to an apostolic life and personal sanctification. Religious institutes and societies of common life (ex amples of these latter are the Paulist Fathers, the Mary knoll Missionary Fathers, the Vincentian Fathers) are well established and known in this country. Not so seculaI institutes, since they are a more recent development. Secular Institutes in the United States In an effort to help the growth of this new form ol specially.dedicated life in this country, as well as to make these groups and other similar groups better known and understood, a small number of interestedpersons:met in the summer of 1949 to talk things over. A year later in July, 1950, the first general meeting of such groups with some seventy participants, was held in Washington D.G. From this developed an unofficial national cente, (operating with the knowledge.and approval of ecclesiasti. cal superiors) for the purpose of coordinating activity and~ of collecting and disseminating information. Until 1957 this center was located and serviced at Notre Dame Uni cersity under the able and generous leadership of Father Ioseph Haley, C.S.C. Two other persons who have played mportant roles from the beginning are Father Patrick ~lancy, O.P. and Father Stephen Hartdegen, O.F.M. In lanuary, 1952, a restricted' gathering (seventy-five 'per- .ons attended, however) met at Notre Dame University. Fhe proceedings of both the 1950 Washington meeting ~nd this 1952 meeting at Notre Dame were compiled. In August of that same year, 1952, the first National ,~ongress of Religious in the United States' was held at Notre Dame University; during this Congress two papers were given on secular institutes. About the same time ~ome published materials about secular institutes ap-peared, and some talks were given to various groups about the same subject. In February, 1954, a meeting 3f twenty-six interested priests took place in Chicago. Meanwhile, an informational bulletin was being issued from time to time by the national coordinating center. The interests of the coordinating center had now been extended to include, besides secular institutes, other groups devoted to a life of total dedication in the world. The bulletin received the expanded title of Bulletin on the Dedicated Life in the World and Secular Institutes. In 1955 a workshop for dedicated persons in the world was conducted at Chicago. That same year regional meet-ings were held in San Francisco and New Orleans, fol-lowed by one in Chicago the next year and one in Boston in 1957. The national center's bulletin was now appear-ing under the name of Bulletin of the Life of Total Dedication in the World. In 1957 there was published a ;ymposium, Apostolic Sanctity in the World, edited by Father Haley, C.S.C.; in August of the Same year a ,aational meeting of representatives of the four regional areas was held at Notre Dame University. The Sacred Congregation for Religious had been ac-quainted with these different activities and meetings. ~'or purposes of unifying the activity and of guiding the zfforts of all concerned along proper lines and in con- ~ormity with the Holy See's directives in this matter, the 3acred Congregation urged that all these related activities ,~e now placed under the direction and guidance of the .~onference of Major Superiors of Men's Institutes in :he United States. Father Joseph Haley, c.s.c, had been in charge of zoordinating efforts until 1957, at which date the national ,nformation and coordinating center was shifted to Wash- .ngton, D.C. with Father Stempen Hartdegen, O.F.M. of Holy Name College in that city as the national director tnd president of the newly proposed (but not yet fully tpproved) Conference of the Life of Total Dedication n the World. The plan for this Conference had to be 4- 4. Total Dedication VOLUME 20, 1961 19'/ Francis N. Korth, S.~. REVIEW FOR RELIGIOUS 198 submitted to the Conference of Major Superiors for approval. This approval was obtained (September 29 1959) and 'preparations were then begun for the firs triennial general meeting of the new Conference (here after referred to as the C.L.T.D.W.), Though ~his meeting was projected .for St. Louis in November, 1960, an un foreseen delay caused it to .be held in Washington, D.in January of the following year. The Washington Meeting This first triennial general meeting represented an edu cational effort to make the life of total dedication in world, especially in secular institutes, better known and understood by clergy and laity alike. The program was signed to appeal both to those whose interest in this wa) of life was just beginning and to those whose interest wa~, of long standing. The opening session of the meeting, convened in auditorium of McMahon Hall at The Catholic University on Saturday, January 28, 1961. Chairman of this session was the president of the C.L.T.D.W., Father Hartdegen. O.F.M. More than one hundred and fifty persons (laymen and laywomen, a number of priests, and several brothers and sisters) had registered for the meeting; a fairly large number of visitors, including some clerical students, individual sessions. The first formal paper of the meeting was a review the activities' during the past eleven years in the United States leading up to and culminating in the formation and. official approval of the C.L.T.D.W. This talk, .en-titled "The Conference of the Life of Total Dedication in the World--A Decade of Growth, 1950-1960/' has fur-nished the facts given in the opening part of the present article. Next on the program was a paper with the title, "An Active Lay Apostolate: Condition of Growth of Secular Institutes in the United States." The paper emphasized that an active apostolate and a deep interior life are the conditions for the growth of secular institutes in this coun-try. Secular institutes, the paper continued, are peculiarly suited to the needs of the times; because they are different in their extrinsic elements, they can fulfill the contem-porary apostolate's need of easier access to atheists and sinners; the institutes, accordingly, answer the universal need for an organized secular apostolate and for a deepl interior life. The paper then went on to give a historical and statistical survey of secular institutes, the main point~! of which are summarized below. In 1938.representatives of twenty-five societies or group~" of total dedication in the world came from various part,~ o[ the world to a meeting in Switzerland. Events such these gradually led up to the official, juridical recognition of secular institutes by the Church in 1947. In the United States at the present time there are repre-sentatives of twenty-five known groups of persons spe-cially dedicated to the apostdlat~ in the world;~ fli~se are either secular institutes or other groups which might de-velop into secular institutes. (No figures are available for Canada.) Of these twenty-five groups, twelve are secular institutes (eight are pontifical and four diocesan), seven are canonically approved pious associations, and six are not yet canonically established, but are existing with the approval of the bishop. The eight pontifical secular institutes are divided into six with final approval (Company of .St, Paul, Daughters of the Most Holy and Immaculate Heart of Mary, Mis-sionaries of the Kingship of Christ [women's branch], Opus Dei, Society of the Heart of Jesus, and Teresian In-stitute) and two not yet fully approved but having the de-cree of praise (Caritas Christi Union and the Society of Our Lady of the Way). The four diocesan secular insti-tutes are: Missionary Priests of the Kingship of Christ, Regnum Christi, Schoenstatt Sisters of Mary of the Catho-lic Apostolate, and the Secular Institute of St. Plus X. The seven canonically approved pious associations are.' Caritas; Domus Dominae and Domus Domini (Madonna House); Jesus-Caritas, Fraternity of Fr. de Foucauld; Ob-late Missionaries of the Immaculate; Oblates of St. Joseph; Pax Christi; and Rural Parish Workers of Christ the King. The six groups not yet canonically established are: Daughters of Our Lady of Fatima, Ecclesian Institute of Christian Life, Institute of Blessed Martin de Porres Work-ers, Institute of the Mystical Ghrist, Institute of the Word, and Pro Deo Workers. Not falling into the above categories of specially dedi-cated persons in secular institutes or in groups that might develop into such, but still worthy of mention here under a special listing because of total dedication or noteworthy apostolic work being done by their members are the fol-lowing four groups: International Catholic Auxiliaries; La Paix (Lafayette Associated Professional Apostolate of Individual Christians ); Lay Workers of the Sacred Heart; and the Society of the Daughters of St. Francis de Sales. [Some information about the above-mentioned secular institutes and other groups is available in a pamphlet en-titled Chan:~els, published by the national information center whose address is: C.L.T.D.W., Brookland P.O. Box 4522, Washington 17, D.C. The price of the pamphlet is twenty-five cents.] The above groups exist in. nearly thirty of the states, though the overall representation is small. While it is true that the secular institute movement has developed Total Dedfi:atlon VOLUME 2°0, 1961 199 4. Francis N. Korth, $.]. REVIEW FOR RELIGIOUS 200 fairly rapidly, still ther~ is reason for concern about the slowness of growth in the United States. The principal cause of this is perhaps the lack of realization on the part of many of what the modern apostolate means and re-quires; namely, the Christianization of modern society. Life in Secular Institutes Following the two main talks of the morning, the audi-ence was then divided into fourteen smaller work groups. Each group had a leader and a secretary; items presented in the preceding talks were discussed more fully by each group; and prepared questions to aid discussion were dis-tributed. Any conclusions were noted by the secretaries; summaries of these conclusions were presented at the final general session on the last day. The first afternoon speaker treated the topic of "Secular-ity in the States of Perfection of Secular Institutes." He made the point that the secularity of these new institutes does not imply secularism but rather a stable way of totally dedicated life in the world. The member of a secular in-stitute has the obligation of the three evangelical counsels of poverty, chastity, and obedience and is always subject to the will of God expressed by the constituti6ns and by superiors. Some difficulties encountered are loneliness, being misunderstood, and a lack of some of the things of the world while living and moving in it. The lack of com-munity life and of a common garb is hard for outsiders to understand. In addition, the member of a secular in-stitute is on his own to do the required thing: perhaps to give up a movie or a television program in order to be faithful to spiritual exercises, to do without new clothing because of the poverty professed, to stay away from an office party. There are no bells to direct one's day, no assistance from the example of others, as is had in com-munity life. Mentality, personality, and strength above average are needed to lead this life. A person must be an active, militant apostle, for part of a vocation to a life in secular institutes is to be the leaven in the masses. The second part of this first afternoon was devoted to a panel on "The Evangelical Counsels," the panelists being two priests and three lay persons. The first panelist pre-sented the canonical aspects of this topic, commenting on the nature of the vows or promises and their resultant ob-ligation or bond and on the fact that one binds himself according to his paiticular constitutions, that a member of a secular institute is not a religious, and that such a call-' ing is a special vocation which at times may require rather high intellectual qualifications. Prudence and good judgment are essential in any prospective candidate and, of course, a good moral life. Some inner impulse or desire is found, but not necessarily a liking; in other words, there should be some general appeal and an investigation of that appeal, The second panelist considered the moral aspects of a life of poverty, chastity, and obedience. His remarks may be summed up in the followifi~ ~iy. Poverty~ tile ~dical ownership remains, while the useful ownership is re-stricted according to the constitutions. A very strict ac-count of income and expenditures is required, the account being rendered to the superior usually at the time of the annual retreat.Combined with generosity to the poor, frugality is practiced. Ckastily: all sins against' chastity must be avoided and, moreover, ~easonable means must be taken to preserve the full beauty of this virtue. Members in the strict sense of secular institutes are forbidden to marry. Obedience: superiors are to be obeyed within the limits of the rule and constitutions. A formal command would be given in writing or before two witnesses and with the use of a special formula; this power is not to be used beyond what is found in the rule or statutes or constitu-tions. ',The practical "aspects of living poverty, chastity, and obedience in a secular institute were briefly treated by the three remaining panelists, each of whom considered one of the three evangelical counsels. The first speaker discussed the practical living of poverty, At times, he noted, it is difficult to determine the detailed application of poverty, particularly in the case of persons engaged in individual work or careers~ One should live in the spirit of poverty and pray to understand what: living in that spirit means. In everyday living two methods of practicing poverty are followed: 1) the individual keeps his own budget and sup-plies his own needs, getting the necessary permissions from his superiors; 2) income obtained from work is pooled and the needs of individuals are supplied by Superio[s. from the common fund. At times there might also be some com-bination of both these methods. Practical ~tuestions, de-termined or settled by the Constitutions or the rule of life of each institute, inclUde the following: whether or not to keep a budget, how much may be spent without special permission, how much to give to charity on one's own ini-tiative, how much.to give to the institute. A definite record of revenues and expenses must be~ kept and reported to superiors at stated times, Permission is required to spend any amount; a general permission might cover expendi-tures for medicine, toilet articleS, and so forth; for cloth-ing, by way of example, specific or special permission might be required. The alignment of permissions varies with the occupations of the members. In emergencies one may act and later report the matter. A booby trap in 'prac-ticing poverty could be the accepting of gifts from relatives or friends (though in some groups it is permissible tO ao ÷ ÷ ÷ Total Dedication VOLUME 20, 1961 ÷ ÷ ÷ Francis N. Korth, $.1. REVtEW FOR R~t.tGIOUS 202 cept gifts even of money) or working extra hours to earn more money when the time should be given to the apos-tolate. A monthly financial report might be required. The rule of life of a particular group will flesh out its constitu-tions on these and similar points. It is important to note that the practical living or regulation of poverty varies considerably with different institutes. Though there is a great variety concerning poverty in the const.itutions, some restriction is essential for all. The speaker on the practical living of obedience noted that obedience presupposes a mature mentality which sees that it is from Calvary that. the meaning of obedience be-comes clear. Obedience gives one an assurance of fulfilling God's will and it frees from pride. Just as other things connected with secular institutes have secular character-istics, so too does this obedience. The member of a secular institute is neither alone nor completely dependent: There are no .schedules or other helps as in religious institutes. Secular institute obedience must be active; often the su-perior gives only general directives. For example, the hour of rising in the morning and the hour of retiring at night are indicated; but if some friend or guest is in the house, the member could probably bypass that directive for the sake of charity. The last of ~he five panelists discussed the practical living of chastity. This means no marriage and no sin against chastity; for God, marriage is renounced and per-fect chastity is undertaken. In regard to dances and shows, the me .mber of a secular institute does not make a habit of these diversions but "attendance is permissible if charity or the apostolate requires it, One must be selective in tele~ vision programs; similarly, books and movies, if there is time for them, must be chosen wisely. Women members should wear clothing that is modest and suitable for their apostblate. Jewelry should not be expensive; it should be used as part6f the costume and not for show. As a motive for faithfulness in preserving chastity, a deep love of Christ should be cultivated. A strong devotion to the Blessed Mother will also help, as.also will fidelity to the rule, which was given precisely to be of assistance in this matter. Formation of M'embers of Secular Institutes The evening session feat ~ured another panel whose topic was "Formation for the Life. of Total Dedication in the World." This time, there w~ere four panelists, two priests and two lay persons. The first panelist spoke about spirit~ ual instruction and remarked that the purpose of a pro-gram of spiritual instruction is to give glory to God, to further the work of the Church, and to form apostolic secu-lar ambassadors of God.: For this latter purpose, apostolic virtues, especially as detailed in the particular constitu- tions, are necessary. In general there is need of zeal for souls, prudence, fortitude, and the gifts of the Holy Spirit. In any consideration of method in spiritual instruction, it is important to remember that the spiritual life must be allowed to grow by degrees. 'It ~as,suggested by the~speaker that in the period of formation fundamentals be stressed; a knowledge of secular institutes in general and of the con-stitutions of a particular group must be imparted along with the spirit of that particular group. In the period of temporary incorporatibn, the above areas should be devel-oped more fully, the .person should be acquainted with the apostolate of the institute, and forbearance of the faults of others should be inculcated.In the period of final or definitive incorporation there is need for continued spiritual instruction, for growing simplicity in one's spirit-ual life with no overemphasis on either the active or prayer aspect of secular institute life. Spiritual guidance was discussed by the next speaker. The spiritual director of a secular institute, he said, must realize that he is working with specially dedicated souls. He must teach them the principles of the spiritual, life with emphasis on prayer and mortification. He must also teach them to think with the Church, to have zeal, tO lead a life of self-denial in order to live with Christ. For purposes of guidance, the panelist suggested the following three "p's" as useful: 1) a philosophy of life (= the faith); 2) a pro-gram (for which consult the constitutions, customs, and heritage of the particular group); and 3) "passion" (= en-thusiasm for living total dedication). The means at a di-rector's disposal are conferences, lectures, discussions, di-rected spiritual reading, and especially a mirroring of all he teaches. The two lay participants on this panel discussed "Teach-ing and Living the Rule and Constitutions in Secular Life." For teaching the rule and constitutions, the third panelist stressed the need of starting with humility, since one is to serve when one governs or teaches. Compassion, zeal, pity, and patience are necessary to teach or train young people. The teacher must teach by living and must himself be immersed in prayer. In actually teaching, the person to be instructed must be studied and the amount of training or instruction to be given here and now must be duly measured. If the person should at present be con-fused or somewhat emotionally disturbed, teaching of mental hygiene is indicated. The vocabulary of instruc-tion should be adapted to the capacity of the hearer. The questions that will be asked of a teacher of the way of life in a totally dedicated group will always tend to be the same; hence the teacher must learn to be patient with the questioners. The final speaker of the panel gave some thoughts on ÷ ÷ ÷ Total Dedication VOLUME 20, 1961 203 ÷ ÷ ÷ Francis N. Korth, S.$. REVIEW I:OR RELIGIOUS 204 living the rule and constitutions. To this end the personal touch and a greater initiative in the following of Christ are needed, especially for groups that do not have training of members in common. Perfection is to be sought from the rule which must be taught gradually without any great upheaval or change in the candidate's life. It must be stressed, however, that the life the candidate is contem-plating is a life of total dedication. He should be taught that in day-by-day living decisions must be made by the individual, but later he should check his decision with the superior's judgment. In the realm of poverty, one should have as if he had not; hence there should be a spirit of being ready to turn.over all one's money to the in-stitute. In order to live the rule and constitutions there must be a constant, conscientious, mature completeness in giving. On Sunday, January 29, the second day of the meeting, a low Mass was celebrated in the crypt chapel of the Na-tional Shrine of the Immaculate Conception. The sermon at the Mass was entitled "The Catholic University and Secular Institutes." The hope was expressed that at some later date a planned series of general courses might be given at The Catholic University on basic knowledge about secular institutes and on training and spiritual in-struction fundamental for life in any groups devoted to total dedication. The Apostolate The general sessions were again held in the auditorium of McMahon Hall. The opening morning session pre-sented a panel of lay participants on the overall subject of "The Apostolate." Five speakers successively discussed lay missions (two speakers), social work, nursing, and teaching. The first speaker on lay missions gave some background information on the general idea of missionary work in the Church. The particular role of the lay apostle in mission areas, he said, is to develop an atmosphere of Christianity through the practice of Christian principles. To achieve this purpose, the natives must be educated in Christian principles, perhaps initially through the ministrations of those in some profession such as nursing. To prepare mod-ern young people for such lay missionary work on a life-time basis, spiritual preparation must first of all be stressed. Next, the prospective missionaries are to under. stand that there must be no forcing of American attitudes about government and life on the natives. The basic atti-tude of the missionary should be humility; he must be sympathetic to the customs and culture of the people among whom he is working. To this end a study should be made of the culture, philosophy, and literature of the par-ticular missionary country. The second speaker on lay missionary work pointed out that opportunities for laymen to spend their lives as per-manent missionaries are found in ~ay mission societies. A lay missionary should be imbued with the missiona~ry mys-tique: to give. He is "going~oht'' to help other p0~ential members of the Mystical Body. Emotional balance is neces-sary for a lay missionary. He should be able to accommo-date himself to the culture of. the country in which he works. "Missionary poverty" means giving up one's former way of living and even of thinking. Joy will be found in a sense of fulfillment, in the hope enkindled in men's eyes, in the happiness of the children one meets, and in the friendship of the natives. Hardships will include discour-agement, lack of assimilation by the natives, rigors of cli-mate, and the like. Teams of missionaries, as opposed to free lances, supply mental uplift, coordination of activity, spiritual assistance, and so forth. The third panelist spoke on the apostolate of social work, an apostolate that implies service and sacrifice. So-cial work implies climbing into the stream of human events and adversities to serve a fellow human being who is suffering. This demands a spirit of self-sacrifice and the conviction that no human being is trifling or insignificant. The fourth panelist discussed nursing as an apostolate. Nursing, it was said, is an art and science that deals with the patient in his entire environment. The nurse must be a mature person with a ministry of mercy based on the love of God. The nurse is to see Christ in the patients, for there is a need of "a restoration of nursing in Christ" to counter-act a secularistic and materialistic attitude. The average nurse today seems self-centered instead of Christ-centered. The nurse should try to help patients spiritually and should teach the Gospel message by action; thus, for ex-ample, the nurse should be ready "to go the other mile" whenever the opportunity arises. A nurse truly dedicated to Christ shares His sufferings and also His joys. The fifth panelist on the apostolate considered the area of teaching, pointing out that educational statistics in the United States show that many Catholic students on all levels of training are not in Catholic schools. Some sug-gestions have appeared in various publications to meet the situation; for example, to close the first four or five grades in parochial schools, to have fewer but more excellent Catholic schools, or to sacrifice tremendously to retain the entire system. Whatever be the solution to the prob-lem, it will always remain true that Catholic teachers must endeavor to be at least as professionally competent as non-Catholic teachers. The speaker suggested that a specialized apostolic group of lay teachers is needed in this country. Moreover, the influence and activity of the Cath-÷ ÷ ÷ Total Dedication VOLUME 201 I961 £05 Francis N. Eor~h, $.J. REVIEW FOR RELIGIOUS 206 olic teacher could well be extended into the area of adult education. After the close of the Sunday morning session, a formal group luncheon was held, at which the Very Reverend Celsus Wheeler, O.F.M. of the Conference of Major Su: periors of Men's Institutes in the United States gave a word of encouragement to the work done at the meeting. He told those in attendance that secular institutes and other groups requiring a life of total dedication in the world are in a splendid position to establiSh contact with people for apostolic purposes in places and circumstances where priests and religious often could not make contact. The second speaker at the luncheon was a physician, a member of a professional men's sodality, who spoke on the topic,. "Dedication to t~he Lay Apostolate through the Professions." In his speech he stressed that though the lay apostolate can achieve a vfist amount of good, still consid-ering the number of Catholics in the United States, there is not the'desired impact or influence which might be ex-pected. Many young people today have no concept of how their future work as professional men might be utilized for the apostolate. One must learn to think with the Church and to carry that thinking into one's professional life. A deep interior life must be developed so that this can spill over into apostolic work. As an example of what one group of professional men is doing for the apostolate, a detailed description was given by the speaker of the sodality to which he helorigs, of its course of training, and of some of its apostolic activities; his presentation was both impressive and inspiring, A business meeeting was held in the auditoriu

Issue 59.2 of the Review for Religious, 2000. ; Celibate .Chastity: A Symposium Religious Life Questions Witnessing Hispanic Catholic Report MARCH APRIL 2000 VOLUME 59 NUMBER 2 Review for Religious helps people respond and be faithful to God's universal call to holiness by making available to them the spiritual legacies tbat flow from the charlsms of Catbollc consecrated life. Review for Religious (ISSN 0034-639X) is published bimonthly at Saint Louis Univers!ty by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: foppema@slu.edu Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP P.O. Box 29260; "Washington, D.C. 20017. POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2000 Review for Religious Permission is herewith gianted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library, clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, arid copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. ~ 0 ]LIVING OUR CATHOLIC LEGACIES Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming SJ Clare Boehmer ASC Philip C. Fischer SJ Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm Barbara J. Soete SSND James and Joan Felling Kathryn Richards FSP joel Rippinger OSB Bishop Carlos A. Sevilla SJ David Werthmann CSSR Patricia Wittberg SC MARCH APRIL 2000 VOLUME 59 NUMBER 2 con en s 118 131 139 c Oib te chastity: symposium Bowling Alone, Living Alone: Current Social Contexts for Living the Vows Mary Johnson SNDdeN couples the social context of community living with new possibilities for the meaning of the vows, particularly celibate chastity, so as to provide a radical gospel-based witness to countercultural values. Celibate Life Offers Insights Keith Clark OFMCap gives evidence that a celibate life well lived communicates to our culture a powerful message about the nature and meaning of sexuality, the unique nature of Christian marriage, and the motivation for the church's ministry. Discerning Our Celibate Way in Our Culture David L. Fleming SJ spells out some of the implications of discernment--making decisions with a lover's instinct--for living celibate chastity, which is defined as a way of loving. 148 156 What Is Religious Life's Purpose? Justin Taylor SM and Albert Dilanni SM question whether the basic purpose of religious life had been obscured long before Vatican II and still calls for clarity now. Must Hermits Work? Kenneth C. Russell provides insight into the place and value of work in the traditions of eremitical life in the Western church and draws some conclusions for today. Review for Religious 175 Mission: Not Do We Have One But Do I Live One? Rol~ert J. Murray OS~, emphasizes the need to live the valu'es reflected in mission statements for the health of the congregation. 180 188 The Easter Faith of Catherine of Siena Roland Calvert OSFS explains the paradox of Easter faith found not in Catherine's writings but in the activities of her life. Foucauld's Evolving Response tO God's Call Cathy Wright LSJ pictures the unfolding of the vocation of Charles de Foucauld and points to what it says to us about understanding our own vocations. 193 repor U.S. Hispanic Catholics: Trends and Works 1999 Kenneth G. Davis OFMConv, Eduardo C. Fernfindez SJ, and Ver6nica M~ndez RCD present a panoramic of the year's events within the U.S. Hispanic Catholic community. 116 Prisms 209 Canonical Counsel: Location of the Novitiate 214 Book Reviews March-April 2000 116 ~e sometimes put more into preparing for a special event than we put into the actual celebration. We have been preparing during these past years to celebrate the new millennium--our efforts inspired by Pope John Paul II's Tertio Millennio Adveniente. Now that we have entered into the year 2000 we may find ourselves forgetful of the reason for our preparations. The bishops' conferences in many countries have identified various ways that priests, lay people, and religious may enter together into special celebrations that grace our liturgical year. Personally we are faced with the more day-to- day question: What are we doing to celebrate this jubilee year? First we need to recall for ourselves the obvious. What is this jubilee about? The heart of the jubilee year is our cherishing and rejoicing in the fact that the Word was made flesh, God became man, Jesus, Son of God and Son of Mary, was born two thousand years ago. And our world has never been the same. Each of us is called anew to our following of Jesus. How well do we know him? Despite the frequency with which we are exposed to the acronym WWJD, do we feel confident in acting out our response to the question "What would Jesus do?" The very title we proudly bear--Christian--suggests that others can expect to see in us a face of Christ, his action, his love, and his forgiveness. Perhaps, first of all, we need a renewed effort in this jubilee year to foster our friendship with Christ. As we search out the ways helpful to us for growing in our knowledge and love of Jesus (for example, spiritual reading, Bible study, prayer, Eucharist, volunteer service projects), we may find that Jesus' reference to the jubilee text in Isaiah 61 as he proclaims his own mission in Luke 4:18-19 can become our entrance into a way of celebration: Review for Religious The spirit of the Lord is upon me; therefore he has anointed me. He has sent me to bring glad tidings to the poor, to proclaim liberty to captives, recovery of sight to the blind, and release to prisoners, to announce a year of favor from the Lord. The context for such a mission for Jesus and so for us is "to be anointed," "to be sent." The biblical concept of jubilee involves, above all, a call from God. As we make attempts to find ways that we can celebrate, more than rushing to take on pious devotions or vol-unteer ministries, we need to listen to the call of God in our life. A litde more reflection time--listening time--is a pervading essential of a jubilee year. Jubilee and sabbath are intimately connected since jubilee is God's expansion of the sabbath rest. But rest in relation to God is not defined as inactivity; rather, sabbath centers us on taking time for our relationship with God, for enhancing that relationship. In a jubilee time we respond to God's initiative in our way of cele-brating rather than assume the initiative ourselves. Our behavior, then, would be like Jesus'--who describes himself as sent. For Jesus, the initiative is always God's. Our celebrating jubilee begins with our taking the time to be a listener, our being available to God's initiative, our making the effort to enhance our relationship with God. Just as jubilee is related to sabbath, so jubilee is also related to Sunday, the day of Jesus' resurrection. Jubilee celebrates a new begin-ning: drawing on new reserves of resources (for those who feel empty and poor), seeking new visions (for those who are blind or in the dark), enjoying new freedom (for those who suffer from feeling lim-ited and bound). The jubilee ideal for the Israelite people was spelled out in such concrete actions as returning land to original settlers, setting free the slave or servant, and letting the land lie fallow. Every action looked to a newness of life, a renewed beginning. Jesus assumed this dimension of the jubilee ideal as his mission and gave it divine meaning in his resurrection. We, the followers of Jesus and the recipients of his Spirit, continue to follow his example as we cel-ebrate jubilee: we listen to God, we follow God's lead, we imitate Jesus, we act like Christians. Maybe a jubilee year !s a time for us to confound G.K. Chesterton's witty and yet poignant judgment: "Christianity has not been tried and found wanting; it has not been tried." Our celebration means that we determine to act like Christians, day in day out, all year long. Th~ world around us cer-tainly would be different. We would know a jubilee. David L. Fleming SJ 117 . March-April 2000 MARY JOHNSON Bowling Alone, Living Alone: Current Social Contexts for Living the Vows celibate chastity a symposium The meaning of the vows, sociologically speaking, is drawn from the human context in which they are lived. Sociologically speaking, their significance lies, not in interior inspiration and dedication, but in how they appear different from other ways of life and ways of liv-ing. Religious vows are liv~d in many social contexts. This discussion focuses on two of them, the societal and the communal. For the first, I shall turn to Robert D. Putnam's influential article "Bowling Alone: America's Declining Social Capital" (1995). For the second, I shall refer to the provocative talk given by Sister Doris Gottemoeller RSM at the Wernersville symposium in 1998 and later published in Review for Religious (March-April 1999) and to relevant data from my recent study of women's institutes in the United States. Mary Johnson SNDdeN, an associate professor of sociology at Emmanuel College in Boston, participated in the symposium titled "Celibate Chastity: God's Invitation to Love in a Sexually Confused Culture" held 22-24 October 1999 at the Jesuit Center for Spiritual Growth in Wernersville, Pennsylvania. This and the next two articles come from that symposium. In this written version Mary Johnson has refocused her original presentation, developing and broadening the topic in the light of the subse-quent papers and discussions. Her address is Sociology Department; Emmanuel College; 400 The Fenway; Boston, Massachusetts 02115. Review for Religious Bowling Alone Harvard Professo~ Robert Putnam, in "Bowling Alone," draws a riveting picture of the result of the loosening of communal bonds across U.S. society in the last thirty years. A commentary on his research in the Chronicle of Higher Education (Heller, 1996) notes that "scores of iournalists have picked up on the implica-tions." Policy makers and government officials, too, have listened to him. Putnam has twice been invited to the White House for brainstorming sessions on the breakdown of American communi-ties. Currently he is writing a book on the subject, doing cross-national research, and participating in workshops that seek solutions to widespread civic disengagement. Putnam notes that "American social scientists of a neo- Tocquevillean bent have unearthed a wide range of empirical evi-dence that the quality of public life and the performance of social institutions (and not only in America) are indeed powerfully influ-enced by norms and networks of civic engagement." He says that these norms and networks are elements of the "social connected-ness" that constitutes the social scientific concept of "social cap-ital." He defines the concept thus: "Social capital refers to features of social organization such as networks, norms, and social trust that facilitate coordination and cooperation for mutual benefit." He continues: "For some reason, life is easier in a commu-nity blessed with a substantial stock of social capital. In the first place, networks of civic engagement foster sturdy norms of gen-eralized reciprocity and encourage the emergence of social trust. Such networks facilitate coordination and communication, amplify reputations, and thus allow dilemmas of collective action to be resolved. When economic and political negotiation is embedded in dense networks of social interaction, incentives for opportunism are reduced. At the same time, networks of civic engagement embody past success at collaboration, which can serve as a cul-tural template for future collaboration. Finally, dense networks of interaction probably broaden the participants' sense of self, devel-oping the T into the 'we.'" Putnam then provides a sweeping overview of the "declined" in social capital in the United States since the 1960s. He begins with politics. Putnam points out that, from the early 1960s to 1990, voter turnout has declined by a quarter in national elec-tions. Since 1973, attendance at town meetings has declined by a third. He states that decline is evident in studies of the numbers March-April 2000 Johnson ¯ Bowling Alone, Living Alone "attending a political rally or speech, serving on a committee of some local organization, and working for a political party." He comments on the loosening of bonds in nuclear and extended families and in neighborhoods. He continues by citing evidence of decline in religious involvement, labor union mem-bership, parent-teacher association involvement, and volunteer-ing in civic, fraternal, and women's organizations like the Red Cross, the Boy Scouts, the Shriners, the Jaycees, and the League of Women Voters. He states that, "after expanding steadily throughout most of [the 20th] century, many major civic organi-zations have experienced a sudden, substantial, and nearly simul-taneous decline in membership over the last decade or two." Putnam concludes this section of his article by referring to the metaphor in his title, which has become a symbol of the dis-integration of communal bonds in the society. He says: "The most whimsical yet discomfiting bit of evidence of social disengage-ment in contemporary America that I have discovered is this: More Americans are bowling today than ever before, but bowling in organized leagues has plummeted in the last decade or so. Between 1980 and 1993 the total number of bowlers in America increased by ten percent, while league bowling decreased by forty percent. The broader social, significance, however, lies in the social inter-action and even occasionally civic conversations over beer and pizza that solo bowlers forg6. Bowling teams illustrate yet another vanishing form of social capital." Putnam gives evidence of some countertrends: the rapid and dramatic rise in membership in certain groups like the Sierra Club, the National Organization for Women, and the American Association of Retired Persons. However, while the political clout of these organizations is considerable, the nature of involvement is vastly different from the organizations discussed previously. Putnam says: "For the vast majority of their members (Sierra, NOW, AARP, and so forth), the only act of membership consists of writing a check for dues or perhaps occasionally reading a newslet-ter. Their ties, in short, are to common symbols, common leaders, and perhaps common ideals, but not to one another. From the point of view of social connectedness, the Environmental Defense Fund and a bowling league are just not in the same category." Putnam identifies two other countertrends: the growth in non-profit organizations, and in support groups. But he argues that these do not fill the role that civic organizations do. He cites soci- Review for Religious ologist Robert Wuthnow's national, study of support groups: "Small groups may not be fostering community as effectively as many of their proponents would like. Some small groups merely provide occasions for individuals to focus on themselves in the presence,of others. The social contract binding members together asserts only the weakest of obligations. Come if you have time. Talk if you feel like it. Respect everyone's opinion. Never criticize. Leave qui-etly if you become dissatisfied. We can imagine that [these small groups] really substitute for families, neigh-borhoods, and broader community attach-ments that may demand lifelong commitments, when, in fact, they do not." Putnam has reflected on causes of and solutions to the breakdown of American communal life. He calls for reinventing community life, but, as an interview arti-cle in the Chronicle of Higher Education says, "the Internet will not do the trick. Nor will nostalgia for a vanishing America. 'Some people have interpreted what I have said as a nostalgic call to return to the 50s. That is not what I say.'" He continues: "It is not just social capital, period. It is social capital that cuts across the existing cleavages in American society. That is, it is not enough that we all start bowling again. There have to be bowling leagues in which people of different races are connecting with one another." He concludes his interview by asserting: "This is the single most important problem facing America. If we can solve this one, if we can get more people engaged in community life in contexts that respect American pluralism, many of our other problems--to begin with, our politics--will be different." Bowling teams illustrate yet another vanishing form of social capital. Beginning the Conversation Putnam's portrait of a society bowling alone has struck a deep chord in the national psyche of Americans. It has caused many to reflect on the fact that our democracy is dependent on a vibrant civic life held together by strong communal bonds. I would argue that Sister Doris Gottemoeller's article "Community Living: Beginning the Conversation" has had a similar effect. Her article has struck a deep chord in the religious psyche of Catholic sis-ters, causing many to ponder what community means to the way March-April 2000 12I Johnson ¯ Bowling Alone, Living Alone of life and mission of apostolic religious in this country. The com-munal bonds that Putnam studies appear weak in a variety of local institutions--family, neighborhood, civic organization, and the like. Both articles point us to a consideration of the quality of communal bonds in local communities of religious. The intent of Sister Doris's article is to "break the silence" about living in community. She believes that "community living may be the 'Achilles' heel' of contemporary apostolic religious life." She says, "Often the mere mention of the topic brings about an awkward silence, embarrassed dismissals, or defensive equivo-cations." She cites a number of reasons for the present silence about the discussion of community life and then raises six questions to begin the conversation: What are we talking about when we talk about community living? What is its theological basis? What can we say about a spirituality for community? What is the role of leadership in creating and sustaining community? What are some special challenges to living community life today? What can we do to renew our community life? I want to focus on the first question here since I believe that it is foundational to .further discussion. Without clear terminology, discussion can lose its way. Sister Doris offers this definition: "Community living is what happens when two or more people relate to one another in a significant, mutually beneficial, and ongoing way." She elaborates on what she means by each of these elements and then concludes that "we are tal~ng about good-faith efforts to live a principal value of religious life. With few excep-tions, it will include a common residence." Building the Structures I begin with Sister Doris's first question bechuse, while much of our rhetbric about ourselves refers to our life in community, I am not convinced that we have a commonly accepted definition. And our inability to arrive at such a definition has implications for ourselves and those who want to join us as sisters. A case in point: A front-page article in the Sunday New York Times (16 January 2000) discusses the efforts of the Sisters of Mercy of New York, New Jersey, and Brooklyn in using modern media tools (a Web site and an advertising campaign) to recruit a new generation of sisters. The article is illustrated with a graphic (recently sent to college campuses in poster form) that includes a catchy picture Revlew for Religious and caption. At the bottom are the words "Sisters of Mercy-- women religious who respond to God's call each day through ser-vice, prayer, and community life." This descriptive is similar to dozens of others used by con-gregations throughout the United States in recruitment efforts. My question now is: What do we mean when we promise new sis-ters community life, and what do they expect to receive when they come? Numbers of women interested in entering, and numbers of newer and not-so-new sisters as well, express a desire to live and pray and share household tasks and support for ministry with sis-ters under the same roof. That is their definition of "community." These women are neither statistically nor substantively insignifi-cant to the present and future of religious life. But it is clear that nowadays the definition of community is often being adapted to mean province life, congregational life, parish life, a circle of inti-mate friends, family members, prayer partners, support and prayer groups within congregations, coworkers, and national and inter-national groups. These broader (or narrower) definitions of com-munity are shared by other numbers of religious. This is a serious issue that has to be addressed. It is one more example of Putnam's finding that communal bonds that have united people to one another on the local level are disintegrating, even while new kinds of linkages are being established. This is not to say that people do not still espouse ideals. But, as Putnam found, they often do so in the abstract or at a distance, through periodic meet-ings, newsletters, or the Internet. But, we have to ask, is this level of engagement adequate to sustain a way of life and mission and to socialize the newer sisters, the majority of whom desire com-munal bonds within communities? This is also not to imply that the relationships with other groups are not important to and essen-tial for life and mission. But, as Putnam said about social con-nectedness, "the Environmental Defense Fund and a bowling league are just not in the same category." Similarly, a group of friends that meets quarterly, a prayer group that meets monthly, and a support group that meets weekly are just not in the same category as a community that lives under the same roof and inter-acts daily. Another question, whether the daily interaction of the community is life-giving, or death-dealing, is an important one, but a different one. Often the two questions are conflated, thus bringing conversation about community to a dead halt. ~larch-April 2000 Johnson * Bowling Alone, Living Alone The work of sharply defining and rebuilding community is essential to the mission and future of apostolic religious life in the United States and other nations where religious life struggles to free itself from the hegemonic hold of middle-class values. This effort is as radical as previous clear and unequivocal claims that the preferential option for the poor means the materially poor. Because many people were willing to work to prevent the word poor from being stretched to meaninglessness and the resultant loss of its prophetic power, we now have a new generation of young Catholics in the United States who claim, in a survey our research team recently conducted, that concern for the poor and the belief that God is present in a special way in the poor are essential dimensions of the Catholic faith (Dinges et al., p. 13). That work, of almost three decades ago, toward a clear and unequivocal def-inition of "the poor" has galvanized energy and commitment to the poor today, especially on the part of the young. In sociology there are dozens of uses for the term community. M1 members of the church, whether single or married, clergy or religious, find themselves embedded in all kinds of groups-fami-lies and parishes and prayer, work, neighborhood, ethnic, national, and international or global groups--which they sometimes describe as their "community." Those social networks will only increase and multiply in the years ahead as technology becomes even more sophisticated. The time seems to be right, especially in the midst of conversations about new forms of religious life, for a case to be made by those who believe that local community life with strong communal bonds is fundamental, not incidental, to apostolic religious life and its mission. This need becomes more acute in light of data given below, data I collected recently in my national study (funded by Lilly Endowment) of women's institutes in the United States. (The .publication of the data from the entire study is forthcoming.) Gathering data from apostolic, monastic, and evangelical orders, the survey was responded to by 70 percent of the women's institutes, institutes that represent 84 percent of the sisters in the United State~. The survey indicates that there are 18,052 com-munities (local houses). The vast majority are apostolic commu-nities. The unit of analysis here is the community, the local house. The table reads as follows: 49 percent of the religious houses in the United States have one sister residing in them, 20 percent of the houses have two sisters, and 9 percent have three sisters; 2 percent Review for Religious of the houses have more than 20 sisters residing in them. Community Size Percentage of houses Number of sisters 49 One 20 Two 9 Three 7 Four 4 Five 6 6-10 2 11-15 1 16-20 2 Over 20 Do these data surprise you? What explains them? How does your congregation compare? What has been lost and gained in this new configuration of houses? Surveying the sisters who entered religious life from 1966 to 1998--the post-Vatican II entrants, not a statistically or substan-tively insignificant generation--I asked the following questions. If you had your preference right now, with whom would you prefer to live? No one 8.8 percent An ecumenical group 0.7 percent An interfaith group 0.4 percent Married couple(s) 0.1 percent Single lay person(s) 0.9 percent Men and women religious 3.8 percent Sisters of my own institute 64.1 percent Children 0.2 percent Teens/young adults 0.1 percent Family members 0.3 percent Intercongregationally - 5.3 percent Combination of my sisters and one of the above 15.2 percent If you bad your preference right now, with how many sisters would you prefer to live? With none 11 percent With one other sister 14 percent With two other sisters 12 percent In a group of 4-7 sisters 45 percent In a group of 8-10 sisters 6 percent In a group of 11-15 sisters 2 percent In a group of 16-20 sisters 4 percent In a group of more than 20 sisters : 6 percent March-April 2000 ~obnson ¯ Bowling Alone, Living Alone Which of these data surprise you? What might explain these data? What further discussions do we need to have in light of these data? How do these issues of community relate to mission? What place does community hold in the life of apostolic congregations? Living in Community In light of Putnam's data, it seems that the creation of com-munal bonds is truly countercultural; that is, it goes against the prevailing value of social disconnectedness and weak, superficial, or nonexistent bonds among people and groups on the local level in the wider society. Countercultural living is one of the hallmarks of religious life. Can these issues be addressed in this light? One challenge to the conversation has to do with the social and communal contexts in which we live. The vows are not only lived within a wider society, marked by looser communal bonds and a religious life characterized by primarily monadic, dyadic, and triadic configurations. The vows are also lived against a hege-monic middle-class culture in which individualism, privatism, and materialism are cornerstones. Another challenge is the personal. Some sisters have had to move into various communal arrangements over the years because of ministry. But sometimes ministry concerns can serve to eclipse .any conversation about community. Some sisters have not been community builders or sustainers in the past. Can these issues be revisited again at this new moment? The challenge is compounded by the fact that many sisters holding key positions in the min-istries of leadership, formation work, vocation work, academia, pastoral work and counseling, national conference work, parish and diocesan work, congregational service, and so forth live alone. Can we be certain to include them in this conversation, even if we have sometimes avoided this issue altogether because they are our friends? Sometimes, when people do live with others, there seems to be a sense that, because of their work, the fewer persons living in the house, the better. Greater numbers of people are seen as deen-ergizing people for mission rather than energizing them. One hears gasps, even groans, when someone says that she lives with several sisters. Memories of the past rise up and seem to choke any attempt to talk about living with more than two other people, an arr.angement that might better accommodate needs of miriistry Review for Religious and hospitality, congregational responsibilities, household tasks, and the maintaining of "breathing room." Can we get to this level in the conversation? The inability to discuss some of these issues is all the more .troubling given the fact that the Catholic Church in the United States continues to grow. It now stands at 62 million people, the largest religious body in the nation, with 20 million of its members in their 20s and 30s. It is paradoxical that, as the church grows, the size of religious houses shrinks. At the same time, vocation and formation personnel continue to plead for more space for possible aspirants and newer sisters. Celibacy in Culture It is against the backdrop of these social and communal con-siderations that I present a brief overview of recent studies in human sexuality. The intended and unintended consequences of uncoupling the vows from community living (a phenomenon now several decades old) need, I' am convinced, to be analyzed regard-ing the mutual relationship each of the three vows has with com-munity. That is, how does celibacy shape community and community shape celibacy? How does poverty shape community and community shape poverty? And so forth. For the purposes of this symposium, we shall focus on celibacy. The studies in human sexuality point to new possibilities for the meaning of this vow: that, together with community, it can provide a radical gospel-based witness to countercultural values. Groups who live this vow well, sharing together the depth of a nongenitally expressed intimacy, give witness to one of the deep-est yearnings of this culture. The celibacy of a group gives proof to the whole society that its yearnings for intimacy can be ful-filled, that it is possible to love deeply and celibately and to do so together, without harsh lonliness. Celibate groups witness to the fact that the journey does not have to be made in isolation, that even this seemingly lonely vow is to be shared. Communities with strong communal bonds and deep celibate love witness also to a love that can cross the seemingly uncrossable social lines of gen-eration, race, and social class, to name just three. It is especially to the young that we must go with this news since they are the objects of so much manipulation about whom to love and how to love. Some of them say that because of this they are afraid to love. We, March-April 2000 127 - Johnson ¯ Bowling Alone, Living Alone whose public identities are so clearly tied to a unique way of liv-ing love, have a corporate responsibility to speak about what we have learned about love to a society paradoxically satiated by sex-ual excess and starved for intimacy. While no studies of human sexuality are perfect because of people's tendencies to overreport or underreport sexual practice, we can glean, from data collected in the following studies, some insights as to how to share the gift that has been given us. The first attempt at a systematic look at issues of human sex-uality was conducted by Alfred Kinsey. Considered a pioneer, Kinsey began his research in the 1930s, and his assertions stood for almost four decades. His work, however, was not without problems. He did not use a sample; he relied upon volunteers to serve as respondents, and so their responses were not representative of the population as a whole. In later years Masters and Johnson, too, used volunteers, involving their work in the same difficulty of being nongeneralizable. Nongeneralizable work can, however, provide important insights on other levels. Sociologist Lillian Rubin, in the United States in the late 1980s, interviewed a thou-sand people between the ages of thirteen and forty-eight about their sexual practices. One significant finding was that sexual activ-ity begins early among today's teens and that teen sexual practices are similar to those of adults. The National Health and Social Life Survey (NHSLS) of the 1990s was the first national scientific study of sexual practices. Rather than enlisting volunteers, it used probability sampling to find its respondents. A thumbnail sketch of some of the findings follows. First, there has been and increase in the level of pre-marital sex, especially among women. Over 95 percent of U.S. men and women getting married ~oday have been sexually active before marriage. One in five women have reported being forced to perform sexual acts against their will. The perpetrator was often known by the women; sometimes it was someone they loved, including their own husbands. On the other hand, only 3 percent of men reported that they had forced women to perform sexual acts. The researchers, struck by the gender gap, hypothesized' that the gap was due not only to underreporting by the men but also to their failure to recognize their behavior as coercive. The survey also found that 2.8 percent of men and 1.4 percent of women identified themselves as gay, lesbian, or bisexual. This Review for Religious stands in contradiction to the Kinsey report of 1948, wherein 10 percent of the population was estimated to be homosexual. Groups challenged the NHSLS findings, arguing that the percentages are too small. The research team responded by saying that, although larger percentages of gays, lesbians, and bisexuals are found in urban areas and in other enclaves in the United States, the survey findings reflect national, not local or regional, reality. The researchers analyzed their data according to religion and level of education. The Catholic data here indicate that the median number of sex partners since age eighteen was three. Thirteen percent of the Catholics had no sex part-ners in the previous year, 72 percent had one sex partner, 13 percent had 2 to 4 sex partners, and 3 percent had 5 or more sex partners. Which of the above findings surprise you? Which do not? How can discus-sions about sexuality improve our rela-tionship with and commitment to all of the people of God? Beyond these questions, it seems to me that further discussion on living the vows in community might be helped by the following questions: ¯ In light of the studies on human sexu-ality, how do we talk about celibacy and how do we support celibacy? ¯ What kind of norms and structures are in place in those communities which exhibit strong communal bonds? ¯ In those communities, how are the following values manifest: personal and communal prayer? celebration and mealtimes? ecological sensi-tivity? hospitality? concern for social justice and the poor? a sim-ple lifestyle? loving support? trust and joy? concern for the ministry and apostolic call of each sister~ fidelity to the call of the wider congregation and to the people of God? ¯ What are the forces, besides ministry or mission, that have pushed some people to live alone or live with their best friend? ¯ How can we resolve issues about community of the past so that we can move toward envision.ing community for the present and future? ¯ How can we unite our efforts to build strong commu-nities and to learn how to live together with the efforts of other groups, especially couples and families, who are also trying to How can discussions about sexuality improve our relationship with and commitment to all of the people of God? 129 March-April 2000 Johnson ¯ Bowling Alone, Living Alone r learn how to live together, to resolve conflicts peacefully, and to enjoy life together? ¯ How can we unite our efforts to balance ministry and community with the efforts of so many in the soci-ety who yearn for a healthier balance of work and family life? These conversations may not be easy becatise they will require crossing a major, though subtle, divide between those who see liv-ing in community as essential and those who see it as incidental. By not engaging in these conversations, however, we uninten-tionally contribute to negative effects on recruitment, retention, and mission. In the midst of wide-ranging and sometimes obfus-cating discussions on new forms of religious life, the voices of those who are committed to the radical gospel-values contained in the vowed apostolic life as it is lived in community have been eerily silent. Perhaps the time has come for many more sisters to break the taboo. References Dinges, William, Dean R. Hoge, Mary Johnson, and Juan L. Gonzalez Jr. "A Faith Loosely Held: The Institutional Allegiance of Young Catholics." Commonweal, 17 July 1998, 13-18. Gotternoeller, Doris, RSM. "Community Living: Beginning the Conversation." Review for Religious 58, no. 2 (March-April 1999): 137-149. Heller, Scott. "Harvard Professor Examines America's Fading Sense of Community." Chronicle of Higher Education, 1 March 1996, A10. Putnam, Robert D. "Bowling Alone: America's Declining Social Capital." Journal of Democracy 6, no. 1 (January 1995): 65-78. Many foreign missionaries depend upon people like you who donate subscriptions for them to Review for Religious. To start a subscription for a deserving missionary, please send $24 to: Review for Religious ¯ 3601 Lindell Blvd. ¯ St. Louis, MO 63108 To pay by credit card, phone: 314-977-7363. Review for Religious KEITH CLARK Celibate Life Offers Insights poerhaps the most countercultural statement that will come ut of this conference is its title. This may be the only gath-ering that states boldly that we live in a "sexually confused cul-ture." My experience of the past twenty years suggests that an ever increasing number of people with backgrounds in an ever widen-ing array of disciplines have attempted to pronounce the last word in just about all areas of human sexuality. We sit here and suggest that our culture is sexually confused. Audacious! I have no "last word" to offer on the topic. The most recent word I have spoken to myself is this: I want to write to the Holy Father and ask him to change the discipline of mandatory celibacy as a prerequisite for presbyteral ordination in the Roman Church. My reason is this: The witness of a celibate life well lived is thor-oughly obscured in our society, in our church, by the assumption on the part of most that those who are committed to a celibate life have made the commitment reluctantly in order to achieve the status of ordination. Since ordination does not have that much status in the eyes of most people, there is little impetus to con-sider seriously either a celibate lifestyle or ordination. The thou-sands of women and men religious who are committed to a celibate life are somehow lumped with those who are assumed to be reluc-tant celibates for the sake of some other pursuit. Keith Clark OFMCap presented this paper at a symposium titled "Celibate Chastity: God's Invitation to Love in a Sexually Confused Culture," held in October 1999 at the Jesuit Center for Spiritual Growth in Wernersville, Pennsylvania. His address is St. Lawrence Friary; 301 Church Street; Mount Calvary, Wisconsin 53057. March-April 2000 Clark ¯ Celibate Life Offers Insights I would make my request of the Holy Father not because I think celibacy has no relevance to our culture, but rather so that the celibate life well lived will better communicate to our culture what our culture so desperately needs to understand. A celibate life well lived can communicate to our culture a powerful message about the nature and meaning of human sexu-ality, the unique nature of Christian marriage, and the motivation for the church's ministry. In order to live a celibate life well, a priest or religious must engage in prayer and ministry in a way that fosters that life. These are the points I intend to develop. The Nature and Meaning of Human Sexuality To understand the nature of human sexuality, we have to go beyond exclusive concentration on the study of genetic markers, synapses in the brain, and the other fascinations of scientific explo-ration in order to understand how human beings are moved to come together in a sexual encounter and commitment. My experience suggests that I am sexual on three levels. First, I know myself to be sexual on the biological level. I have a biolog-ical sexual apparatus which works. It is entirely instinctual. And ir works no matter how I understand or misunderstand it. My bio-logical sexual apparatus is clearly designed to bring me together with a female member of my species for the purpose of making other human beings. (See the Nova series program The Miracle of Life.) The impetus I receive from my biological level to come together with another human being is pleasure. Genital sexual activity is pleasurable. I identify this impetus as my biological sex-ual urge. It can be, and is, the subject of scientific inquiry. I know myself to be sexual on the biopsychological level. In most instances, this is experienced as being sexual in an emotional way. It is that amazing level of the human being which allows one's body to affect one's psyche, and one's psyche to affect one's body. The blush in the cheeks in response to embarrassment in one's psyche is possible because of our biopsychological makeup: In terms of my sexuality, the biopsychological level is that in me which allows some things to have sexual significance for me and which, therefore, stir my biological sexual apparatus. This is the seat of romantic interest. This level of sexuality is both instinc-tual and learned. I am born with the capacity to recognize some things as having sexual significance, and I learn some things that Review for Religious have sexual significance for me. I learn these things, not because somebody sits me down and talks to me, but because of the "minute displays of emotion" (Erik Erikson) which I pick up from my sur-roundings. What has sexual significance varies from one culture to another. (See the movie Walkabout.) The impetus I receive from my biopsychological level to come together with other human beings is emotional fascination. Romantic sexual activity is exciting. I iden-tify this impetus as my biopsychological sexual drive. It can be, and is, the subject of scientific inquiry, especially today, since this level includes one's sexual orientation. Most discussions of human sexuality stop after genital sexual urges and romantic sexual drives have been spoken about. These are the levels we humans share with the higher forms of animal life. Whatever else is said about human sexuality is frequently thought to be the in the realm of religionists and ethicists, taking the form of advice and instruction on how to ride the beast which has been described in considering the biological and biopsychological levels. But, even in the higher forms of animal life, there is another level: the level of sexual need. In the animal world, the sexual need is that the species continue. This sexual need instinctually regulates or moderates the activity of the urges and drives. The biological urges and the biopsychological drives of male dogs are activated only when the need of the species can be met, when there is in the vicinity a female dog in heat. It is filling this sexual need that gives meaning to all the sexual activity. At the level of sexual need, we human beings differ from the higher forms of animal life in two ways. First, we are spiritual beings, and our personal needs are not entirely subjugated to the needs of the species. We have also a personal sexual need, that is, our need for intimacy with other human beings. Second, in human beings the sexual need for the species and the personal sexual need for intimacy do not instinctually moderate our sexual urges and drives. Because we are persons (spiritual), we have an intellect and will. We must moderate our sexual urges and drives by insight and freedom, or they will not be moderated. Because the activity of our biological urges and our biopsy-chological drives is not instinctually moderated, human beings can engage in genital and romantic pursuits without any reference to the personal need for intimacy or the need of the species to con-tinue. Thus, people have invented contraception and abortion, which divorce sexual activity from the need of the species, and March-April 2000 Clark ¯ Celibate Life Offers Insights have invented free love and sexual promiscuity as well, which divorce sexual activity from the personal need for intimacy. The gratification of people's sexual urges and drives is accepted as ade-quate meaning for sexuality. "If it feels good, do it." Urges and drives impel people to behave in ways that will fill their sense of need. If the gratification of their sexual urges and drives alone brought sexual fulfillment, ours would be the most sexually fulfilled culture in the world. In fact, human sexual activ-ity can find its meaning only in the filling of the human sexual need for intimacy. Intimacy is the "simultaneous fusing and coun-terpointing of personalities" (Erikson). It is spirit touching spirit. It is allowed to arise in human life through the dynamics of self-awareness, self-disclosure, and listening in prayer. Among the ways those dynamics can be expressed are genital and romantic pur-suits. But, among married, single, and celibate people, intimacy can arise without genital and romantic pursuits. A celibate life well lived reveals this meaning of human sexu-ality. Celibacy is not merely abstinence from genital and romantic pursuits; that by itself will not lead to personal sexual fulfillment in intimacy. A celibate life well lived is the pursuit of intimacy, sex-ual fulfillment, in ways which do not include romantic and geni-tal pursuits. It is a way of loving people, not because I am urged or driven to do so because they have sexual significance to me, but because they are deserving of love whether they appeal to me or not. The celibate man or woman stands as a support to spouses in their pursuit of intimacy, whether at the moment the spouses are romantically driven or genitally urged or not. The celibate woman or man stands as a support to all people in their pursuit of con-nectedness with other human beings for reasons quite distinct from their attractiveness to us. The Unique Nature of Christian Marriage Although a celibate commitment is most often spoken of as a distinct contrast to married life, the two states of life are intimately related within the believing Christian community. The marriage of Christians is different from the way other people marry. Christian marriage is a sacrament because it is a vis-ible sign of what cannot be seen. Christian marriage is not merely a response to the genital and romantic feelings the spouses have for each other. The commitment of spouses to each other is a com- Review for Religious mitment to be there for each other for life, no matter what. It is a sign of how fully Christ has taken us all to himself. A celibate commitment is not a sacrament: it points to some-thing that can be seen, but might not be recognized for what it is. The celibate commitment points to what is unique in the com-mitment of Christian married couples. The committed celibate within the believing community asks all people to recognize the unique basis for Christian marriage. The Motivation of the Church's Ministry in the World A committed celibate life is a lifestyle, not a ministry. That lifestyle, however, points to that which is the basis of all church ministry. The church's ministry is caring for one another within the community and taking care of our world. It is based on the min-istry of Jesus, who said, "I have come, not to be served, but to serve." Church ministry to its members and to the rest of the world is not based on the driven components of human love, nor is it merely philanthropy called for by the needs people have. It is based on Jesus' commandment to love one another as he loved us. Again, the committed celibate life points to something that can be seen (the ministry), but might not be recognized for what it is. There is, accordingly, an argument from "fittingness" to be made for a celibate commitment in the ordained ministers who preside at our Eucharists and who order the church's ministry. A church might well want to select those who will lead and order our ministry from the ranks of those who say by their lifestyle, and not just their words and actions, that ministry is about loving people for reasons other than their attractiveness to us. Prayer and Ministry, the Sources of Strength for Celibate Living The great fear ] hear from young people is that a committed celibate life would be a lonely life, while marriage is a life filled with intimacy. I think that, in general, human lives are neither lonely nor intimate. Life has lonely moments and intimate moments. Married people stand ready to enter fully and vulnera-bly life's intimate moments, and to find God there concretely. Celibate people stand ready to enter fully and vulnerably life's lonely moments, and to find God there concretely. March-April 2000 . !36- ! Clark * Celibate Life Offers Insights Let me share with you my entering a lonely moment and find-ing God concretely. I was sitting in my office in Milwaukee, prepar-ing a continuing-education report for the provincial council. I began to daydream: I was before that council, not to give a report, but to receive a new assignment. I was being congratulated on my performance in the job I was leaving, and then the provincial asked me what job I would like to do next. I said, "I really don't care. But please, gentlemen, give me a job I can do well that will have some significance in your eyes." The daydream faded, and I sat at my desk pondering what I had heard myself say to the provinci.al council. I was not pleased with what I recognized. What I had said seemed rather mean and cheap. I wondered if the approval of others might be what moti-vated much of my behavior, or all of it! I could feel myself blush at this bit of self-awareness. I was surprised at myself, and I was having a difficult time accepting myself as I now knew myself to be. I felt very fragile. But I stayed with this line of thought and emo-tion, and seemed to reach an even greater depth, where I inwardly smiled sheepishly while disclosing to God who and how I was. At that depth I realized that God was not surprised at my motiva-tion. God had known it all along. It was news only to me! And I realized that God was not having a difficult time accepting me. God had for years accepted me as I was. There was a knock at my office door. I said, "Come in." It was Jeannie, supposedly my secretary, but really the one who runs the office. She was incredibly efficient and competent. I looked at her and, for the first time, wondered whether she sometimes felt as fragile as I did. If she did, I was much more open to accept-ing her that way. I was able to connect with her more intimately than I could have before. It was as if, with the mask of my own self-sufficiency stripped away, I could see beyond the efficiency (and self-sufficiency?) of another and get a glimpse of the perhaps fragile human being who lived there. It is not only this kind of self-awareness, self-disclosure, and listening in prayer that can bring a person to a moment of intimacy with God; so can ministry. Committed celibate persons can have as many moments of intimacy in their life as any married or single people can. There remains, however, a crack in the sidewalk that celibate people might trip on. I learned about this while visiting a couple to give them a chance to talk about a Capuchin they knew and loved who Review for Religious had suddenlY left the community with the intention to marry a young woman from town. As we were preparing to have a drink at their kitchen table, Don said, "I think you and my wife ought to go sit on the porch swing and talk for a while." So we did. Mary and I had talked for a short while about Ralph's departure when she said suddenly, "You don't belong to anybody, Keith Clark, and you never should! Ralph used to belong to all of us, but now he belongs to Jennifer." I thought often about Mary's observation, and I realized that the human desire to belong uniquely to another human being is a desire which will not be fulfilled in my life. About me no one will ever say "my husband" or "my father." And even if they say "my priest" or "my Capuchin," it does not ring true. I will never belong uniquely to any human being. And this is a void where I might fall. I need to fill ~hat void by developing my sense of belong-ing uniquely to God. I find I do this most readily in ministry. I learned a lesson from the full-sized red Hawthorne bicycle that my father gave me right after World War II ended. The bicycle was too large for me. My legs were too short for my feet to reach the pedals. My father put wooden blocks on both sides of the pedals, which allowed me to reach them. Even at the young age of six or seven, I knew that to have a new bicycle was very exceptional. The "war effort" had taken most of the steel available in the nation, and production of peacetime products like bicycles was just getting underway. I knew, too, that I was uniquely the object of my father's love. He did not buy other people a bicycle; other fathers in the neigh-borhood were not buying bicycles for their children. This gift from my father was unique. It took a few lessons from my father to get me up and pedal-ing. He would run alongside me, holding on to the back of the bicycle seat until I had gotten up enough speed to keep the bicy-cle from falling over. Eventually I mastered it. The bicycle stood up well to my use and occasional abuse of it. It lasted well into my newspaper-carrier days, when we added a large basket over the front wheel. I have thought of that red bike often. It taught me a lesson about gifts and how they are to be used and enjoyed. If I had let A committed celibate life is a lifestyle, not a ministry. 137 March-April 2000 Clark ¯ Celibate Life Offers Imigbts I used to think that God gave me gifts so I could do things for other people. that bicycle stand on the front porch to be admired but not used, I do not think I would have made my father very happy. If I had waited until I had a paper route before I used it, I think my father would have been disappointed. Even telling him over and over how much I loved the bicycle and how grateful I was would, I am sure, not have been enough to please him. He gave me the bicy-cle to use and to enjoy. It was a long time before I understood that the gifts I receive from God are much like the bicycle I received from my father. I used to think that God gave me gifts so I could do things for other people. I missed the fact that my gifts are unique and that they are a sign of God's unique love for me. For a long time I was afraid to enjoy using them. Now I allow myself to enjoy using my gifts. I can listen to people and can understand a lot of what they tell me. Sometimes I can even say the needed word, the right word, in response to them. It is a gift from God. Sometimes a seminary student coming to me for spiritual direction feels much better after we have talked. When he leaves my office, I realize that I was able to hear and understand him because of the skills and talents God has given me through my life's experiences. I know that no one else could have done for that student exactly what I did. Some people could have done more than I did; oth-ers could have done something different but equally helpful. But no one could have done just what I did. I sit back and enjoy what I have just done. Then I tell God, "Thank you," knowing I am loved uniquely. Culture and Counterculture These things could be more easily understood and more inte-grally and effectively practiced if we lived in a world of real mean-ing. Until such time as our culture moves into that real world, we continue to live our lives of celibate commitment as a "value radi-ation center" (Van Kaam) so that the values of the real world do not become completely obscured by the understandings and practices of the less-than-real world in which we and others unavoidably continue to live. Review for Religious DAVID L. FLEMING Discerning Our Celibate Way in Our Culture In this third presentation of the 1999 Wernersville symposium, want to gather together the themes of the two previous pre-sentations and then point out the work ahead of us. The topic I have been given has three clear parts, from the words contempo-rary culture, celibates, and discern. Our two previous presentations have clarified our understanding of the first two terms, culture and celibates. Let me highlight several points. Mary Johnson SNDdeN has given us a snapshot picture of our culture and its attitude toward chastity. She began by pointing out difficulties in making an assessment. We, along with other peo-ple, may be overly impressed by flurries of sound-bite judgments proffered by the media or by generalizations stated by pulpit ora-tors. "All college-age students do . " "In our country everyone. ¯." Trying to go beyond impressions towards what we call factual information, we find some security in statistics and in popular polls. But, even with a carefully constructed statistical study, there remains the difficulty of overreporting or underreporting, espe-cially if the issue is a delicate one, such as sexuality and sexual behavior. For example, when reporting sexual mores, it seems that men tend to exaggerate their sexual knowledge or activity because of a macho stance, and that women tend to be reticent about sex-ual activity because of fear, shame, or a sense of propriety. Johnson stressed that there have been three significant statis-tical studies Of sexuality and sexual behavior in the United States: David L. Fleming SJ is editor of this journal. March-dlrri12000 . Fleming ¯ Discerning Our Celibate Way the Kinsey studies in the 1950s, a much smaller but somewhat more sophisticated study at the beginning of the 1990s, and the apparently best-balanced report from the mid 1990s. From these reports we learn something about behavior patterns in our times. When certain reported behaviors surprise or shock our own sense of morality and that of our church, we must be careful that our first response is not to deny the evidence. Once we take note of that caution, what might we observe about the value and living of celibate chastity as reported in our contemporary culture? In the current U.S. culture, we have widespread evidence that sexual activity is no longer considered to be restricted to marriage. Because of the easy avail~ibility of contraceptive pills and condoms, sexual activity is no longer tied to the possibility of pregnancy; rather, it is considered just one more among desirable and plea-surable human activities. A more frightening result of this atti-tude equating sexual activity with recreational pleasure is the easy and frequent acceptance of abortion. We are not surprised that in the reporting of behaviors we note a true gender gap. Men readily report that the woman is a consensual partner, whereas women indicate that they feel pres-sured or coerced by the male. Statistics, then, provide evidence of a gender gap, especially in reading the other sex's behavior signals. In our culture there is a great deal of confusion around the terms intimacy and sexuality. Often the two are identified. But sex-uality can be acted out with little sense of intimacy. Intimacy, on the other hand, does not need to be expressed sexually. Young peo-ple, especially, are looking for intimacy and use sexuality as its mistaken route. Studies give evidence of this behavior pattern. What does celibacy or celibate chastity mean to people in our U.S. culture? It is evident that the celibate vocation is not esteemed or looked upon as a kind of ideal. Rather, in our times, it more readily signifies, especially for large numbers of young adults, sexual dysfunction or pedophiliac tendencies or stunted personality growth. We must be aware, then, that our contem-porary culture has little regard for chastity or celibacy. Its sign value has to be significantly rethought and expressed anew in order to be seen and understood for what it is and what we who live it want it to be. In his turn, Keith Clark OFMCap presented a contemporary picture of the meaning and living of chastity and celibacy. Chastity is the pursuit of consistent behaviors--for marriage, one set of Review for Religious behaviors, and for those professing celibate chastity, another set of behaviors. We need to look at the sexual makeup of the animal species, acknowledge the commonalities we have as human beings, and then carefully pay attention to how we humans go beyond the reproductive drive and mating seasons common to the animal species. We realize our human need for insight into sexual behav-ior and for our exercise of freedom in regard to it. Once again we note that there is the human need for intimacy and that this is not identical with genital activity. Clark stated clearly his notion of celibacy. "A celibate life well lived is the pursuit of intimacy, sexual fulfillment, in ways which do not include romantic and genital pur-suits." Celibacy as a Christian vocation means that we pursue a way of loving people, not because we are so urged or driven, but because people are deserv-ing of love. They are children of God. Both presentations stressed the importance of "norms" for appropriate behaviors in living celibate chastity in a community or group lifestyle. Cultures as large as an ethnic group and as small as a particular religious congregation have developed their own parameters for acceptable behaviors in connection with the affectio~is. These cultures get expressed in norms that guide the consistent behavior of group members. Members of a group have a responsibility to observe the norms expected of participants. We who live celibate lives as members of a priestly order or as members of a religious congregation need to have norms that are agreed as guides for the behavior expected of the whole group. After looking at our contemporary culture with the help of Johnson and getting, with Clark's guidance, a sense of a con-temporary expression of lived celibate chastity, we focus now on the word discern, which is meant to be the connective between the two terms. How do we discern the living of celibate chastity in our culture? What is it to discern? I believe that celibacy, properly under-stood, has a necessary connection with the ability to discern. Celibacy or celibate chastity understood in a Christian manner is a way of loving, a way of relating to others. It is not enough to Members of a group have a responsibility to observe the norms expected of participants. March~April 2000 Fleming ¯ Discerning Our Celibate Way say that celibacy means not being married or that to be chaste means just not engaging in or enjoying sexual activity. It is not enough to equate celibacy with a certain ritual purity. To limit our chastity ideal to these kinds of description fixes us in a pagan or pre-Christian understanding. Sad to say, many older explanations about the vow of chastity, and some contemporary ones too, could well have been written by a good pagan. Celibacy cannot be ade-quately defined in terms of what it is not or what it lacks. Celibacy is understood and lived in terms of what it is and does. Celibate chastity describes a way of loving, loving the way that Jesus loved. Because celibacy is a way of loving, there is a true sense that we are always growing in our life of loving celibately. We cannot lose our chastity; we never "had" it so that we could lose it. We are always growing into being a chaste lover, a lover like Christ. We grow in our loving chastely, or we find ourself becoming less of a chaste lover. We make choices of behaviors that enhance our life-direction (which is meant to be a growing more and more to love as Jesus loves), or we find ourself slipping (all too humanly, through selfishness or focus on self) into more and more limited ways of loving. We do not need to be a loving person to make a decision. Individualism rampant in U.S. culture is the seedbed of a lot of decision making. Even in religious life we sometimes hear glowing reports about the new growth in our understanding of the vow of obedience based on human decision making. We say that we have moved from a kind of infantile dependence to a relationship where authority's only role is to support the individual's decision. Yet, if we understood how obedience and chastity are intertwined, and that discernment is not possible where love is not involved, then we might not be so self-satisfied with our own share in the indi-vidualistic decision making often observable in religious life. Evaluated from a religious point of view, personal decision making is not deserving of praise if love of God has had no play in it. Discernment and obedience can be understood and practiced only by one who loves. Perhaps questions about authority/obedience are more about the love quality of religious life than about respon-sible decision making. When people make decisions about sexual activity, they can decide to use this person for their pleasure. They can decide that treating someone in this sex-object way is what pleases them. What they want to do and what feels good decides their choices in this Review for Religious typical American individualistic stance. People live as though they are the center of their world, and this stance acts as the foundation of their choices. In order to discern, however, we need to be a loving person, one who lives in an expansive (always open to other people's inter-ests) world. People who are caught up in an individualistic way of thinking and acting are incapable of making a discernment. Why? Because discernment is a sensitive listening to God speaking to us through interior movements, that is, feelings and inspirations. Discernment is a lover's instinct. Probably most of us have had the expe-rience of this kind of interior commu-nication between ourself and a close friend. No words are spoken, but a lot gets communicated. When persons are dear to us, we know what pleases them and what annoys them. We listen, not to any externally spoken words, but to the person, and we can respond instinctively--if we are people who love. ls this kind of sensitivity, so familiar to us in our human loves, possible between God and ourself?. In the Judeo-Christian tradition, it has always been recog-nized that discernment is a gifting of God. St. Paul identifies dis-cernment as a special gift to members of the Christian community through Christ's sending of the Spirit. A number of holy men and women have shared their insights into the gift of discernment, how to pray for it, how to grow as a discerning person, and how to make a decision-making process a true discernment. St. Ignatius Loyola especially is renowned for the practical application of dis-cernment procedures for an understanding of What spirit is mov-ing us and for a method of coming to a decision through such a discernment of spirits. Discernment is about making practical life-dealing decisions not just with prayerful prudence, but with our will attuned to the will of God our Father. We are trying to love the way Jesus loved. Jesus prayed a lot; he prayed in order to deepen his relationship with God and so to express his love. The dialogue of prayer is a dialogue of love. Prayer is not discernment, but without prayer there is no discernment. Why? Because discernment is a grace given to a lover. VCe see it clearly in Jesus. Discernment marks Jesus' choices. In the crisis moment in Gethsemane, Jesus in agony Discernment remains always a gift, a growing in a lover's sensitivity. 143- Marcia-April 2000 Fleming ¯ Discerning Our Celibate Way pours out his prayer and in love can say, "Not my will, but yours be done." One who loves has a sense of, a feel for, what pleases the one who is loved. To be a discerning person means that we must be a free person: free of self-will, free of prejudice, free of being locked into doing what is expected (to be accepted, to save face, and so on). We see this freedom in Jesus. Discernment remains always a gift, a growing in a lover's sensitivity, just as Jesus grew in his sen-sitivity to his Father's will up to the end: "Into your hands, I com-mend my spirit." In other words, we never just "have" discernment, as it were, as our possession. We need always to acknowledge dis-cernment as a dynamic grace or gift. As Jesus' special gifting of the Spirit to us, his followers, discernment is always to be rever-enced, esteemed, and lived in our choices. Discernment affects our living of celibate chastity on three levels: (1) the body or the physical, being at home with our sexual makeup; (2) the soul or the psychological, being at home with our affections; and (3) the spirit or the spiritual, being at home with God. Let me develop each of these levels. 1. As people who are trying to love as Jesus loves, we need to love our own incarnation, that is, we must love our own bodili-ness. Acceptance of our sexuality helps us to be like Jesus. For Jesus was sexual and celibate and a man who loved. Jesus is so much at home with his body that he keeps it with him forever. And that is his promise of resurrection for us. To be at home with our body, then, is a Christian attitude to grow in and to deepen. We make the choice to love the body that God gave us. In our culture we know how much we try to run from or deny the failings connected with bodiliness, for example, the whole process of aging. With a cul-ture that wallows in sexuality, especially its genital aspects, we may think that our countercultural stance should be to run from or deny our own sexuality in order to bd the good celibate. But our Christian viewpoint sees sexuality and the way it shapes our relat-ing and our loving, all our life long, as a gift of God to us. Living in gratitude for God's gift, we find that being at home with our own body is the only way for us to love as Jesus loves. 2. We celibates must also be at home with our affectivity. There is no such thing as loving in the abstract; we love the flesh-and- blood people that come into our lives. To love in general is not to love at all. Yet, when we try to love the people that God brings into our life, we find difficulties with the way they dress, the way they talk, even the way they sexually attract us or not. I have always Review for Religious admired the healthy quality of the bawdiness found in Chaucer or in Shakespeare as representative of the peoples of their times. We--especially people vowed to chastity--need to laugh at our affective responses sometimes so embarrassing to us and so little under our control. We may even be surprised at a sexual response we feel in prayer or even at communion time. This is the moment to recall that we are God's creation, enfleshed, with all its humor, distress, and bedazzlement. We thank him for being the ones in whom he delights. We need to give over anew the whole of our life to God and so not let our discerning focus get distracted on self. Always we as celibates--a unit of body, soul, and spirit--need to own and not to deny our affections. We must be in touch with how affective or not we are naturally, from family upbringing, community customs, and ethnic culture. Whatever the limits of what we have inherited, we--growing by the grace of our celibate calling as sensitive lovers--gradually learn how to make various appropriate adaptations. Does Jesus ever seem frozen in the face of others' affective love, whether expressed by Mary Magdalen or by the beloved disciple? Think of John lean-ing on Jesus' chest at the Last Supper or of Mary Magdalen's fierce bearhug in the resurrection garden scene. Growing always in a lover's sensitivity is especially to be valued by a vowed celibate who desires to relate affectively to all. Married couples teach each other how to make love all their lives long. We as celibates must keep our eyes on Jesus in order to keep growing in our way of loving. Our prayer should lead us deeply into the Gospels so that Jesus keeps teaching us how to love. Our being affective people, or not, affects our ministry. In fact, there is little exaggeration in saying that ministry without. affectivity is useless in terms of evangelization. We may be able to do "good things," but for what.purpose if we do not touch peo-ple with love from a God who is Love? 3. We Catholics are fortunate because we understand that God loves us in affective ways. Our Scriptures, our sacraments, our prayers speak out God's way of loving us in the most tender of human expressions. Even more, God loves us in intimate ways. This good news we bear in our very persons as loving celibates: We as celibates must keep our eyes on Jesus in order to keep growing in our way of loving. March-April 2000 Fleming * Discerning Our Celibate Way God wants to be intimate with us. Our spiritual life is a life of love, intimate love with God. Two examples from Scripture bring this fact home to us. I am indebted to the late Father Carroll Stuhmueller CP for his long-time insistence on the meaning of the Hebrew word rahamin. In the Old Testament, especially in the prophetic writings, God is often described in English translation as merciful, tender-hearted, or compassionate. These words attempt to signify the meaning of rabamin. The Hebrew word seems best understood in this way: the feeling that a mother has for the child in, and of, her womb. God wants us to know that the relationship he has to each of us is like the feeling a mother has for the child of her womb. What is this feeling? Is it pity or mercy? No, it is one of pride and 10ve for the child of the womb. That is how God feels towards us. God loves us and takes pride in us. We cannot deny the intimacy of this Hebrew word. That kind of intimacy God claims towards us. We celibates are meant to find a home in this love. In a more theological way I would like to reflect upon the word covenant. Perhaps we are familiar with the covenants of Middle Eastern people of whom the Israelites were a part. A covenant is an agreement between two parties (usually unequal), and the expectation involves certain ways of acting toward each. Covenant is a central theme of the relationship between God and his chosen people. The biblical covenant that God established was marked according to the Semitic cultural tradition by the ritual of killing an animal and sprinkling its blood upon the altar (rep-resenting God) and upon the Israelite p.eople. The blood was a symbol of life, not death; the sprinkling of blood on the altar and on the people signified the familial union. The action said: We share the same blood. When Jesus on the night before he died wanted to establish a new covenant, he retained the same symbol: blood. But it is his own blood that Jesus gives, his flesh for our food and his blood for our drink. This blood is life-giving and makes us who feed on his Body and his Blood belong to the same bloodline as God. Jesus could not make it any clearer that we truly are brothers and sisters to one another; we share the same blood, Jesus' blood, the blood of the Son of God. We call upon Jesus truly as our brother, and together with him we call God Abba-Father. The reality of this new covenant is an intimacy of unity, Jesus God bringing us into the very life of the Trinity. As celibates, day after day in our Review for Religious Eucharist we come forward with hands stretched our to receive and to be taken in by the most intimate love of God, a God embracing us into the divine life of love. What distinguishes us who are called to a life of celibate chastity? We are called to a special way of loving. When we celi-bates are truly at home with our bodies (with our sexuality), with our affections (with our soul), and with our spirit (God's Spirit, now ours), we are free to be the discerning people who, in a sex-ually confused culture, live God's invitation to celibate chastity peacefully, happily, and apostolically. The Silence That Is Not Silence at All Unobtrusive as dawn, the lake balances perfectly between East and West. An early hiker rounds the corner, headset clamped on. Juncoes tsk tsk and give way. Starlings catcall. Merganser, all white hood, skims a straight arrow line, alights with a velvet swoosh pursues prey through clear water soundless. Lichen stained alders circle the shore, haloed with smudges of alizarin catkins. Aments upon aments. A Lent retreatant, I come for the annual fast from stimulation, rededicate to silence or at least to the diminishment of stimulants. Make way for tumult. Here are the Big Ego geese. Indignant honking, they want to be noticed. Chest beating, a squall of identity. Hannah J. Main-van der Karnp March-April 2000 147 --- JUSTIN TAYLOR AND ALBERT DIIANNI What Is Religious Life's Purpose? For thirty-five years since Vatican Council II, we have constantly ?asked questions about identity: What does it mean to be a religious, a monk, a Dominican, a Jesuit, a Marist? It might then seem superfluous to ask about the purpose of religious life. But it is our conviction that pre-cisely this question must receive a more adequate answer before we can come to proper conclusions about how to structure our religious life and truly renew its spirit. The main goal of religious life is to place God at the center of our lives. That is the meaning of religious consecration, and it is best symbolized in the vow of chastity, in which we make a gift of our very hearts to God. Religious consecration is all about the service and worship of God, about affective and effective love of God for God's sake. Religious life is a way of being with ¯ God that takes the form of a gift and an act of worship. It evokes the image of St. Francis lying prostrate on the ground throughout the night calling out repeatedly, "My God and my all,." In other words, religious life needs to Justin Taylor SM, a Marist priest from New Zealand who resides at the Ecole Biblique in Jerusalem, does teaching and writing on biblical topics and on spirituality. Albert DiIanni SM wrote for us in 1993 and 1996; his address is Marist Vocation Office; 27 Isabella Street; Boston, Massachusetts 02116. Review for Religious be religious, and this means that it must be theocentric. Religion can be about many things, but first and foremost, as Hegel said, "religion is about God." This may seem to go without saying. But we are saying it and stressing it because we all tend to substitute something else for the love of God. Nothing else will do, not even love of neighbor. The question we ask is: Have we not, long before Vatican II and after it as well, tended to substitute--for a focus on the glory and love of God--either a personal ascetical spirituality or a social morality? We grant, of course, that both morality and asceticism find their place in religion, but we maintain, too, that religion cannot be totally or even primarily reduced to them. Could it be that this tendency to substitute something for religion--whether it be self-improvement or the improvement of other individuals, society, and the world--is what underlies the malaise we currently perceive in religious life? We stress that this problem does not arise out of Vatican II. It already existed before Vatican II and may have caused what the council had to say about religious life to be misunderstood. It is a problem that lies deeper than the distinction between traditional-ists and so-called "change-oriented" religious. Both of these groups, as we shall see, may have given way to the very same error. In her recent book The Fire in These Ashes, Joan Chittister insists that the sole purpose of religious life is "only to seek God" (p. 45). She writes: "We have too often been seduced., by other explanations for religious life, all of them valuable and all of them true to a certain degree. We have sought to be 'relevant.' We have set out to be 'incarnational.' . We have given ourselves untiringly to the 'option for the poor.' We have devoted our-selves to 'the transformation of social structures.' We have evan-gelized and renewed and revised and reformed until we dropped from exhaustion. And all of those commitments are good and necessary and worthy of attention. But, through it all, one thing and one thing only can sustain religious life, can nourish reli-gious life, can justify religious life: The religious must be the person who first and foremost, always and forever, in whatever circumstance, seeks God and God alone, seeks God and God alone in all of this confusion, in all of this uncertainty and, what-ever the situation, seeks God--and God alone." She concludes: "Otherwise, religious life is just one more social institution to be succeeded by social institutions after it, rather than centers March-April 2000 149 Taylor and Dilanni ¯ Reli~ous Life's Purpose of contemplation where, we can hope, the mind of God can touch the mind of humanity" (p. 47). "A center of contemplation where the mind of God can touch the mind of humanity"--is this not a beautiful definition of reli-gious life? For Joan Chittister, contemplation of God is the pri-mary center and focus of religious life. But she is not thinking of a selfish, isolated sort of contemplation cut off from society or the world. Rather, for her, contemplation of God has an effect upon the mind of humanity, changes it and urges it to become engaged in the task of approximating the kingdom of God on earth in works of peace and justice, especially in favor of the poor and the marginalized. This call to contemplation, which is now being stressed by many authors, indicates that the crisis of religious life is deeper than people think. It is rooted in a crisis of faith. By this we mean that there has been a change not only in the depth and intensity of our faith, but also in its actual content. And this is hardly new. It has been present in the church for a long time, as attested by Henri Bremond in his Histoire litteraire du sentiment religieux en France, a magisterial eleven-volume study of mysticism in France in the 17th century. Bremond did not write with a view to commenting on religious life in the 20th century, but his volumes are full of relevant insights. Bremond (an ex-Jesuit turned diocesan) keeps coming back to one particular issue: Why, throughout the period of which he writes, was the Jesuit mainstream in France especially, antimystical? Why, with the notable exception of Louis Lallemant and his school, did the Jesuits begin to focus their spirituality more and more away from God and more and more toward the human? In the course of his writing, Bremond suggests some more or less peripheral reasons, but in the end he expresses a suspicion that the Jesuits, even in the 17th century, were intuitively sensing a crisis of faith. They were sniffing the presence of an incipient atheism in their contemporaries and perhaps in their own hearts. They were beginning to fear, at least subconsciously, that the pure love of God as the chief reason for a devout life was not going to motivate people of their time and place much longer. This, suggests Bremond, is the reason why they felt the need to recommend prayer not so much as adoration and thanksgiving before God, but especially as a means of growth in virtue, a means to inoral and ascetical self-improvement, a way to ensure one's personal eternal salvation. Review for Religious It is clear that this crisis of faith is not restricted to the Society of Jesus in the time of which Bremond writes. The same crisis has continued in a perhaps even stronger fashion in the 20th century. Both before and after Vatican II, religious have tended to recom-mend religious life to the world--and perhaps to themselves--in terms of what it could "do for" themselves or for others. Religious life was considered legitimate and desirable because it was useful, however that usefulness might be conceived, whether in terms of a surer way for the individual to attain tleaven or in terms of a service to society. Both of these stances, however, place religion and religious life on a less-than- full theocentric plane. Viewed in this way, the crisis of faith did not begin in the post-Vatican II era. It was in full swing well before the 1960s, but at that time social and ecclesial structures and a gen-eral feeling of success (at something) kept people going. Once those supports were taken away or seri-ously weakened, its real proportions were revealed. It has been said that, before Vatican II, religious used to "skip the world" and focus too heavily on our individual other-worldly salvation. This is a legitimate criticism if properly understood. To the extent that there was overemphasis on our individ-ual otherworldly salvation, religious life was already ¯ anthropocentric or egocentric, and not theocentric. For a program of self-improvement, even in view of obtaining eternal life, is not specifically Christian, but broadly Stoic. The concentration on obtaining eternal life even became obsessive for a number of people, and priests in confessionals encountered peo-ple so absorbed in themselves and their salvation that they became paralyzed by scrupulosity. For this and for other reasons, an under-standable dissatisfaction set in with regard to a form of devout life whose focal point was one's own perfection. Unfortunately, however, the remedy that was often prescribed compounded the ailment. In line with the self-improvement ten-dencies, the constitutions of many religious congregations before Vatican II propounded a twofold goal for religious life: saving one's own soul and saving the souls of others. After Vatican II, the notion of salvation was expanded beyond an eschatological salvation to include also, and at times almost exclusively, the liberation of peo-ples or the social betterment of humankind. Neither of these This call to contemplation indicates that the crisis of religious life is deeper than people think. I51-- March-April 2000 Taylor and Dilanni ¯ Religious Life's Purpose focuses, however, whether on personal improvement and salva-tion or on social liberation, is properly religious in the sense of having to with the worship and love of God. Neither of them makes God the pivotal center of our lives. If this is true, where should we seek the remedy? If there has been a shift in our faith in this century and before, what then should be the content of our faith? We believe that the religious hunger is ultimately the hunger for transcendence or, more con-cretely, the hunger for God. It is a hunger which, in fact, is often felt most keenly by the poor. The world points to something beyond the world: its Author. Our first response to the world must be gratitude toward the author of that world--paying homage to God. Religious are called to be involved totally with God, to be bridges to others to enable them, not to negate this world, but to transcend it and reach God. The world is extremely important-- the Word became incarnate for the sake of the world--but in itself it is still not enough for us, us of the restless heart. In whatever manner we decide to refashion religious life, we must not lose this central insight, which is at the heart of the religious quest. The "kingdom of God" promoted by the Jesus of the synoptic Gospels certainly demands an effort on our part to improve the world, but it also involves a transcending of the world, and this transcen-dence will consist, as always, in union with God. In fact, without such a reference to the Transcendent, it is questionable whether an urgency to improve the world has sufficient meaning. Again, with Joan Chittister, "The religious must be the person who., seeks God, and God alone" and--we could add, with Vita consecrata (§3, §20)--helps other members of the church in their search for God. It is in this latter task of spurring others on to transcendence that some form of identifying religious garb has its importance. St. Thomas Aquinas asks why religious congregations are called "religious." Our reflections thus far have perhaps prepared us to understand and receive his answer: "Religion is the virtue by which we perform the service and worship of God. Hence, reli-gious are so called because they dedicate themselves totally to the service of God, as if offering God a whole-burnt sacrifice" (Summa theologiae, 2a-2ae, q. 186, a. 1). Here Thomas speaks of a "virtue of religion," a kind of habit. This habit of mind, heart, and action has to be part and parcel of every genuine approach to God, for it is basically about awe in the presence of the "tremendous and fas-cinating mystery." "This tremendous lover" is what Francis Review for Religious Thompson called Christ, and the adjective is striking. It refers to a lover who fills us not with fear but with awe. Our response to God is one of wonder, adoration, and gratitude in the face of a Love that bends down to us, a love that is gratuitous and that we did not merit. What makes religious life distinct from other forms of Christian life (granted that there is no complete cut-off, but many a gradation) is that it is a way of life which is organized and centered on the.service and worship and love of God and which would make no sense on any other terms. From a worldly point of view, it might even be called a useless life; it is worthless except to the eyes of faith. We believe, with Vita consecrata, that chastity is at the heart of the matter. Chastity is the baseline of religious consecration, not primarily a way of being freed for ministry, although it is also that. Through it we consecrate to God our hearts and our sexual-ity, our capacity to love and be loved, and our capacity for repro-ducing ourselves and so assuring a sort of afterlife. It is therefore the point at which the service and the love of God meet in the center of the consecrated person. Religion, as a virtue, is not the same as charity, so that serving and worshiping God are not specifically the same as loving God. But the two are very close, and both are needed. Without love, religion quickly becomes fanaticism; without awe before God, love can be too facile and presumptuous. In the golden age of French spirituality in the first half of the 17th century, the great masters differ a little on where they place the emphasis, St. Francis de Sales placing it on love and Pierre de B~rulle on religion. In any case, they agree that religious life is essentially theocentric. St. Thomas's "whole-burnt sacrifice" strikes the note of throwing all of oneself into a life given to God in a fire of generosity. Abandoning calculation and self-service, a person stakes all on the single-hearted quest of God, and God alone. That is a goal in the pursuit of which a life is well lived and the world well lost. The above remarks raise at least two questions about love of God which require some discussion. We are speaking of a "pure love of God." But is it possible to love God selflessly, for God alone, and not for ourselves? Not in the sense that I could leave myself totally out of any act of the will: whatever I will, I will also as my own good. But it is possible in the sense that there can be a degree of selfless love in an act of the will, and that this selfless love can grow in future acts. In praying I make all sorts of different March~April 2000 Taylor and Dilanni ¯ Religtous'ous L~Life's Purpose "acts," including petition for myself and others. But what makes prayer (any prayer) true prayer, and love of God true love, is that overriding everything else is the love of God for God's sake, the willing of God's good, and the ultimate submission of my will to God's. And that is "pure love." Note that this is not something rare and extraordinary. Selfless love is part of every authentic human love. It is part of the Lord's Prayer, where we say: "Hallowed be thy name, thy kingdom come, thy will be done." In any genuine human love, I will love the beloved without thinking of my own good and even, at times, to my apparent detriment. M1 lovers would deny the name of "love" to a mere desire to get their own satisfaction. In every true love there is selfless devotion toward the beloved, that is, "pure love," some-where. And selfless devotion, it seems, has always been the touch-stone of a religious life properly lived. The second question concerns the relation between the two commandments of love of God and love of neighbor. Above we wrote that not even love of the neighbor can be substituted for love of God. Love of the neighbor does not replace love of God; it does not even, strictly speaking, express love of God. God is to be loved for God's sake. On the other hand, love of the neighbor is the acid test of the genuineness of our love of God. St. John's for-mulation could not be bettered: "Those who say, 'I love God,' and hate their brothers or sisters, are liars; for those who do not love a brother or sister whom they have seen cannot love God whom they have not seen" (1 Jn 4:20 NRSV). To remove all excuse for illusion on this topic, the Letter of James (2:15-16 NRSV) affirms th~it a mere sentiment of goodwill is not enough: "If a brother or sister is naked and lacks daily food, and one of you says to them, 'Go in peace, keep warm, and eat your fill,' and yet you do not supply them their bodily needs, what is the good of that?" If love of the neighbor is not a substitute for love of God, the reverse is also true. Loving God does not give us an excuse for not loving our brothers and sisters, really and concretely. Christians are called to live for the glory of God and not pri-marily for their own good, not even for their own salvation here or in eternity. The emphasis has to be on the primacy of the love of God. The truth is, however, that the more genuinely we love God, the deeper and more effective will be our love of neighbor, especially the poor and the unloved. The great lovers of God--that is to say, the saints--have been those who have done. most in the Review for Religious way of love and service of their brothers and sisters. There is no risk that following the call to love God with all our heart, soul, and mind will distract us from serving others or from working for justice in the world. Rather, when we go to God, we find One who loves justice and who is on the side of the poor and the weak. This God demands that we too pursue justice and come to the aid of the needy. In loving God we go outside of ourselves in a radical way. We encounter the transcendent Being who loves the created world and invites us to become active within it. There is no competition between the two commandments of love, but rather reciprocity. If love of the neigh-bor is the acid test of love of God, love of God overflows into love of neigh-bor and makes it truly love. For jus-tice without love may quickly become tyranny, while mere "humanitarian-ism" may become bureaucratic, offi-cious, and quite unloving. On the other hand, love of God makes love of neighbor tenderhearted, generous, and selfless. For, in our living communion with God, we discover that God loves us all and that for this reason we must love others and strive to bring peace and justice into the world. What is.the upshot of all this? What does it mean in practical terms? If all this is true, it may mean that the ongoing renewal of religious life needs to be reviewed. It may mean that we must go back to the drawing board and ask ourselves whether we have made changes on the basis of an inadequate notion of the purpose of religious life. It may mean that, while many good things have occurred in terms of a structural renewal of our lives, the spiri-tual renewal is yet to begin--one that may cause us to take a sec-ond look at those structures. Our structures of prayer, our living of the vows, and our community life must be fashioned so that, primarily, they foster our love for God. To achieve this we must grapple with this question: .Are we perhaps in need of a shift in our faith, one that moves away from the many forms of anthro-pocentrism of the last few centuries, and centers religious life more directly on the pure love of God? Chastity is the point at which the service and the love of God meet in the center of the consecrated person. March-April 2000 KENNETH C. RUSSELL Must Hermits Work? Maust hermits work to earn their living? Must they leave side their regime of silence and prayer to earn money, even though this is a Catch-22 situation, with solitude calling them away from society and work drawing them back into it? By taking a job, manufacturing a product, or providing a service, they trou-ble themselves with any number of people so as to have enough income to get away from people and indulge their own hermit's desire to be alone and untroubled. Are they not then better off depending on some form of fixed income, on the largess of the religious congregations to which they may belong, or on the charity of the faithful? It would seem so. But is this kind of dependence legitimate? What does the his-tory of the eremitical life in the Western church say about this? How do the principal texts on the solitary life deal with the eco-nomic, psychological, and spiritual aspects of work? What features remain constant in the tradition? What shifts take place? In this brief overview, which makes no claim to be complete, we begin with the teachings of the pioneers in the Egyptian desert as these are recorded in the alphabetical collection of Sayings of the Desert Fathers and in John Cassian's Institutions and Conferences. We then turn our attention to a few representative medieval texts, primarily from the 12th century, a period marked by a widespread revival of the eremitical life. Kenneth C. Russell last wrote for us in November-December 1998. His address remains 40 Landry Street, Apt. 1505; Vanier, Ontario; t~6~ K1L 8K4 Canada. Review for Religious The Sayings of the Desert Fathers Although the classical picture of the hermits in the Egyptian desert as hardscrabble peasants used to a tough life has been chal-lenged of late, it seems clear that, whatever the truth about their social status and educational background, they earned their keep by the work of their hands. The Sayings tell us that the solitaries plaited ropes (Sayings 184, 39), made baskets (105, 1) and hired themselves out as laborers to bring in the harvest (82, 47; 191, 2).' At least one monk strung necklaces of small dried peas to pay for his food. We are told that Abba Serinus spent his time harvest-ing, sewing, and weaving (191, 2). The monks worked because they had to. They did not share the conviction of the excessively spiritual groups of the time that considered work to be below the dignity of those called to per-petual prayer. Several stories seem to satirize the "angelic" atti-tude of these Messalians, as they were called. One concerns Abba John the Dwarf, a prominent desert figure, who in his youth announced to his brother his intention of living a carefree life of ceaseless prayer like the angels who do no work. After a week he was back knocking on his brother's door, hungry and begging to be let in. When this brother, in no hurry to admit him, got around to answering the door, he told young John: "You are a man and you must once again work in order to eat" (73, 2). The same point is driven home in the story of a monk who, while visiting a small eremitical community, sees the brothers working hard and cautions their leader, Abba Silvanus, not to seek "the food which perishes" (John 6:27). Silvanus allows him to spend the day reading, but does not summon him to dinner. When the hungry monk asks why he was not called, the elder answers: "Because you are a spiritual man and do not need that kind of food. We, being carnal, want to eat, and that is why we work" (187, 5). In these words of practical economy, it is obvious that work not only feeds the monk but keeps him grounded in the real-ity of the world and human nature. The Egyptian hermits lived apart from society, but they were not disconnected from the larger world. A brother was advised by Abba Poemen to do some manual labor "so as to be able to give alms" (148, 69). This readiness "to work for charity's sake" (87, 4) also set the Egyptian monks apart from the Messalians or Euchites, who regarded themselves as the most fitting recipients of any handouts. March-April 2000, Russell * Must Hermits In one story some Euchite monks answer Abba Lucius's query about what kind of work they do by announcing, rather smugly it seems, that they do not touch manuhl labor, but obey Paul's instruc-tion to pray without ceasing. Lucius asks how perpetual their prayer can really be if they must interrupt it to eat or sleep. For his part he demonstrates that work and prayer are not incompatible and shows how his charity toward the poor fills the gaps in his own prayer schedule. "When I have spent the whole day working and praying, making thirteen pieces of money more or less, I put two pieces of money outside the door and I pay for my food with the rest of the money. He who takes the two pieces of money prays for me when I am eating and when I am sleeping" (102, 1).2 But work that enables a monk to support himself and make a contribution to the well-being of others can also prove a distraction. What is supposed to support the spiritual life can become an end in itself (64, 10). It can assume an importance it does not deserve (44, 1 I). This is surely why Abba Silvanus threatens to leave his little community when his disciples and some other brothers move the fence to enlarge the garden (188, 8). This story also implies that at some point work becomes a guarantee of security, which challenges the hermit's dependence on divine providence. Abba Serinus, who worked at a number of tasks, avoided this trap by insisting that "in all these employments, if the hand of God had not sustained me, I should not have been fed" (191, 2). In the same vein, Silvanus is confident that as long as he does his part God will provide (188, 9). Given the tendency of work to become a goal in itself, it is not surprising that when a monk asks Abba Biare what he must do to be saved, the elder advises him to reduce his appetite, dwell in his cell, and reduce his quota of manual work (37, 1). Any kind of work can upset a hermit's life if it assumes too great a place in it. But certain kinds of work were regarded as essentially distracting. Agriculture per se was considered an exte-riorizing activity that draws a monk's attention away from God. Even the gardening that is mentioned in the Sayings was suspect. It was, at best, on the borderline of the acceptable. When Abba Silvanus had to water the garden his disciple usually cared for, he hid his face lest the sight of the trees should distract him (187, 4). Underlying what we have seen so far concerning the eremit-ical understanding of work is the conviction that a monk should pay his own way and contribute to some extent to the welfare of oth-ers. But neither of these obligations demands that all monks must Review for Relig4ous work. Some monks, surely, had the means to sustain their life with-out daily labor. A number of these could probably count on the support of their relatives and friends. Would this modest support not give them more time to pray and meditate? Is there not a mod-icum of good sense even in the extremist position of the Messalians? Why is work itself so important? We must note, first of all, that living on any form of income other than daily labor is explicitly rejected in the Sayings. A monk who is disturbed by the haggling involved in selling his wares asks one of the senior monks whether he may give up work if he finds another means to survive. The elder replies: "Even if you do have what you need by other means, do not give up your manual work" (168, 1). The monk is instructed, in fact, to work as hard as he can. The "word" given here is exemplified in the story of Abba Achilles, who edifies his visitors when they discover that he has been working and meditating all night. "From yesterday evening till now, I have woven twenty mea-sures, although I do not need it; but it is for fear God should be angry and accuse me, saying, 'Why did you not work when you could have done so?' That is why I give myself to this labor and do as much as I can" (25, 5). The Sayings generally do not emphasize the noneconomic value of manual labor. They do, however, present work as a basic element of a hermit's life. When Abba Poemen holds up one of the elders as an example, he observes that "in Abba Pambo we see three bodily activities: abstinence from food until the evening every day, silence, and much manual work" (158, 150). When Poemen lays out the basics of the eremitical life for an inquirer, he begins by saying that "living in your cell clearly means manual work" (160, 168). We know then that, according to the Sayings, work is an asceti-cal activity linked with meditation which should not be set aside even if other means of support are available. It seems clear, how-ever, that manual labor was so tightly tied to economic survival in the experience of most Egyptian solitaries that they felt no need to reflect in depth on the role it played in their lives. It was simply a fundamental but unobtrusive activity of their uncomplicated regime. To get a deeper insight into the role that work plays in Any kind of work can upset a hermit's life if it assumes too great a place in it. 159 March-April 2000 R~ssell * Must Her~nits Work? the eremitical life, we must turn to the elaborations on life in the desert which John Cassian offers us in his Institutions and Conferences. --- 160 Cassian's Institutions and Conferences The presence of Messalians (Syriac for "those who pray" but do not work) is more strongly felt in John Cassian's writings than in the Sayings. The need for daily work seems, therefore, to be less the plain, indisputable fact of life it is in the Sayings and more a deliberate option. Cassian takes Paul the Apostle as the exemplar of work. If Paul, who had the right to live off his mission, worked, how can monks refrain from doing so? Paul worked, Cassian notes, not for the sake of introducing some healthy variety into his life, but to earn his bread by the sweat of his brow even though he might have lived off his savings or from offerings received from others (Institutions 10.8; p. 270).3 Since Cassian uses Paul's injunction to the Thessalonians to work with their hands and to be at peace (1 Th 4:11), it is clear that he sees manual labor as an antidote to distraction (10.7; p. 269). Work concentrates the mind and shuts out external noise. It lifts the individual above the turmoil of the emotions. This is so important to John Cassian that he connects a story illustrating this point to St. Anthony himself. Anthony, we are told, was challenge'd by a brother who argued that his own life was superior to the discipline of the desert. He lived near his rel-atives, benefited from their support, and so was able to give all his time to prayer and reading. Anthony countered his claim to be free of care by showing that he was, in fact, emotionally tied to the economic ups and downs of his supporters. Anthony goes on to say that "this most lukewarm condition [is] depriving you of the fruit of your own hands and the just reward of your labor" (Conferences 24.11.3; p. 833).4 Once again Paul's example is put forward as the ideal. It is his example, Anthony maintains, which compels monks to work. Indeed, were it not for Paul's example, Anthony argues, he and his fellow monks would take the easy route and live off the alms of their relatives. Anthony goes on to chide the healthy monk for living off alms that should by right go to the weak. He then makes an astounding statement which radically opposes the notion that, while others must work, monks are exempt from labor because Review for Religious they pray. He insists, on the contrary, that everyone else in the world relies on the compassion of others, "with the sole exception of the race of monks which, in accordance with the Apostle' s precept, lives by the daily toil of its hands" (Conf24.12.3; p. 834). Anthony reminds us that, according to tradition, the monk gives alms, he does not receive them. In Anthony's opinion, authentic solitaries do not live off their relatives or near them. On the contrary, they flee society and live outside civilization's jurisdiction in the wastelands beyond the fer-tile Nile valley. This withdrawal not only shelters them from the hubbub of village life, but makes farming--the kind of work with which most Egyptian monks were probably familiar--impractical. Cassian regards farming as an unsuitable activity for a monk for several reasons. First, it draws the mind away from the focus on God which should be the monk's principal concern. Second, the fatigue brought on by hard work in the fields drains away the energy a monk needs for his spiritual pursuits (Conf 24.12.4; p. 835).s The third reason, however, is the most important. Not only is farm labor hard, it is also periodic; as a con-sequence, a monk who does this work is at loose ends for long periods of time. Cassian makes this last point evident in the story of some farming monks who grew restless whenever they visited the hermit colony of Skete. They literally could not sit still. Cassian says that they had not learned how to quiet their inner being because they worked outdoors and their thoughts were scattered everywhere by their bodily activity (Conf24.4; p. 828). For John Cassian, therefore; work is primarily associated with the spiritual goal of the monk. The hermit works because work provides the best conditions for prayer. The monk does certain kinds of work because certain tasks can be done day and night, day in and day out, without undue fatigue and without requiring a great deal of attention. The uncomplicated procedures associated with rope making and the like help him to pray. They keep the monk alert and centered so that he is able to resist both sleep and the listlessness and distractedness typical of acedia (Inst 2.12; p. 210). The example of Abba Paul, who had no economic reason to do handwork, shows just how essential Cassian thought manual labor actually was. Abba Paul's basic needs were met by the garden he Authentic solitaries do not live off their relatives or near them. March-April 2000 R~ssell ¯ M~t Hermits Work? tended and the palm trees near by. It seems, in fact, that his idyl-lic little oasis was so far out in the desert that the hermit had no way of getting his wares to market. Nevertheless, he collected palm branches and set himself a daily quota of weaving. At the end of the year he gathered the baskets he had made into a great pile and burned them. Then he started all over again. Abba Paul did not work to feed himself or to provide for the poor. So what was the point of his manual labor? Cassian says that his example proves that a monk can neither stay put nor achieve perfection without manual labor. Abba Paul worked solely to purify his heart, to keep his thoughts on course, to persevere in his cell, and thus to overcome acedia (Inst 10.24; pp. 274-275). In other words, he worked because it steadied and grounded him. The handwork with which he occupied himself night and day while praying centered him in a way that the gardening he did to support his life could not. Work serves prayer as long as it remains a subordinate ele-ment in the monastic regime. But, once a monk begins to think of himself as a "hard worker," he is in danger of feeding his human ambition by measuring his own worth in terms of the profit he makes or the tasks he performs. The monk, in effect, imports the world's notion of success into the desert. Once work itself becomes the goal, it usurps the priority that belongs properly to prayer. This is vividly illustrated in Cassian's tale of an elder who comes upon one of these superachievers wearing himself out try-ing to break up a stubborn boulder. The exhausted hermit thinks he is doing "good work," but the senior monk sees that a demon is urging him on (Confg.6.1-3; pp. 333-334). The point is clear: work that does not serve prayer can turn even the sorry resources of the desert into vehicles of human ambition. Jerome's Letter to Rusticus Before we leave the earliest teaching on the place of work in the eremitical life, we should take note of the list of possible tasks St. Jerome lays out in his letter to Rusticus,a young man on the brink of a monastic vocation.6 Although he counsels Rusticus not to live with his mother, and does mention at one point that by working he will be able to pay for his food, practical necessity is not the principal reason Jerome gives for working. It is primarily a matter of keeping busy and thereby holding the devil at bay. Review for Religious Some of the jobs which Jerome recommends are the familiar crafts of the Egyptian desert: weaving baskets and tending a small garden plot. To these Jerome adds the cultivation and grafting of fruit trees, beekeeping, the weaving of fishing nets, and, signifi-cantly, bookcopying. The copying of manuscripts was, to a great extent, a physical task like the other jobs mentioned. The parchment had to be pre-pared, inks mixed, pens cut, the pages lined, the text written out, and, finally, the manuscript bound. But there was an intellectual dimension to this activity. Jerome mentions that copying texts feeds the mind. He then goes on to remember his own brief stay in the desert when he fought off temptation by working hard to learn Hebrew. We have here, I think, the seeds of a conception of "work" quite different from that of the tradition of the Egyptian desert. We have moved out of the world of small peasant farmers into the cul- ¯ tivated world of the Roman gentleman. Although, while in the desert, Jerome may have earned his keep by some simple hand-work, it is clear that his real work was studying and writing. The same may be said, to some extent, of Cassian. From this time on we see a certain tension between the idea of work as a physical, money-earning activity and work as an intellectual activity for the betterment of the individual. Should someone who can do the higher work lay it aside to do a less spiritual and less humane task for the sake of earning money? Must a hermit work? Are the eremitical life and work in the sweat and blood, money-earning sense of the word compatible? The old question subtly reemerges between the lines, as it were, when Jerome, a man of scholarly inclination, lists the kinds of work suitable for a solitary. Grimlaic's Rule for Solitaries The 9th-10th-century Regula Solitariorum, by Grimlaic, rep-resents a literary dividing line between the Egyptian tradition's insistence that hermits must work to earn their living and the belief that solitaries have the right to turn to others for support.7 After noting the spiritual value of work as a means to. avoid idleness, Grimlaic summons up the example of St. Paul and the Fathers to insist that solitaries must work to support themselves and to help those in need. Indeed, he says that the greater part of the day should March-April 2000 Russell * Must Hermits Work? A hermit's food, drink, and clothing are paid for either by his personal labor or by the offerings of the faithful. be given to "holy work." He has in mind some task which can be performed mechanically while reading or praying.(Regula 39; 629). Grimlaic retells Cassian's story ofAbba Paul, who lived too far out in the desert to make the manufacture of baskets and ropes practical, but who nevertheless set himself a quota of manual work every day. He also borrows from the same source the story of the superspiritual nonworldng monk who was brought down to earth by Abba Silvanus's failure to call him to dinner (39; 630). He further emphasizes the importance of manual labor by laying out the Benedictine schedule of work and accept-ing the principle that, if poverty demands it, more time should be given to labor (40; 631).8 Obviously, there had always been elderly or infirm hermits who were unable to imitate the example of St. Paul "and the holy fathers" which Grimlaic so strongly emphasizes. Nonetheless, it seems to me significant that Grimlaic should undermine his argument by noting that Augustine maintains that the occasions on which Paul himself depended on alms demon-strate that those who are unable to do manual labor may receive their sustenance from others (39; 630). Grimlaic states this principle and then backs away from its implications. He insists that solitaries should work with their own hands even if they have some other means of support (39; 630). The idea that it might be legitimate for solitaries to rely on oth-ers for their keep recurs, however, immediately after Grimlaic defends the importance of work in passages borrowed ~rom Cassian and Benedict. It is no longer an exception to an almost inviolate rule. He simply states that a hermit's food, drink, and clothing are paid for either by his personal labor or by the offerings of the faith-ful (41; 631). He notes that he has demonstrated that it is legiti-mate for solitaries to live off alms. The argument isbased on more than Christian charity toward the needy. Hermits are compared to the priests and levites of the Old Testament, who received tithes so that they might be free to minister to the Lord without the distraction of earthly preoccu-pations (41; 631-632). The Christian clergy, like the ministers of Review for Religious the Old Testament, have nothing of their own, but merely admin-istrate and distribute what they receive from the people. The assimilation of solitaries to the clergy, which was becom-ing more a reality as monasteries were clericalized, is complete in Grimlaic's quotation from a rule for canons in which monks and hermits are said to rightly receive material support from the church because they have followed the evangelical counsel to renounce wealth (41; 632). Without this support they would have to shift their focus from God to the business of securing the necessities of life. But what of the traditional obligation of hermits to help the poor? The Regula Solitariorum deals with this issue by comparing hermits to the apostles in the Jerusalem church. The apostles them-selves owned nothing, but acted as channels through which each of the faithful received what he or she needed. Solitaries are to have the same detachment toward material things and to see to it that the poor share in the offerings which come their way (41; 632). What has happened to the concept of work in this transition from a reference to the fact that the fathers earned their living by the work of their hands to the declaration that hermits have the right to live off alms? The Regula Solitariorum is not saying that hermits need not work, but rather that they need not earn their living by the work they do. The profitability of work is not the sine qua non of the eremitical life. When the Egyptian abbas talked about work, they were refer-ring to an activity by which they avoided idleness and earned money. In the works which follow the Regula Solitariorum, the financial benefits of work will fade into the background. There will be a strong tendency to value work solely as a means to escape the boredom idleness brings on. A Camaldolese Rule for Hermits The shift in what is meant by "work" is evident in a 12th- 13th-century rule for hermits which plays a part in the history of the Camaldolese.9 It is interesting that, when the customary warn-ing against idleness is given and the hermit is told to combat this by "doing some work," the works suggested are actually spiritual and penitential practices (34; 297). When the rule does refer to manualia exercitia, the emphasis is on when manual labor may not be done (35; 298). March-April 2000 155 Russell ¯ Must Hermits Work? The kinds of work mentioned--gathering wood, gardening, collecting straw--are to be done in groups of three or more (36; 298). What the rule seems to have in mind when it talks of work (the noise of which must not disturb the quiet of the hermitage) is the maintenance necessary to keep the hermit colony functioning. There seems to be no notion of profitability whatsoever. Indeed, the emphasis on the recitation of the Psalter indicates the influence of Cluny (37; 298). Liturgical prayer has become the monk's real work. A hermit is simply too busy and too often weak-ened by fasting to work. During Lent, for example, some work (aliquid; manualia quaedam) is scheduled for only two afternoons a week (35; 298). Guigo I's Carthusian Customary The "customary" (or custom book) of what Would later be called the Grande Chartreuse, written by Guigo I, shows that bookcopying was to the Carthusians what weaving and braiding had been to the Egyptian solitaries, that is, the perfect activity for the hermit's cell. Guigo I notes, therefore, that anyone who is capable is taught to do this work (222)'.~° The production of manuscripts seemed particularly apt to these priest-hermits because it was a way for them to preach the word silently (224). The profit motive is not mentioned, but surely the produc-tion of a commodity that was in demand supplemented the support the inner circle of monks received from the outer ring of conversi, who did the manual labor that today we call blue-collar work. Guigo's complaints about the cost of running the place suggest that the community was on a tight budget (210). However, if there was anything left over after expenses had been met, it was Jaot given to the poor directly but sent to the neighboring village for distribution. In this way the Carthusians made it unprofitable for the poor to trek to their door (210). .I.t/k/ Peter the Venerable's Letter to Gislebertus Not all hermits and recluses shared the Carthusians' deter-mination to keep people at a distance. Some of them surrendered to the inclination to escape the monotony of their life by turning outward. Their effort to lighten the burden of their solitary rou-tine by a bit of pastoral counseling may seem prudent to us, but in Review for Religious fact it made the return to solitude all the harder. It had another damaging consequence: it brought them more money than they needed. The extra, of course, was said to be for the poor, but watching the coins pile up could easily lead to avarice or turn the hermit into a local benefactor. It is not surprising, there.fore, that Peter the Venerable, the great abbot of Cluny, advises Gislebertus, a monk of his who has recently become a recluse, to make sure that there is no extra cash in his cell. He insists that Gislebertus not become a distribution center of offerings to the poor. If someone in authority tells him that he must perform this function, the abbot uses his authority to veto the plan. It makes no sense to Peter that someone who has been freed from the worry of meeting his own needs should be entangled in concerns about the needs of others (35).~ Since we are told that his monastery provided Gislebertus with food, clothing, and his hermitage, it is clear that he did not have to earn his living (35). When Peter, therefore, proposes some sort of manual labor, he is suggesting a means of refreshing the'mind and exercising the body. He is recommending manual labor as a relief from the hard work of reading, prayer, and meditation (38). ¯ For Peter, as for Guigo I, the best work for a hei'mit is book-copying. He too is enthusiastic about its pastoral benefits (39). But, if a hermit cannot do this work because his eyes are bad or because it gives him a headache, or if he simply wants to have something more than just bookcopying to do, Peter recommends that he make coinbs, needle cases, small wine flasks, and the like. He even mentions that, if a swamp is nearby, the recluse may imi-tate the ancient monks and make baskets (39). At this point, it seems to me, the text veers toward the romantic. Work has become a hobby, purely a means of avoiding idleness. The task which Cassian said the Egyptian

Edward C. Boyle ; The Weber and Davis County Communities Oral History Collection include interviews of citizens from several different walks of life. These interviews were conducted by Stewart Library personnel, WeberState University faculty and students, and other members of the community. The histories cover various topics and chronicle the personal everyday life experiences and other recollections regarding the history of the Weber and Davis County areas. ; 68p.; 29cm.; 2 bound transcripts; 4 file folders. 1 video disc: digital; 4 3/4 in. ; Oral History Program Edward C. Boyle Interviewed by Rebecca Ory Hernandez 9 November 2011 18 November 2011 Oral History Program Weber State University Stewart Library Ogden, Utah Edward C. Boyle Interviewed by Rebecca Ory Hernandez 9 November 2011 18 November 2011 Copyright © 2012 by Weber State University, Stewart Library Mission Statement The Oral History Program of the Stewart Library was created to preserve the institutional history of Weber State University and the Davis, Ogden and Weber County communities. By conducting carefully researched, recorded, and transcribed interviews, the Oral History Program creates archival oral histories intended for the widest possible use. Interviews are conducted with the goal of eliciting from each participant a full and accurate account of events. The interviews are transcribed, edited for accuracy and clarity, and reviewed by the interviewees (as available), who are encouraged to augment or correct their spoken words. The reviewed and corrected transcripts are indexed, printed, and bound with photographs and illustrative materials as available. Archival copies are placed in the University Archives. The Stewart Library also houses the original recording so researchers can gain a sense of the interviewee's voice and intonations. Project Description The Weber and Davis County Communities Oral History Collection includes interviews of citizens from several different walks of life. These interviews were conducted by Stewart Library personnel, Weber State University faculty and students, and other members of the community. The histories date back to the early settlement of North Ogden, and cover various topics including the History of Fort Buenaventura, city government affairs, controversial issues, Latinos in Ogden, personal everyday life experiences and other recollections regarding the history of the Weber and Davis County areas. ____________________________________ Oral history is a method of collecting historical information through recorded interviews between a narrator with firsthand knowledge of historically significant events and a well-informed interviewer, with the goal of preserving substantive additions to the historical record. Because it is primary material, oral history is not intended to present the final, verified, or complete narrative of events. It is a spoken account. It reflects personal opinion offered by the interviewee in response to questioning, and as such it is partisan, deeply involved, and irreplaceable. ____________________________________ Rights Management University Archives All literary rights in the manuscript, including the right to publish, are reserved to the Stewart Library of Weber State University. No part of the manuscript may be published without the written permission of the University Librarian. Requests for permission to publish should be addressed to the Administration Office, Stewart Library, Weber State University, Ogden, Utah, 84408. The request should include identification of the specific item and identification of the user. It is recommended that this oral history be cited as follows: Edward C. Boyle, an oral history by Rebecca Ory Hernandez, 9 November 2011 and 18 November 2011, WSU Stewart Library Oral History Program, University Archives, Stewart Library, Weber State University, Ogden, UT. iii Edward Boyle Roswell, New Mexico 1943 Edward Boyle New York, 1984 1 Abstract: The following is an oral history interview with Edward C. (Ted) Boyle (b. 1922). The interview was conducted by Rebecca Ory Hernandez, on November 9, 2011. In this interview Ted speaks of his early life growing up and attending school in Ogden, Utah and later attending Weber State University. The interview also highlights his life after graduating from Weber State University and going on to graduate school at the Thunderbird School of Management. Ted also talks about his career in international banking with Citibank, traveling the world and working as a bank executive. Ted is retired and now lives in St. George, Utah with his wife Hazel. ROH: I'm going to state the date and where we are. Today is November 8, 2011. We're in the home of Ted and Hazel Boyle in St. George, Utah. We are here conducting an oral history. I'll just start by asking you to repeat your name and where and when you were born. EB: My name is Edward Conrad Boyle, commonly known as Ted Boyle. I was born in Ogden, Utah, August the tenth, 1922 in the Thomas D. Dee Hospital in Ogden, Utah. I picked up the nickname of Ted Boyle when I was a youngster which came from my Uncle Albert. He used to call me Theodore Roosevelt and Ted stuck with me all my life. I was socially known as Ted Boyle. ROH: You were born in Ogden. Where did you grow up? EB: I grew up in Ogden, Utah on the east side of Ogden, which at that time was at the outskirts of the city. It was at 1470 26th Street which was between Taylor and Polk Avenue and was an area which was basically low income people on the 2 north side of the street and people of means on the south side of the street. Our house was very small by today's standards—two bedrooms, one bathroom, a small kitchen, a dining room, a living room, and a small lot. My brother and sister and I and my mother and my father only had two bedrooms. So my brother and I slept in the unheated basement of our home in unfinished bedrooms with my mother's washing machine between us. My sister had one bedroom and my father and mother had the other bedroom. It had no garage in as much as my father never owned a car. He was one of the very few in Ogden who didn't have a car. My original concept of this house was that it was purely acceptable for us during those trying times which would be the Depression era of 1920s and 1930s. We got along as we could and stayed out of each other's way. My father who was a furniture salesman with Boyle Furniture Company in Ogden would actually walk two miles through all kinds of weather to save a five cent bus fare. Without a car we all depended on friends to get around to social activities. My mother had to walk three to four blocks and bring back her groceries. I remember that very distinctly. At the tender age of six, seven, and eight years old, I was unaware of the differences in the economic status of people on the block. As I grew older I learned to understand that we were on the wrong side of the track as far as the economic aspect of it. It didn't really bother me that we grew up near the poverty line. My father was a good provider. My mother was a wonderful cook. We ate the staples, cornmeal and mush in the morning and things of that nature. We had an icebox, a small cubicle to eat in 3 and I got by. I learned to accept what we had. I had one pair of shoes and one suit. I learned early in my life that I was not conventional in the sense that I had no feel for solving mechanical problems. I couldn't do anything but maybe change a light bulb. That carried through my whole life as my wife knows very well. I was just not like that. I was not allowed to have a house pet. All my friends had dogs but my father adamantly said no dogs. So I grew up in the neighborhood by adopting dogs in the area. My earliest recollections of my schooling in elementary school were at Polk School, which was a block away from our house. It was a very modern school of that time. There were eight grades and it was very convenient. However, during the heavy winter storms that we had in Ogden in those days, we had snow days where I couldn't even get to school because the snow was piled up so high. ROH: How did you get school? EB: We would try and get through these snow drifts but we were basically snowed in. We used to build snow igloos in my front yard. In my early days at Polk School I was a very average student. I thought I had a knack for numbers but when it came to social studies, math, and others, I had trouble. The teachers at that time—our principal was named Florence Brown. If we got out of order then, at that time, we were called in the office and she took out a ruler and hit us on the butt. Today, you know what would happen. But we accepted that. Our parents accepted that if Johnny was out of order he would pay the price. My earliest contact with the female species was in the third grade when we had all the boys 4 sitting on one side of the room and the girls on the other with a phonograph record playing dance music. The teachers would pair us off and we'd go out and try to dance with each other. It was a very strange feeling. Among those girls was Rosanne Peery. She was in the same class I was. I had no skills of any sort. We had a shop organization where we went down in the basement of the school and made wooden things. By hook and crook I made a sewing cabinet for my mother and had it shellacked and it was a pride and joy for me. As I walked up to my house I stopped at the neighbors place and his Labrador retriever went over and did his thing on my sewing cabinet. I was devastated. It didn't matter when I took it home to my mother. She said, "Oh, that's fine." I think that really must have been the only thing I ever created. ROH: How old do you think you were? EB: I was probably about ten years old I guess. In the school I was not physically adept towards contact sports which bothered me enormously because we were always rough housing and I was afraid to get in the middle of it. So I became a finesser, trying to find a sport where I didn't have the contact. I developed a very fine arm. I used to throw stones and I developed a very strong pitching arm, so I became successful in softball and things like that. Going back on Polk School— my late brother (who was five years older) at one time, on the third floor, opened a window and got a hold of the ropes on the flag pole and swung out one hundred feet off the ground before hitting the ground. That was the beginning of my brother being an ultimate dare devil. He was afraid of nothing. My dad loved Sundays as it was his only day off. He was not a church man. He would go out 5 and tend his garden which included all kinds of fruit trees. Then in the afternoon he would go down on the bus to the Orpheum Theater and see a movie, then come back home with a bag of popcorn for the family. My mother of course was in church. I was encouraged at that time to go to church on Sunday. ROH: What church did your family go to? EB: It was the LDS church at 26th and Jackson. At that time it was a six block walk for my mother in all kinds of weather. Our bishop was David Romney. I had a group of friends while growing up and among them was Jennings Olson. Jennings was a person whose handicap was a club foot. We all tried to put that out of our minds when we were playing baseball and things. Jennings was always full of vim and vigor. One thing I remember about him was that he did not like carbonated drinks. He always had to have something non-carbonated. I remember that he read voraciously. His father was a very good medical doctor in Ogden. His mother was a dear but rather homespun. We formed cliques. We had what we called the 26th Street Gang which was the street we lived on. We had about six or seven of us that used to play football in the street and then we'd go skating over bumps and things like that. It became the center of activity. We all grew up to bond. Those people in my early ages were the people that stood with me through the ages and today are still my best friends. It was a phenomenon that we all had the same interests and it was a matter of getting along without any money. We created our own fun outside of the theaters. For instance, on Saturday I would go down to my dad's office at Boyle Furniture and I'd say, "Dad, I want to go to the movie." So he'd give me twenty five cents. That twenty five 6 cents covered my bus fare down and back from the Paramount Theater, a bag of popcorn and I would sit in the front row as close as I could get for these cowboy movies because it was thought at that time, the closer you were to the action, the better off. I'd get out of there and I'd be blurry eyed. I couldn't see for five minutes when I got out of the theater. One thing that I do remember very vividly was Christmas. In Ogden, in the thirties, there were several department stores including the Emporium and Lowe's where they had Christmas displays with electric trains and everything like that. I used to spend hours looking at these various things and hoping against hope that we would be able to get something of that note. Christmas night my brother, my sister and I would go to bed early hoping that Santa Claus would get down the chimney. We had a chimney. I never did understand how he was going to get down through there. My mother put out the cookies with milk and we'd go to bed early and get up at four o'clock in the morning to sneak up the stairs and look and see what Santa Claus had brought. Quite often it was a bowl of hard candy and an orange, a piece of clothing and an inexpensive game. We kept hoping for a train set but we made the best we could. We survived. I became aligned with my closest friends that I loved. About the church— my mother was a devout Mormon. She would have been in the bishopric if they had allowed women. My father was a non-believer, a great man but did not actively participate. I was obliged by my mother every Sunday to go to church with my friends. We diligently went in and passed the sacrament and obeyed what we thought were the laws of the church until such time when I think I was 7 about sixteen or seventeen. The bishop came down the aisle and got me by the arm and said, "Ted. I think it's time for you to go on a mission." That shocked me. I think I just said, not negatively, but that I was not really interested at that time. My truest friends—all of them followed the same line of reckoning, so I wondered at this time, what was it? Was it peer pressure? We all had the same idea at that time that we were not going on missions. It was etched in stone. After we graduated from Polk School, I went to Central High School down at 26th Street and Monroe. Believe it or not, those two years are negative. I have nothing really factual that I can remember of any note. In other words they passed by me without any real essence of any happenings at all except the music instructor there said, "Ted, you've got a wonderful voice. You should go out and use that voice." I remembered that. So off we went to High School at dear old Ogden High School on 28th and Harrison. We were the third class and that's when I really grew up. It was a new atmosphere. The ambiance, the people, the teachers, the location all struck me as being something super. I guess you could say I was a jokester all my life and I got by with my wits. In other words, I was always cracking jokes and breaking up people. I became very popular and joined the social clubs there. I knew quite a few people. But I do remember something, this was pre-war, they had ROTC. It was officer's training school. We were obliged to go out on the campus and parade around for an hour and then after that they selected officers from our group to lead. These were the power makers. This bothered me enormously. I was not selected. I was a private. All my friends were colonels, majors, captains, etc. I was obliged to walk through 8 the ranks as a private. I thought, "Well, this may be my life. Maybe I'm not going to make anything out of it." But I did make some very good connections there. I loved the people there. Our actual basketball team were the state champions. We were honored in Salt Lake. We had, what I think Tom Brokaw would call the finest generation. I would consider that our class of 1940 was exceptional as far as the quality of the people and what they did and the environment we were living in. ROH: Can I ask you a question real quick? Tell me the names of some of your friends at Ogden High. Who were your best friends? EB: Jack Luddington, who I'll talk about incessantly. Jack Dalton, Bill Hinds, Jennings Olson, Richard Stine, Parry Thomas. Here's something that you want to wire in. Parry Thomas and I were very close and Parry Thomas probably was the leader of the pack, as far as what happened to the graduates. Parry became president of a prestigious bank in Las Vegas. He became a very big factor in banking in Las Vegas. Bob Bishoff who was president of I think the Commercial Security Bank and Maurice Richards, a prominent attorney. It was a time when Ogden was at its apex as far as producing people of culture with the ability to move on. One thing I noted that in our parking lot there were probably five or six cars of people that owned cars. You go by today and there's hundreds of them out there which is an indication of time and change. I still, at that time, had no real love connections. I think a lot had depended upon that my family had no car so I depended a lot on double dating and taking girls out like that. I had a lot of very close female friends but nothing serious at 9 all. I would go to the prom by myself and my friends would put my name down and I'd dance with their female partners. ROH: Did you call that stag? We always call that stag when you went by yourself. EB: Yeah, I went stag. I enjoyed the dance with other people's partners. I was awe stricken by the campus. It was so beautiful in 1940. It was constructed for less than one million dollars and one of the advisors to building was Meryl McClanahan whose son was Richard, a classmate of mine. After we graduated many people went their different ways and I went home and I said, "Where do I go from here?" I knew we had very limited means. I had no money myself. My dad couldn't afford anything. So Dad scratched up enough money for tuition for Weber Junior College. Quite a few of the students there were on short hook as far as money. The money class went to Utah or BYU. We arrived down on the campus of Weber College and it was very, very small in relationship to what I had pictured. The student body and my class were something like 180 people. We were in a war by that time so that meant that there were very few people around. I thought while I was there that I still wanted to be a forest ranger because of my likes of being outside, hunting and fishing at the cost of the government, and so that was my theory. I wanted to graduate from Weber College and then go on to Utah State where they had a forestry school. I became involved with the Excelsior Club, which was the premier social club. I made lots of friends. I think my personality lent itself to making friends. I was like a loose cannon. I always felt like I had to make light of anything and I think that was a big hit down there. 10 I became very close to [Henry] Aldous Dixon who was president of the College. His son, John Dixon, became Director of the University of Utah Medical Center. I made new friends. I found at that time that Ogden had a history of being a Mormon town. In other words, if you were Catholic, you were on the wrong side of the track. I had wanted to date a girl who was a Catholic. My mother found out about it and she had a fit. She was very down to earth and strong in her beliefs of the LDS Church. ROH: Did you have any friends who were African American? EB: Here we go. In the student body there was one black. His name was Willy Thomas and he was a huge, black, muscular athlete from Kansas. He was an outstanding track man and basketball player. He ran the hundred meter dash. I became very close to him out on track. I ran the track there, the mile run. I would joke with him and he would sometimes take it as offensive and then he'd say, "After I thought about you Ted." I was chuckling to myself. I became very close to him. Another example was Wat Misaka who was of Japanese origin and an excellent basketball player. He has been honored nationally. I became very close to him. At that early stage in my life it became apparent that I had no racial problems. I had made my point there at Weber College and found that later on in life, that's what often led on to what I did and where I went. Anyway, I took fond memories from Weber College. I thought that the beauty of that college at that time was the smallest of the class, the informalities, the attention from the seniors as to coming in to classrooms and talking to you. You felt like it was a family operation, totally family. It was a wonderful thing. 11 Aldous Dixon lived on campus in a small house right there. Later on when I went in to the war—my family would tell him what I was doing over there and he would write to my family and say Ted was going to be okay. I also liked the small classes at Weber. We had a lot of help from a very professional teaching staff. As an aside, I purchased an expensive oil painting of Farrell Collett who was once the head of the art department at Weber College. ROH: Nice. EB: Anyway, I always imagined myself as being an athlete. I had a very strong arm and I could throw the football farther than anybody on the football team but I was so fragile that I knew that once I was hit I was down. So I never did participate in football or basketball. But I was on the tennis team at Weber College. By the way, while I was in high school I was city champion in several contests there and I would ride down on my bicycle to Liberty Park, and I would have one racket with maybe a string broken. In one case, a prominent citizen would come up in his convertible in white shorts with a racket and the contrast was startling. I had a tremendous forehand but no backhand so I would always attack from my forehand and try and cover up my backhand. I was fairly successful because when I was younger I used to pound the back of our house constantly with a ball. That's where I developed my forehand and the serve was tremendous. But my backhand did not exist so I lived by playing around that. It was one of those things. As we progress along, the war was coming closer and closer so a group of us, after graduation from Weber College, decided to go to Utah State. Five of us 12 went to Logan and moved into in a house near the campus. We managed to survive. I joined the Sigma Alpha Epsilon fraternity, which was a premier club. I was very comfortable on the campus. Then my dearest friend Jack Luddington, who I mentioned before, had been taking pilot training out at the old Ogden Airport, and he said, "Ted, things are closing in. The Air Force is having a meeting in Ogden for possible applicants to join the Air Force. Do you want to go along with me?" I said, "I don't know." Then he talked me into it. I said, "Yeah, we'll get drafted if we don't." So we went in there for the physical, I think I weighed 138 pounds. The Army Air Force medical guy said, "You don't qualify. You're too thin. But I want you in here. Go home and eat about three pounds of bananas and come back tomorrow. See if we can fudge you in there." Low and behold I gained a pound or two and he said, "You're in." My friend Luddington, who was not a genius either, as far as his ability to score well on tests, was the last one out of the class. He sat down and I said, "Come on Luddington." He finally made it and we both joined the Air Force and left Salt Lake City on the train for Santa Ana, California. We arrived and there were 20,000 cadets at our base. We were separated after we took the tests to find out what our abilities were. He was assigned as a potential pilot and I was assigned as a potential bombardier. So after we graduated from the base in Santa Ana I was assigned to Roswell, New Mexico which was a bombardier school. Jack went in to pilot training on the California coast. I arrived in Roswell and found that we were dealing with the Norden bomb sight which was highly prized by the German Air Force as being something they 13 would like to have in their power. So, while we were in training, we always had to carry a .45 revolver and treat the bomb sight as a most valuable item. We would practice bomb day and night. We were expected to drop the bomb in a five hundred foot circle from five miles high. The blue practice bombs had ninety-eight pounds of sand and two pounds of spotting powder. The Air Force kept washing out cadets. I would call my mother and say, "I'm still in here but the ranks are thinning." When I finished, I got a short leave to go home to Ogden and I showed off my wings. Then I was assigned to Hondo, Texas for navigational training. Hondo wasn't too far from Austin, Texas, where my Aunt Clara lived with her billionaire husband. She invited me to go up there on the weekends. She let me sleep late and she fed me well and I was in seventh heaven. After we were through with Hondo, we got our orders to form our strategic bomb group in Salt Lake City, at Kearns Army Base. I thought it was nice to be back near home for a few days. Our plane crew was made up of crewmen, pilot, copilot, bombardier, navigator, and six gunners. We named our plane 'Lassie and Her Lads' because we had a gorgeous spray painting of Betty Grable wearing a swim suit on the tail. We were a composite group of the Midwest and far West. We trained in Dyersburg, Tennessee. Then we moved on to West Palm Beach Florida for our final training. From there we got orders to go to Trinidad, West Indies. We flew by ourselves. The landing strip was in the jungle and we were in there overnight. The next day we took off for Belem, Brazil. We flew over the Brazilian forest for ten hours and I said to the navigator, "If we go down in 14 there, we're done for. They'll never find us." From an overnight in Belem we flew to Fortaleza, Brazil, which is on the tip of Brazil. The next stage was thirteen hours flying over the Atlantic Ocean. We took off at night. We were flying a thousand feet over the waves in order to save on fuel. I was in the nose, as usual, and we encountered St. Elmo's fire, which was an electrical discharge carried to our guns. I thought we were being fired on. It was phenomenal to see. We arrived in Dakar, Senegal in North Africa. That was an eye-opener. As we landed, a multitude of Senegalese warriors came out with guns and top hats and surrounded our plane in order to protect it. They put us in canvas tents and as we relaxed, the Senegalese came through with their spray guns for malaria and they sang as they went through and sprayed us. Our next stop was Marrakech, Morocco situated high in the Atlas Mountains of North Africa. We went into town to visit the markets and old French restaurants. Towards the evening we decided to visit the French Foreign Legion outpost in Marrakech. We asked the commander if we could watch their parade in the evening and he said we would be their guests of honor. That night we froze to death and slept in our plane. The next morning we got orders to go to Tunis, North Africa. We flew across the Sahara and landed at a deserted German Luftwafee air base that was used during the Montgomery and Rommel desert war. We visited the ancient aqueducts there and marveled at how they had been built. We also visited the ruins of various German Luftwafee planes and we were warned not to take anything because everything was booby trapped. 15 We received our combat orders and flew from Tunis to Foggia, Italy and landed at a deserted air field that had been occupied by the German Luftwafee. We went to our canvas tent and proceeded to locate the mess hall. We thought the food was not very tasteful, so we bartered our provisions for local products such as fresh eggs. Our group was the 463rd bombardment group commanded by Colonel Frank Kurtz, who went back in history to the invasion of the Philippines by the Japanese. His airfield was attacked by Japanese bombers and several of the American B-17 bombers were split in half. They put one piece of a bomber into another and called it the Swoose—half swan, half goose. Colonel Kurtz was the chief pilot of that plane, which is presently being restored in the United States. We got settled into our base and our first mission was what we called a 'milk run.' That was to indoctrinate one without fear of major casualties. As the bombing missions progressed, they became more deadly and losses mounted. Then it became one of marking down. You had to make fifty missions as related to a loss of three to four percent of the planes each time we went out. As the missions increased in intensity, we finally came to a mission where the target was Ploesti, Romania. For the Germans, the Ploesti oil fields were a source of oil for their entire military operation. It was heavily guarded by flak guns and F-190s and ME-109s. They were the elites of the German Air Force. When we found out we were going to Ploesti, everyone sighed, had their breakfast, went out to put in their bomb load, and proceeded to taxi out to the runway. 16 By the way, the air fields were metal strips, not cement, and the B-17 loaded with 6,000 pounds of bombs, 2700 gallons of high-octane gasoline, does not get off the ground very quickly. At the end of the runway there was a fence. I was in the nose of the plane and remarked to the navigator, "This plane's not going fast enough to get off the ground." Finally we cleared it by about a hundred yards and went up into our formation at 15,000 feet. Over the Adriatic Sea, everyone discharged their machine guns to make sure they were firing. Then we went over the Yugoslavian Alps. The Yugoslavians were not allies at that time and they had flak guns mounted on top of the mountains. They shot at us, but weren't very effective as they didn't have advanced radar. We flew into our target area and our escort fighters, which were P-38s and P-47s peeled off because they were short of fuel and headed back to their base. They left us unescorted as we approached the target area. There were three or four hundred planes forming a line at what was called, the 'initial point.' This enabled German aircraft guns to zero in on our direction and altitude. I took command of the plane, flying it as we approached the target area. As we neared the target area we saw a huge black cloud box where all the German flak guns were concentrated. I saw planes going through that box and going down on fire and we knew we were next. It was very trying and tested ones fortitutde to the maximum. As we approached closer to the target, I cranked in the airspeed, the velocity, the wind, and other data into the bomb sight. The two indices cross and you know you're on target. I'm watching carefully and finally the indices cross 17 and I say, "Bombs away." The bombs are released and we turn away with planes on fire on both sides of us. As we left the target, if any of the planes in our formation had an engine out and they trailed the pack, they were attacked incessantly. You had to keep a tight diamond formation with seven planes, which also gave you more firing power against the enemy. So as we came away from the target and headed back, we were still alive. Then we started talking about if we had enough fuel to get home. As we neared the Adriatic coast, we started planning whether we were going to make it or whether we were going to ditch. We'd all had training as far as what to do. We finally arrived in the vicinity of the airfield and landed. We were interrogated and had our hot chocolates and donuts and tried to unwind. In another mission, we lost all of our commanding officers and crew in a mid-air collision caused by cloud coverage. In another occasion after takeoff to return to base, we had instructions that the mission was aborted. Our chief pilot, who was later a noted neurologist from Boise, Idaho, turned to our copilot and said, "Why don't you handle this landing." We turned towards the runway and I noted there was a crosswind and the copilot wasn't factoring that in. As we approached the runway, I said, "We're in trouble." We hit on the left landing gear and bounced about fifty feet up in the air and came down with the engines chopping up the runway—with 6,000 pounds of bombs and 2,700 gallons of fuel. I said, "I'm dead." We slid for about five hundred yards and the minute we stopped I yelled for everyone to get out and I ran for about a half a mile and dropped down and covered my head. For some time the rescue crew wouldn't 18 get near the plane to deactivate the bomb load. I don't know why that plane didn't explode. [photo included] ROH: Let's pick up where we left off with World War II. You had survived a crash landing. You said it took a long time before anyone would go near it. EB: Gas was pouring out over the engines and the bombs were banging against each other. We stayed away for a long time and then the emergency crew hosed it down to cool it off. ROH: Did they send you on vacation after that? EB: No, the policy was that you could fly twenty-five missions and then you could take a week off and go to the Isle of Capri near Naples to unwind. My theory was that I wanted to get out of there as fast as possible so I didn't take the vacations. I flew my missions because I wanted to get back to the States. The B-17s flew between twenty and twenty-seven thousand feet. It was thirty degrees below zero—freezing. Non-pressurized cabins. Ice formed down the face of your gear. No relief tubes. We had flak suits on and our parachutes hooked on one side, then we had a helmet. It made it very hard for us to move around. On another mission, we had a misfire in the bomb bay as two bombs had banged together and did not detach. The pilot said, "Boyle, get back there and release those bombs before they blow up." In the B-17, between the front part of the plane, the bomb bay, and the back, was a rail and two supports. As I walked over it, I was looking down at the Mediterranean from 25,000 feet and holding on to a rail with one hand. I was trying to release the catch for the bomb that was 19 swinging against the plane. I managed to unhook the bomb and made a silent prayer as I returned to the nose of the plane. It was a terrible thing to fly eight hours on total oxygen at very low temperatures. It was bitterly cold. After a mission, the Red Cross would be there waiting for us with donuts and hot chocolate, then we'd be interviewed about the mission immediately. As the missions went on, I would write letters. I have over a hundred letters that I wrote to my mother that she kept. I began to wonder if I was going to make it or not. On my fiftieth mission I was flying with another Utahn, Clyde Hart, and he knew it was my fiftieth mission. When we landed, I got out of the plane and kissed the ground. Before that, on a raid over northern Italy, we had some terrible problems from damage to the plane. I managed to get the bombs on target and two weeks later I was awarded the Distinguished Flying Cross. After my fiftieth mission, I said, "I've done it!" We got ready to depart and the fifteenth Air Force came out with a memorandum saying, "Unfortunately, we have a shortage of flight crews, so you can have thirty days' leave in the United States, then come back and serve another fifty missions." I wrote to my mother and said that was a death sentence, I would never come back. Fortunately, they reversed that. I left Naples on a troop ship on July 26. We were in the upper part of the boat and on the decks they had thousands of people who were fleeing France and Italy. They had no place to sleep, so they slept on the deck. We were in a convoy surrounded by destroyers, but we had reports of submarines in the 20 area, so we were dropping death charges. That was scary. We arrived in New York. I took a train from New York to my home in Ogden. My first few nights in my family home, I would wake up screaming. I hadn't unwound yet. I would try to find ways and means of winding down. After resting at home, we were sent to a camp in Santa Monica to continue to decompress. My combat days were over, thank the Lord. I was assigned to San Antonio Air Base, and then I spent a series of time moving from one air base to another. I kept in mind that I might be called to duty again. I applied for pilot training in the Air Force and I was accepted. I was assigned to Thunderbird Field in Phoenix, Arizona. The field was also occupied by Chinese cadets who thought nothing of flying into you or on top of you because they had no reason for flying etiquette. In that area of Arizona, there are always hot air drafts. After I had gotten to the point where I was flying solo, I was landing the plane and unbeknownst to me, the pocket of hot air was pushing the plane up and I didn't compensate for that factor. I pancaked and spun around on the landing strip. Thankfully, I wasn't hurt. Immediately I went on a flight check. The instructor, a pilot named Carl Thigpen said, "Ted, you're a good pilot, it's unfortunate you've painted yourself into a corner." They washed me out of the program. I eventually ended up in Denver, Colorado where I was released from the Army-Air Force. ROH: Did your older brother serve as well? EB: No, he had a medical problem. He was a dare-devil—totally different than I am. He parachuted out of a plane in Ogden in 1934 at the age of seventeen. It was a 21 high school bet with his friends. The owner of the airport told him he had to have his father's permission, so Billy called our dad and said, "Dad, I'm going to jump out of a plane, you have to give permission." We sat on the front porch and watched this biplane circling up and then a parachute drop. He became a champion ski jumper in the 1930s. He became an expert on Ecker Hill which was adjacent to Park City. It was a humungous, steep hill, and it attracted a bevy of Norwegian ski jumpers. They formed a cartel and would have jumping contests. My dad and I would go to watch my brother jump. He did exceptionally well at that. After that, he went to California and raced cars. He had no fear at all. That was his life. Later, he became a dreamer. He got into real estate and everything was going to be a million dollars. He was an alcoholic. He became an advisor in Santa Monica for a bevy of movie stars and famous people who would call him at two o'clock in the morning, "Billy, I got a problem." He never quite made it financially. He was always engrossed and saying, "I just got to get this guy to sign this and then I've got it made." It was always touch-and-go with Billy. We were very different. ROH: Did he write to you while you were gone? EB: I've got a ton of letters. Hazel and I are always wondering about who's going to give a hoot about these letters after we're gone. Billy was a great personality. He could walk into a place and immediately have people around him. He eventually ended up in a nursing home in Santa Monica and Hazel and I would go diligently and take him milkshakes and candy bars. The next day he would say that people 22 had stolen them from him. I said to Hazel, "Now that I've seen this in my brother, when it comes time for me, I'm heading for the hills with a Pepsi." It taught me a lesson in assisted living. He was my protector when I was young. My sister was a beauty queen from the get go. She did modeling in Salt Lake City and she was a prom queen. She married well—Ed Haas who was one of the producers of "The Munsters." She traveled in high style in Santa Monica with him. We had the same experience with her in assisted living that we had with my brother. ROH: So none of you worked in the Boyle furniture store? EB: This is fun. I thought from day one that I was going to be selling furniture for the rest of my life. I worked in Boyles as a delivery boy and not withstanding my frail structure, they put me on a delivery truck to haul stoves to second floor premises. Then I handled the store elevator covering three stories which didn't have an automatic stop. During the Christmas season we'd have a pile of customers on the third floor and I'd try to judge where the first floor was and end up sliding clear to the bottom and have to go back up again. HB: You'd better start telling her what happened to change your life. EB: I haven't got that far yet. Anyways, after I got out of the war, I was twenty-three and I was looking for companionship. I had bought a car during the war for my family, who had never had one. I met a girl and we had a relationship. Her name was Gloria and her dad was the music instructor at Weber College. Things were progressing. I was an avid skier and we were in Snow Basin and I told her she 23 needed to learn to ski faster and she went down and fell and broke her leg. Things went from bad to worse after that. Another day, I was at Snow Basin skiing by myself. I was the last man on the hill. The ski patrol had gone and I wanted to do one more run. On the way down, I fell and spun around and stopped near where the gate was. I got up and decided I was okay, so I was going to do another run. Remember, there was nobody on the hill. I got on the ski lift and about half way up, my left knee started to hurt so bad I couldn't stand it. I rolled off the lift at the top. It was dark. I zigzagged my way down the hill, sitting down all the way. It took me an hour to get down. I went to the doctor and found out I'd blown all the tendons in my knee. I had my knee in a cast and I was the house boy at the Pi Phi house in Salt Lake. I was living in the basement with about thirty Pi Phi's as residents; one of them being my sister. I got all the dirt about what had happened on dates—the girls would sit at the kitchen table talking about their dates as if I didn't exist. One day a group of young men in the lounge were talking about the Thunderbird school in Glendale, Arizona. I thought, "Wow. That sounds good." So I made an application to enroll. I was accepted—I still had my leg in a cast. I set out for Phoenix by myself in the winter with my left leg in a cast. I got near Cedar City and it was black ice and I skidded off the road and tipped over in a ditch. This was 6:00 in the morning. I got out and hobbled down the road to an all-night café. There were several patrons in the bar who offered me a drink before they went out to put my car back on the road. I arrived to Thunderbird school and decided I wanted to live abroad and work for an international company. 24 I decided I needed to work on my command of the Spanish language. My friend and I traveled to a small university in Morelia, Mexico. We lived rather sparingly with a Mexican family. After studies in Spanish, it came time to go home. We had practically nothing in our pockets, so we boarded a bus to Guadalajara. There were more chickens than people on the bus. In Guadalajara, we had no money for a hotel, so we went to a flop house that had a hundred beds or so. Bill and I went in and paid and we agreed that one would sleep and the other would stay awake because someone might assault us if we were both asleep. We had to go third class on the train to Nogales, Mexico. That was a laugh because it was full of immigrants heading to the United States and they were all pretty liquored up. We had no money for food, so when the train would stop, we'd get a stock of bananas. We were on the train three days and all we ate was bananas. Close to the border, we got off the train. Bill left his U.S. passport on the seat and had it stolen. Going through customs in Nogales, Bill went to jail because he didn't have a passport. Then they put me in jail because my passport, when we'd gone into Mexico with friends, had been stamped that I had brought a car into the country. So I was put in jail until they called the owner of the car and verified that the car was in Mexico City. I don't remember how Bill got out of jail. That was a journey never to be forgotten. After we graduated from Thunderbird—the beauty of the school, is that the people who hire, came to campus. I was prepping to get a job with Sears Roebuck. A friend of mine had scheduled a meeting with a Citibank officer from New York. When Citibank found out my friend was married, they said no. My 25 friend said to me, "Ted, why don't you interview in my place?" I asked for an interview and the first question their man from New York—Gordon Bullock— asked was, "Why do you want to go to Latin America?" I said, "I have an uncle who runs the largest sugar cane factory in Puerto Rico and if you hire me, I think I can get the account." I made it up off the top of my head on the spot. [Laughter] I walked off to get ready for Sears Roebuck and a week later I got a telegram saying Citibank had accepted me. They had to write for references. Not far from me lived two very powerful lawyers, George Lowe and Roy Thatcher. They wrote letters to Citibank. Then I asked my dad, "Dad, I'm at a crossroads here. I don't know anything about Citibank." My dad said, "Ted, the only people who are important in Ogden are doctors, lawyers, and bankers. Go for it." I accepted Citibank and said goodbye to Ogden. I got on a train to New York and went to the YMCA with the other trainees. I stayed seven days in New York and they shipped me off to San Juan, Puerto Rico. San Juan was our training base for South America. The people there were very friendly, we practiced our Spanish, and we learned about banking—that including carrying the golf bag for the managers when they went golfing. My family came to see me. They had never been out of Ogden, Utah. My mother has a diary of everything that happened. She even wrote about my dad listening to the motors on the plane. We had a lovely time. I think that was the biggest thing to ever happen to them in their lives. As it came time to depart from San Juan, they told us, "You trainees have three choices, you can go to Havana, Cuba," which was pre-Castro, which was a 26 great place, "or you can go to Mexico City," which was number one, or Bogota, Colombia. I'd never heard of Bogota, Colombia. For some unknown reason, I chose Bogota. I arrived in Bogota at 8,600 feet in altitude. It rains about every other day. It's in the top of the Andes with ancient Indian culture all around it. I settled into an apartment with another trainee and we lived the buena vida—the good life. He was a football player from Ohio State named John Mack—a very joyful guy who would fit in any crowd. We played fifty-four holes of golf in one day. We had a great time. We dropped golf balls out of the windows to watch them bounce on cars and roll down the street. A friend who liked to drink went out and got locked up and couldn't find a way home. The police called the wife of the other man with him and asked if she wanted to come down and bail him out. She said, "Hell no. Leave him in there." She was furious. Anyway, we had a wonderful time. Our chief officers at the bank were Boice Nourse and Juan Sanchez, a Castilian from Spain. It was just idyllic. We would play Liars Dice at the Anglo- American club and whoever lost would pay for lunch. We'd play against the manager and he wasn't very good at concealing his thoughts, so we got a lot of free lunches. We used to have vacations—we would get three months off after every two years and they'd put us on the Grace Lines ships to go up to New York. I'd go back to home in Ogden and I'd bought a car—my original car was a 1942 Chrysler Sedan that I'd bought during the war, then I bought another that I think was a Ford. Back in Ogden, I reunited with my old friends but I felt like I was out of place with them. In the interim period, I was doing well in the bank and 27 learning about the theory of banking. Citibank was the world leader in international banking. We worked with governments and with major organzations and their subsidiaries. We were not oriented towards individual banking. We worked with big-ticket items. In one of my trips North, I met a young lady from New York City, who was on the cruise with her mother. We became involved and were engaged when I went back to Bogota. One day I was working on the bank platform in Bogota and this young woman walked in and stopped the music. She walked down that platform with her gorgeous black hair and I thought this was the girl of my life. I hadn't even met her. When she walked in, I just thought, "Where have you been all my life?" ROH: What year was that? EB: That was about 1951. We dated about eight months. The bank had a policy that you could not date employees and I was engaged. I had a dilemma. I talked to my general manager, Boice Nourse and he said, "Ted, we'll make an exception as long as you play the rules of the game." Hazel loved peach melbas, so I asked her out to get one with me. I kind of dallied around. Finally I went out to meet her parents and find out if they were willing to let her date me. To the very strict in Latin America, this is how you go about dating. When her father saw that we were getting serious, he wrote the State Department to find out if I was married. He was worried about the Mormon religion and if a polygamist might be after his daughter. 28 Hazel and I started dating and I was in seventh heaven. I couldn't believe it because of the age difference. But we dated and then I got really sick. We had an idiot bank doctor and I went to him and said I didn't feel good. He said, "Do you chew gum?" I said yes. He said, "Then stop chewing gum." Well, I got worse and I started turning yellow. Hazel got worried and I went to another doctor. He said I had Hepatitis and he wanted me in bed resting immediately. I was in bed for three months. All I can remember of the treatment was that I ate a lot of hard candy because the doctor wanted to build up the sugar in my body. I had written to my fiancé in New York and told her that things had changed. She showed up in Colombia. The bank was having a big party and I ended up with Hazel and my fiancé in the same room. I just about died. I said to myself, "What have I done to deserve this?" I managed to make it through the night. I made the break with my fiancé and she went back to New York. Hazel's dad came over all the time while I was sick. He taught me to play bridge and he spent a lot of time with me. I think he was trying to make sure that this thing was real. His name was Edward Pierce Roskruge. Let me interrupt here to say that Hazel's biological father was German who I think was connected with the Colombian Air Force. When the world war came, he was called to duty back in Germany. Then Edward Pierce Roskruge married Hazel's mother. He was a wonderful Englishman and always very correct. I fell in love with him right away. He was there when I needed him. Anyways, so I managed to get out of bed to get married. We had the wedding in her house with a Catholic priest. It went well but Hazel had an affinity 29 for dolls. She had a huge doll she loved that she wanted to take with her as we were packing for the airport. I said, "No way, you're not taking that doll on that plane." ROH: How old were you two when you got married? EB: That was 1952. I was thirty years old and Hazel was seventeen. Anyways, we got to Barranquilla, which is a seaport at the head of the Magdalena River. Hazel took to married life with vim and vigor. She learned how to cook. She was a wonderful hostess. People there loved her. She became very active in the American Woman's Society. At that time, we made a lot of friends in Barranquilla. They had an international golf tournament one year and one of the players was a young man named Arnold Palmer. We were privileged to meet him and have drinks with him. That was the beginning of his career. My mother and father came to Barranquilla to visit over Christmas and that was a real treat for them. At those times, I rode the city bus. We didn't have enough money to buy a car. At one point, we were in dire circumstances financially. Hazel's father had given her a very expensive bracelet with gold in it and unbeknownst to me, she went to a pawn shop and sold it. When I found out, we went back to get it but it was gone. It was tough in the early days, but it was a learning process. My supervisor was from Brooklyn and from the old school. He was very gruff. He and I had several personality clashes. He would say, "This is the way we're going to do it." But I had a feeling that my ideas were better. When we got to the point where we didn't get along, I would go take a walk around the block 30 and then come back and sit down. He knew what he was doing but he did it with the old style. He hadn't arrived into the twentieth century. Among the American counselors was a gentleman named Harry Shlaudeman, who was a vice council and a super golfer from Pasadena, California. Harry, through his career, became the right-hand man for Henry Kissinger in Washington. The head American council was an elderly Scotsman who loved golf. One morning we were alerted that he was missing. We looked for him for three days and eventually he showed up and said, "I just fell asleep." We really enjoyed life there. When it came time to start a family, I witnessed the birth of our first daughter, Sharon Elizabeth. Everyone said she was beautiful just like her mother. Our second daughter, Linda Kay, was born in Cali. We almost lost her but she survived. When it came time for us to move to Cali, Columbia, I had the title of Pro-Manager. It sounds better than it was. I had been a sub-accountant. ROH: Why did they call you a sub-accountant? EB: It was something to show that one was just starting a banking career. We got our orders to go to Cali, Colombia. Cali was a wonderful place and we settled into a very nice house and I became the second in command there. I eventually became manager of that branch, which was a big success. We were very prominent there. I was president of the American Men's Society and Hazel was president of the American Women's Society. ROH: Tell me a little about these societies. 31 EB: It was a consortium of Americans who were working abroad and assigned to Cali. It was similar to a Kiwanis Club. The Americans and some prominent Colombians worked together to promote service activities to the community. Cali was the a center for the production of sugar cane, which is a major source of income for the Colombian government. We also had many pharmaceuticals plants, Quaker Oats and other multi national companies. Political unrest and local violence were causes of concern. In one instance, we had gone to a cocktail party at the American councilor's home and when Hazel and I got back in the car, I said, "Oh, it's drafty." Then I realized someone had removed the entire front windshield of the car. After that we would go down to an automotive spare parts store and see our windshield and buy it back. It was petty thievery. Another thing was if you were driving in thick traffic and had your arm out the window thieves would take your watch off your wrist. Cali was in an earthquake fault zone. One night I heard this thunder like a train approaching the house. It was a tremendous noise and the house was shaking badly and shook for about two or three minutes. It was a major earthquake and there was a lot of property damage in Cali. The next day we had big cracks in the masonry of the house. We were very fortunate in the banking industry to deal with high class business houses and individuals. We also had banking relationships with the Colombian government. There were very little dealings with individuals. Kim, our third daughter was born in Cali. I never questioned the superb quality of medical facilities in Colombia. So, our third daughter arrived and I'd 32 send telegraphs to my mother and father, "I've got another queen in the family." The girls went to the American schools in Cali. All of my daughters had dual nationalities, Colombian-United States of American, until they were twenty one. They were brought up strictly by their mother in the Catholic Church. From Cali we were transferred to Medellin. People associate Medellin as the center of the narcotic industry in Colombia. At that time there were no problems with narcotic trade. The only political parties were liberals and conservatives. There was a fierce political battle which was a concern. We had problems with rioters in the street in Cali. We had to close the branch because people were being shot in the street. Castro arrived with Che Guevara in Bogota and from that sprung out these problems with peasants up in the mountains who were ill-prepared to make a decision. They entered the Colombian political system of 1949 in addition to the conservatives and the liberals. It was a problem if you were in the wrong place at the wrong time. There were instances when it was rather dicey to go certain places. An uprising would happen overnight and you would get caught unawares. But I do want to add that in Colombia, bull fighting was famous as it was in Spain. Bogota was very much connected to Spain. We still have films of bull fighting. My career was blossoming. I had been named manager of the branch, which was a major move. ROH: Can you give me an idea of the size of the branch? EB: I had over a hundred employees. The currency was pesos. When I arrived, the peso was at par with the dollar—if you had a peso, you had a dollar. When I left, 33 the peso was something like two cents to the dollar. It completely devalued. Much like what is happening in the United States right now, the government's economic policies were off-key. By the way, coffee represented a major portion of their exports and they lived off that, but they had almost every major natural resource but they lacked the funds to develop. They were passed by other world countries that didn't want to put money into Colombia at that time. So, the economics at times got out of balance at times. The Brazilian coffee was a lesser quality. The Colombian coffee was called "mam"; which meant "Medellin, Armenia, Manizales." That's the high grown coffee; the higher the area it grows the more valuable it is because it matures slower. Medellin was my next step. It was a larger area and more responsibility. It was the center of textiles for most of South America. Again, we were very favorably invited to join the community there. It was group of outstanding people we were associating with—both the Americans and Colombians. The manager of Citibank was on par with the American consul, as far as prominence, in any city we were in. So we were always on the top of the list as far as invitees for whatever might be going on. In Medellin, we had the fourth addition to our family. Sarah was born premature and it was almost a tragedy. The hospital there took such great care of her. There wasn't a minute when there wasn't a nurse there looking after her. That was our family. After our fourth daughter, I said, "That's it. I'm surrounded by women." But anyway, I think being in the international banking circle, you're dealing with people who are intelligent and sociable, usually the moneyed class. It was a 34 wonderful world. It encouraged you to step up and be a part of it. We dearly loved that. The one major incident when I took my life in hands was when I bought a car in Bogota. The individual had a late-model car for sale and I had to fly to Bogota to get it. My boss said, "What are you doing?" I said I was going to drive it back to Medellin. He said, "You're crazy." The road from Bogota to Medellin was undeveloped and had very few facilities. At that time, there were uprisings with the natives attacking buses, dragging people out and cutting their heads off. They called it "Corte de Franela." There were several massacres in that area. That was in the back of my mind, but I said I'd travel at night while they were asleep. So I left Bogota all by myself. I drove maybe seven or eight hours through areas where I saw nothing except a paved road. It was eerie and I kept thinking, "What am I doing?" I arrived in Medellin at about 5:00 in the morning. Hazel was thrilled that I made it. It was an idiotic thing for me to do. EB: Eventually, we sold that car and got a good price for it. Hazel was driving it about three days before we sold it and there was a truck parked with a piece of lumber sticking out of it. She went too close and the lumber went right through the front windshield and all the way back. She was okay. I went to the guy I sold it to and I was really upset. He said, "Don't worry. I can get a new one from Miami." We got a lot of letters from corporations saying thank you for the attention and help I'd given them as they got started in their business. I was on the board of directors of companies where we were involved in Medellin and Cali. They 35 wanted a local director with banking experience on their boards. They'd send the Chairman of the Board down to Colombia and I'd take him golfing. In Medellin, we were honored as a well-managed branch. I got letters saying that and that helped my career. I was a stickler for details and communication. ROH: Did you travel back to the states as part of your work? EB: No, we very seldom would go back to New York when we were in a foreign branch. Except when we were on furlough, I would normally spend a week or so in New York on my way to vacation. Hazel would take the children while I was in New York. I don't know how she did it—traveling with four young kids. She was a marvel. There was a group of expatriates in Medellin who ended up in Fort Lauderdale, Florida after their careers in Colombia ended. There seemed to be an exodus of American workers in Colombia going to Florida after. It had a Latin complex in Florida, and the weather was similar. After Medellin, I got a promotion and orders to go to San Salvador, Central America to be the manager of a huge branch there. They didn't have a house for us when we arrived, so we had the privilege of staying in a very high class hotel for about three months. That was a good life for Hazel. She didn't have to cook or anything like that. In El Salvador we had a problem with earthquakes. El Salvador lies right on a fault line. We had several earthquakes while we were there. Anyway, I was second in command at the branch in El Salvador. Our major clients there were coffee exporters, almost entirely. Then we also dealt with the Salvadorian government directly. We were on intimate terms with the president of El 36 Salvador. The ambassador to El Salvador was a gentleman from Phoenix, Arizona and his last name was Castro. He looked like a Mexican bandolero— black hair, moustache, had a gorgeous blond wife. He would call the American business leaders to a meeting on Wednesday and he wanted all the information he could get about what was happening so that he could report back to Washington. I was president of the American school there. We had Joe Borgatti, who was an innovative vice president. He did a lot of things of which nobody had ever heard. Nobody at CitiBank, at that time, had the privilege of having an airplane available to the chief officers. Joe said to them, "I'm in charge of Central America—Honduras, Guatemala, Nicaragua, Panama, and so forth. I want to get a plane." So we got a push-pull. It's a plane that has a propeller in the front and one in the back. One of the things I organized down there was a league of soccer teams. Citibank was the champion of the tournament. Two things while we were there. One was when President Lyndon B. Johnson was trying to form better relations with Latin America. They decided they were going to have a big meeting in San Salvador and invite the heads of state from Central American countries. Citibank was encouraged to be a part of this meeting. The Mexican embassy said that Johnson liked cuff links with coins from the country he was visiting, so I was assigned to get to the local jewelry store and get some coins that were delivered to him. We were part of the big entourage. We met the President and his wife and the two daughters. 37 The other thing that happened in San Salvador was the Chairman of our Board, George Moore, who was a genius in my estimation. He decided to come down with his wife, who was from a very prominent Mexican family. She was not very sociable. We decked out his room with flowers and when he walked in, he said, "Is this for my funeral?" He had all of the young, gung-ho businessmen in San Salvador come to the swimming pool at 6:00 in the morning and swim with him. Then he would have breakfast with them and talk about business. Hazel was in charge of a party for his wife. Hazel carried it off perfectly. The two big events were that we were going to take them around in our plane and show them Honduras. The plane was small and Mrs. Moore was rather large, so when we went to get on the plane, she said, "George, you think I'm going to get on that plane? Never." She walked off. We had to run around and get a commercial plane to take them. The crowning event was a party on an island resort owned by the coffee barons. I happened to be walking along the path and Mrs. Moore crossed in front of me and she wanted to sit down. I suggested she sit in a hammock. Well, she got in the hammock and it broke. She's on the ground and said, "Don't touch me." I said, "I'm going to get fired whatever I do." I didn't dare touch her. She rolled off and dusted herself off. One of our prominent clients was elderly but liked to fly. He flew his own plane over there, but the weather worsened. He insisted he was going to fly back to the air base. His son told him not to so he took off unbeknownst to them. He took off into the clouds and got lost. The Salvadorian air force had to find him and guide him down. 38 There was a war of sorts between Colombian and Honduras. They called it the "soccer war." They got very serious about soccer. I think the end result was a Honduran plane dropped a bomb in the ocean near a port city. There was no actual exchange, but there were a lot of words. The president of the country would ride around on a motorcycle; he was very flamboyant. He would come to our office like that. But the people we dealt with were delightful. Most had made their money exporting coffee. We carried a lot of memories out of that. A lot of our clients were from the moneyed class and they didn't want to deal with Salvadorians or Hondurans or Colombians for tax reasons, so they wanted to confide in us. We were an intermediary. ROH: How long were you in El Salvador? EB: Three years. I was the manager and we had about twelve officers reporting to me. ROH: Did you have the young rookie kids like you coming up through the ranks? EB: We had people who were doing what I was—coming up through the ranks just two steps behind me. We always had trainees or American staff. Then they decided that I needed to go back to the domestic side, so we packed up and ended up in Wilton, Connecticut. The agent who sold us the house was married to a man who was a Citibank manager. We had minimal funds to invest; I still was not making any money. But we let her take us around to see houses. This was 1965 or 1966. She asked how much money I had and I said I had about $46,000. So she started showing block houses to Hazel. Hazel didn't like them. Nora said she had another that might be available. It was a two-story colonial 39 home with two acres of woodland with an immaculate four bedrooms. It was everything you'd ever want. Hazel wanted it. Nora said it was out of our price range. Hazel said, "That's my house." We managed to get that house in the low-forties. It was idyllic. In Wilton, I commuted on the New Haven railroad for five years. I think it was from 1968 to 1973. I was working in our head office in what we called the Overseas Unit for Individual Banking. People from all over the world would come in and want to talk about their money in Liberia and Japan, and so on. I worked in that area during those years. Wilton was a wonderful area. The highlights there were two intercontinental trips from Wilton, Connecticut to Long Beach, California in a station wagon. Those trips were classic. I told the girls that they'd seen the United States from thirty-thousand feet but that they hadn't really seen it. Well, we got into the station wagon, loaded to the gills, with the four girls in the back trying to get comfortable. We'd go from one stop to another and see things along the way. We always stopped at the Holiday Inns and the girls went straight to the pool. We traversed the country and saw everything. The girls saw America and it was a great growing-up experience. My parents lived near Long Beach and whenever we went there, we went to Disneyland. The cross-country trips were invaluable. I kept them on their toes with games like, "First one to see a white horse or a yellow Volkswagen gets five cents." It was something that created memories. All of them talk about it. One memorable trip, our youngest, Sarah, was about five or six years old. We 40 stopped for gas and drove off and we were a mile away when we realized we'd left her. Nobody had counted noses. We got back and she was crying. It was one of those things. Hazel and I fell in love with Disneyland, too. On our fiftieth anniversary, we all went to Disneyland and they bought two blocks with our names on them in the area where they sell your name and it's there for eternity. ROH: When did your parents move to Long Beach? EB: After I left home. My dad had several close friends who had moved to Long Beach. Dad became an avid golfer at sixty-five and played almost until his death. My brother had lived there most of his life. My sister did very well there. Those trips across country were something else. The girls graduated from Wilton High School. Then they got ahold of me in New York and said, "Ted, how would you like to go to Monrovia, Liberia? We've got a branch there that is the central bank for Liberia and we also do international banking from there; it's an important link for us in West Africa." I went home and told Hazel. If I had been married to an American, I think I would never have had the opportunity to go because an American woman probably would not have adjusted. Hazel said, "Let's go." We got out library books and I got a post report. The first thing that caught my eye was that we had a house in a fifteen-acre strip with six other houses. That area around Liberia contained six of the most deadly snakes in the world. That influenced Hazel to buy riding boots for all the girls so that when they walked through the grass, there would be less of a chance they'd be bitten. There was also a lot of malaria. Our doctor gave us pills, which I think affected us all later in terms of our eyesight. We arrived there with a 41 dog and a cat. Our house had a river behind it that contained crocodiles. There were other animals, like apes and things. We were in the middle of an animal kingdom. When I got into the branch I got a shock. I didn't have a problem with blacks, but it was a cultural shock to walk in and see everyone in the branch was black except the manager and me. There was an adjustment there. We settled in and found out that we were the kingpins as far as the American banks there. The president of Liberia thought nothing of coming in at whatever hour of the day or night and saying to the manager of the bank, "I'm going to New York. I need some traveler's checks." We'd have to open the branch and get that for him. We had a problem with labor relations. The employees decided to strike because their white managers did not understand them—that was I and the other manager. We were in the hot seat there for a while. Hazel developed a friendship with the wife of the President through the American Club. They had a graduation ceremony and Hazel loaned Mrs. Tubman one of her chairs to sit on. During the ceremony, the lights went out and it was raining cats and dogs. They brought out some lanterns. It was a comic graduation. We were invited to a wedding of one of our employees. We were the only white couple there. When we saw the cake, there was a colony of ants crawling over the cake. The cultural shock—you learn to adjust to it and get involved with it. They had golf there but the greens were tarred, they weren't grass. The caddies didn't wear shoes so they'd go out into the rough and pick up 42 your ball—which is illegal in golf, but they wanted a tip—and there were snakes all along the fairway. From time to time, we would transfer money that was depreciated to the central bank. We had a cash officer and two guards when we took that money over to the central bank. On one day, we had branches up-country and he went to the cash officer said he wanted to take money over; I asked how he was going to do it. He said, "Our two Monrovia trucks are busy, so I'll get my chauffeur and my car and get a guard from the bank." I said, "So be it." So they drove over and parked in front of the Monrovia Central Bank. The guard got out and the driver stayed in his seat. Before the guard could get the money out of the car, the driver took off with the money in the trunk. We found the abandoned car. It was a national catastrophe—it was all over the news and all the borders were closed so they couldn't get out. For two days I was waiting. New York told me I'd better get the money back or I was in trouble. So, the guy who stole the money went to his brother's house and they buried it. The one who stole the money took enough to get to the Ivory Coast for vacation. There are two episodes. The guy with the money waiting for a taxi to take him to the Ivory Coast that's fifty miles away. The taxi driver said, "You haven't got enough money to get to the Ivory Coast." And the guy said, "Here." He put the money on the seat and the taxi driver drove off with the money. This is comic. Well, they got a hold of the guy and shook him down and he admitted to where the money was. It was wet and they were digging it up and all the bills were sticking together. So the Treasury Department said, "You've got to be down there 43 while we count this money." I spent three hours there while they were peeling dollar bills to be sure we got all the money back. Another thing—and this one was scary—Hazel and I, and our daughter, went to a show down in the center of Monrovia at night. Coming back, the car stopped. Hazel and our daughter pushed me over the bridge down to the bottom where there was a house. I knocked on the door and a guy came out. I said, "Here's ten dollars, if that car is still there in the morning, I'll give you another ten dollars." We took a taxi home. The funny thing was that our daughters were dating and they wanted me to take them into town. The roads were very narrow and had big drops. This was tribal country. So I'm going along the road at night and I see this car coming towards me on my side of the road. There was no shoulder and I dropped down about ten feet into a ravine—still upright with two of the girls in the back seat. Within five minutes, there was a tribe of indigenous people swarming the car. I thought we were going to be cannibal soup. Well, it took about twelve of these guys, but they helped get the car back up on the road. The compound had a guard at night. One of our junior officers was coming in at night and he went over to him and shook him. Well the native went over to his tribe headquarters and said he had been assaulted by an American. The tribal chief ordered that this man be arrested and go into a tribal court. The bank immediately said, "That's a problem." The only way we saved him was to transfer him out of the country. Then we had an incident of inside robbery. Hazel and I were sleeping in bed with our golden retriever next to me. My wallet was two feet from me. The 44 next morning I woke up and saw my wallet was gone. What had happened was we'd had a thief who had come in with a screw driver and broke through one of the windows. He got into our room and the dog growled but we didn't pay attention. The thief stole my wallet, then went down to the St. Paul River, took everything out and dumped the wallet. At that time, Liberia was ruled by elitists, the people who came by boat from the United States. They had the money and they ran the country. About ninety percent of the people had no money and had been kept under control by the people in power. Just after we left, they had an uprising where they took the president and his cabinet down to the beach, stripped them to their skivvies, and shot them. They gunned down the President of Liberia and eight counselors. That was when this John Doe became famous and was running the country and now things have calmed down. But it was a very serious uprising of the have-nots. Mind you, when they had a parade, they wore top hats and they wore canes—they didn't have any guns. It looked like Laurel and Hardy. We were there about three years and we were packing up to go back to the States—we'd about had it at that point. ROH: Were you doing better financially by this point? EB: No, we were barely hanging on. Anyway, we were scheduled to go back to New York after that tour and one of our senior officers from Athens, Greece was in Liberia visiting. I was talking to him and said I didn't want to go back to New York. He said, "Okay." And the next thing I know, my superior at the branch said, "How 45 would you like to go to Beirut, Lebanon." Well, there was a war going on there. But again, Hazel said, "Okay, let's go." It was eerily quiet when we landed at the Beirut airport. The taxi driver took us to the Bristol Hotel, which was one of the best in the city. We registered and Hazel and Sarah were the only females in that hotel for about three months. They were treated royally by the staff. It was an indication that it was a very dangerous situation. One day Hazel and I decided to go visit the ruins in Syria. Word got around that Boyle and his wife were going to visit the ruins. We got in a taxi with a reporter from New York. We rode up into the area occupied by the Syrian army. We got into Baalbek and we were stopped by Syrian police. They took our passports and wouldn't give them back until we left. The ruins were spectacular. We were the only tourists in any form in that area. We had so many near-misses in Lebanon. They burned the American Embassy. We were located on the Mediterranean in a high rise. We were on the seventh floor and there was a Saudi prince on the eighth floor. Unbeknownst to us, we were in a PLO area—the western side of Beirut was headquarters for Yasser Arafat. We had a bank there called the Bank of Lebanon and Kuwait. It was fifty-fifty with the Kuwait royal family. Our principle objective was to recover investments for our clients because of the war. We were in a tenuous situation. One of the most dangerous things I've ever done—I was obliged to do it. We had branches on the east and west sides of the city. The west was the Muslim side and the east was the Christian. There was a dividing line between them. At one point, the leaders of the Lebanese government decreed that they 46 were going to get some insurance money from the bankers in the area for protection purposes. They approached our offices on the east side and said, "We're going to keep people around here to protect your branch, but it's going to cost you this much." It was not a threat, but in order to continue to bank without being hustled or having people break into the bank, we sent the proposal to New York. They said, "Absolutely not. We cannot be taken to court on that type of issue. Just send down an ultimatum: we do not accept these terms." Well, someone had to take that message to the people in authority. We drew straws and I got the short straw. They said, "Ted, you are going to be an emissary. You're going to drive through an area that's highly contested on both sides and you're going to carry this message personally." I had to go down this road with enemies and firepower on both sides. We stopped near the headquarters of the Lebanese presidency. We were searched and they sat me in the hall to wait. One of the men that was ruling the country had been educated in the United States, so he had an English background. I was brief about it. I told him, "This is what has happened and we've been advised by our headquarters that we cannot do this." He said, "I understand." He shook my hand and I walked out. That was scary. With all this going on, it was very dangerous. Quite frequently, Hazel and our daughter would be flown down to Athens and I'd stay behind. When I'd get to go to Athens, I'd stay over the weekend and come back. The pilot would say, "I've got to find out which runway is open. There's firing on the north side, so I'm 47 coming on the south side so we won't be hit." While we were flying in, there were missiles flying around the airport. ROH: What did you think of Athens? EB: Athens was a dream come true. I had seen a little of the ancient history when I was in the Air Force in Tunisia—the aqueducts and all that. But when I walked around there, I just felt eerie, like it was unreal. It was hard to imagine the history that you were walking around. When we left Beirut, we didn't find out until we were ready to go that our body guards and the people who were hanging around in the lobby all the time were PLO—they were protecting us, unbeknownst to us. The golf course in Lebanon was laid out on the edge of the PLO firing range. The ambassador, I was told, carried a machine gun in his golf bag when he played. We had shrapnel coming down on us while we played. ROH: Did you have friends there? EB: Thanks to Hazel, we have had friends everywhere we've gone. We were involved with the government because of the banking industry. They had the American school there and this is where Hazel and our daughter were baptized. I got the idea, having bombed Europe and seen the desolation and the destruction, Beirut reminded me very much of a destroyed city. They had destroyed the business sector. Buildings were derelict. It was a mini world war for me. ROH: Did that cause problems in business for you? EB: Oh yes. This was an extreme case of merchants who took advantage of the situation and refused to pay us back. Recovery of assets was very difficult. They 48 knew what the situation was and we had very little clout. You never knew who would be the governing body. We were going to the airport, leaving Beirut, and our driver, innocently, drove through a road block of Syrian soldiers. They were ready to shoot us with machine guns. Another car drove into the line of fire and stopped—in other words, they couldn't see us anymore. He overtook us down the road and said, "I saved your life, what the hell were you thinking?" Our driver thought they were telling us to go on. That was our departure from Beirut. We went from there to Karachi, Pakistan. That was in turmoil too. The president had been convicted of crimes and they were going to execute him. They had killed several marines in our embassy in Islamabad. We got word from New York to get out of there. Hazel and our daughter were flown down to Athens again. I went underground with our people. It was a very tenuous situation when we first got there. There was a lot of demonstrating in front of the bank. Again, our bank worked closely with the government. Pakistan is famous for its textiles. They had an industry down on the coast that broke up old ships that were battle-worn. There was a big industry there for that. They had oil deposits, too, but textiles were their strongest industry. The entertainment there was centered around the American school, which was a premier school. In fact, the Pakistanis who had money would be on waiting lists for years to get their children in the American schools. I was on the board there. In fact, the head of that school was here recently in a tennis tournament for seniors—Tony Horton. He had traveled all over the world as the head of 49 American schools. We had, again, a very closely knit community. We were there for about three years. ROH: Was it better than when you were in Beirut? EB: Oh yes. There was an underlying community of the have-nots. The countries we were in at this time had a high rate of poverty. As a result, there were riots in the cities. It was a learning experience again. ROH: At this point were you thinking about retiring? EB: No, I was still active. I had become a resident vice president. My duties were managing our portfolio—the quality of our loans and making sure people were paying and all that. We took several tours up into the area where the book Three Cups of Tea was written. We were in that area, not quite as high as he was. It's very rural. It was kind of scary in a sense that there wasn't a real feeling that you didn't belong, but you had a feeling that you might be better off if you weren't there. The populous in Karachi was horrific in terms of slums—water and sanitation was a horrible mess. I understood why the have-nots had uprisings. Of course, spinning off from India, there was always a feeling that India was their big rival and there was a fear that India would come after them, and then they had the nuclear problem down there. Pakistan was a tinder box. After Pakistan, we moved over to Riyadh, Saudi Arabia. That was an eye-opener. The bank there was called Saudi-American Bank. It was fifty percent owned by Citibank and fifty percent owned by the royal family. We also had a subdivision for females only. There wasn't a male teller in that division. We had 50 lots of meetings and instances—one where we had a Saudi princess with a lot of money who had a farm development out in the desert. They desired to have their own wheat, which cost ten times as much as it would have to import it from Canada. They have pivot wheels out in the desert with the wheat growing out there, and then the Saudis would have their estates out there. I was invited by a Saudi and the princess arranged for a luncheon. She had about sixty pieces of chicken for three of us for lunch. Our dealings there were really something. If you invited a Saudi of any importance, the wife never came. You never saw their wives in a social engagement. And there was enormous segregation. One of the things they told me was, "If you're driving down the street and a Saudi runs into you, you're liable. They say it wouldn't have happened if you weren't there." The philosophy is that you caused the accident because you were residing in their country. I had a terrible incident there with my health. The Saudi hospitals are staffed by Americans and have our equipment; it's just like an American institution, but only Saudis can utilize those services. My condition worsened and it was decided that I would leave the Kingdom. Our driver took us to the airport and I found that I had a missing document. They said I had to go six blocks to another location to get the document, but the plane was on the runway taxing without me. We raced over and they actually held the plane for thirty minutes for us. I was on that plane for thirty hours in terrible straights. But what I'm going to say is that if anyone in the royal family has hay fever, they head to Walter Reed hospital and take up a whole wing. 51 We dealt with Osama bin Laden's father. He was one of our biggest clients and continues to be one of the biggest powers in industrial equipment in Saudi Arabia. I can't document it, but I think Bin Laden was employed there in Saudi Arabia while I was there. It's funny. You don't have any poverty in Saudi Arabia. It's set up so that if you get in line and go tell the king you need a washer or whatever, he gives you the royal handshake and gives an order. You don't see poverty because the people with oil money keep the populace happy with that type of thing. They say, "Hey, I've got money." But religion—if they think that you are even getting together for religious purposes, they kick you out of the country. They consider that a deterrent to the kingdom. So Hazel and her friends would have secret meetings. They were told not to park close to the house, they would walk so that no one would see the cars together and think, "We got one." Our Air Force guarding the kingdom is a deterrent to the kingdom being overthrown. I think, militarily, our presence has been a big thing in saving the kingdom. Another thing that's interesting is once the Saudis get into the Saudi planes, they'll exchange their royal robes and put on their jeans. ROH: While you were there, was your daughter still with you? EB: Our youngest daughter was a threat—in other words there were restrictions that a young female could not enter the kingdom. They didn't want any western women walking around with the Saudi boys looking at her. So she couldn't get a visa to get in. I don't remember, but I think their laws prohibit interest on loans, making it extremely difficult to bank at a profit. You had to protect yourself with 52 collateral outside of the kingdom because the laws there would make it so difficult to foreclose on a property. You have to play their rules. It's an extremely difficult area to bank in. After Saudi Arabia, we came back to Wilton, Connecticut. At that time, I was approaching retirement and I took an early retirement there. I was sixty-two. ROH: What position did you hold at the bank? EB: I was Vice President for Citibank. ROH: Were you finally doing okay financially? EB: I've always thought in terms of the investments and stocks. Over a period of forty years or so, I've been fortunate. But you have to be patient. The average investor today with this market and all this growling about Wall Street and what's wrong. But what do we produce now? We've lost our keys—we were the kings of electronics and technology. We've lost everything where we could say we dominated. I think most of it is a labor factor of the cost value. You cannot compete with China and India where the person is making a dollar or two dollars an hour but Detroit wants fifty or sixty dollars for the same product. But I want to talk about several vacations. We went to Cairo and went down the Nile on a houseboat from the Aswan Dam clear to Cairo. Doing everything that tourists do with all the royal burial grounds. We got off at Luxor, which is kind of a tourist trap, and Hazel wanted to get a cartouche for each girl. While Hazel was dealing in the jewelry store, the owner of the shop came over and said, "Mister, I give you a hundred racing camels for your wife!" [Laughter] 53 Racing camels were thousands of dollars; it was millions he was talking about. I told him, "Give me a few minutes to think about it." That was hilarious. Our trip to Nairobi, Kenya was fantastic. I've always thought about big game. We got down there with three of our girls and we decided not to go with a guided tour. We got out to the base of Mount Kilimanjaro and we were right in the middle of all kinds of wild game. The next day I decided to go out in our car, by myself, and find the animals. I was going along the trail and low and behold, I see three lions loping by the side of the car. We've got pictures of them. Anyway, we got in there and saw lions, elephants, and rhinos, you name it. On the way back to Nairobi, I tried to drive through a dry lake bed but it was sandy and we got stuck. I finally got onto what you'd call a road and one of the girls smelled gas. I stopped and found that the gas line had parted. The girls put it together and put some gum around it to patch it. We stopped in a village of Masai natives who were about six feet, ten inches tall. We are the only white people in the village. They all had spears and red paint. We dealt with them and got a couple of spears from them. When we got back to our hotel, we headed out towards Mount Kenya. It was a very sumptuous place which was owned by a famous movie star—William Holden. It was like an Elizabeth Taylor movie—there were all these natives with turbans on and holding rifles. At night, you had a fireplace in each cabin and they'd come in and light the fire. It was, again, something out of a fantasy land. 54 Going back with the same car, the car was stopping and starting. We had to coast into Nairobi. We lucked out. But that trip was worth a million dollars. We really roughed it. ROH: Did you hunt while you were there? EB: No, that's too expensive. We did it on an economy budget. The other tourists would get on a bus and see a lion off in the distance, but we had them running right alongside of us. That was something. We spent several vacations in Switzerland. We had a close friend from San Salvador whose husband was a hotel manager. He had a chalet in the Swiss Alps near the border with France. We spent a Christmas there. Switzerland is very orderly. They have a lot of rules and regulations, and it's hard to get in, but I said to Hazel I would live there. Then we spent a Christmas in the Spanish Alps. We did Spain while we were in Saudi Arabia. We saw bullfights and where they grew the wine and all that. We went into Russia during the Cold War. It was 1976. The big thing there was a train ride from Moscow to Leningrad overnight. There was supposed to be an elite coach, but there were four bunks—no beds. Hazel and I and Sarah got in the train leaving the station and a middle-aged Russian male came in and said, "Mine," and pointed to one of the bunks. Then he stripped down and went to sleep there in our cabin. I thought that was hilarious. We were an oddity in Russia. We were at the Kremlin looking at Lenin's tomb and they were parading some of their Mongolian soldiers all dressed up. Hazel was standing around and a Russian lieutenant came up to her and said, "I take you." He served as our 55 guide and took us up through this church we wanted to see. Then we had our English speaking guide, an attorney. I said I wanted to give him something and asked if I could give him money. He said, "Absolutely not. They'll put me in jail." But he said he liked my jeans. So Hazel and I left a package on the back seat of the bus with my jeans in it and he picked it up. ROH: Where haven't you been that you might want to go sometime? EB: I think Australia. We were in Thailand and Hong Kong. I admire the Australians. I lost one of my best friends in the battle with the Japanese down there. My dad used to sing from South Pacific. I'd like to go there. ROH: You were very successful in the banking industry. What do you attribute your success to? EB: I think it was doing the right thing, first of all. No monkey business and a perseverance in cultivating human contacts—relationships with your staff so you didn't talk down to them. Like when we went to Nellis Field and a general came out in a flight suit like a normal trainee and I thought, "That's success—getting down in the trenches." Assimilating customs of the people and trying to understand what makes them work. In other words, why are we banking here, what do they want from us, and how do we go about it. I think relationships and how you treat people are prime—also, towing the line. We went where we were told. I attribute that to my wife because she was very flexible. Without her, I may have stayed in New York and not done any of this. The minute I said, "Pakistan," she said, "Okay." There was never any discussion or complaining. I attribute my success to my wife. She was with me in the trying moments. You have to have 56 support. Now that I've been talking to you, I've asked myself, "What if I had stayed in Ogden?" I could very well have been a salesman for Boyle Furniture for the rest of my life. It's hard to picture who was pulling the strings. Hazel always said God was looking over us and I think she's right. I think somebody was directing us through all this that we did. That's my problem now, I've run the mill and I think I have no more bridges to cross as far as advance or travel I'm content to just kind of sit back. Here in St. George there is a difficulty of communication because of where we were and what we did and our thoughts and perceptions. A lot of times, people turn you off; they're not interested. You get the idea that they want to talk about the local scene and the lack of water here in St. George. If our leaders would at least look at the world and look at what makes the world go 'round—and I stress religion—and try to understand civilizations that have lived according to the Quran for thousands of years and overnight you want them to change and you said, "We've got something better than what you have." I don't like isolation. I think we've got to understand what makes the world go around. China, Cuba, trade wars, and now they're undercutting us—so what? They've done the right thing; let's learn from them. What are they doing that we're not doing? What happened to our manufacturing abilities from the '50s and '60s when we were king of the hill? I think a lot of it is political, unfortunately. But I just wonder where we are headed and what our children's future will be. ROH: Do you keep in touch with people from Citibank? 57 EB: Oh yes, I have a lot of friends in Florida who I met in Colombia. I have my ex-boss in San Salvador and New York. He owns a bank in Bulgaria. He's been featured in Fortune magazine because it's the best bank in Europe. Joe Borgatti was my favorite. He was down to earth. But you get other people who get ahead of themselves because of their title or they want to isolate themselves from you and make you a lesser factor in running the bank. I've had some wonderful associations with people above me and I've had some I didn't like. ROH: What do you think about the changes that have happened with Citibank since you left? EB: We started out with the Rockefellers. In fact, Citibank is the oldest bank in New York. Through the years, leaders of the bank came from high society and we had people in there who were bankers by trade and by inheritance and they stayed the line; in other words, they held on to tradition and what we were good at. There was no variance. We had enormous control over our assets by our auditing departments. We held on to tradition under George Moore and Walter Wriston, then John Reed who was a genius but had a failing in personal communication. After Reed, you drop off. He was the last of the Mohicans. Next you get Sandy Weil who brought all of his ideas about insurance and things we didn't normally get into. He wanted to build an empire and we lost control of what we did best. Sandy did a tremendous job of building up assets, but he lost control of the inner workings and delegated too much. Then they made a bad mistake in naming Prince the president. He was an attorney by profession and knew very little about banking. We got off track. There was a law earlier that prohibited 58 banking activities outside of a certain area, like the derivatives and things we got into later. The derivatives were the downfall, they were dealing with assets they had no control over. I think Citi Group will survive because of all the help from the government but it back-fired. The major corporations, who used to be the pillar for the banking community, now have their own in-house bank. A depositor asks, "Will my money be safe with Citibank?" This goes right back to the economy. We don't have jobs and there's no money in circulation. ROH: How did you decide to create an endowment at Weber State? EB: "I have accepted this assignment with immense feelings of inadequacy, humility, and privilege, keenly aware that the man we honor and memorialize here today was, and is, a giant whose character, thought and deeds can never receive can never receive justice by the mere force of human utterance. Dr. Jennings G. Olsen is the only person I have ever known who is unqualifiably deserving of the title genius. One who, in fact, came closer than any of my acquaintances, of being a man for all seasons, as was said of Thomas Moore. Indeed, a virtual superman. I was an eighteen year old freshman just out of high school, anything but passionate about the need for an education. Wet enough behind the ears to have narrowly escaped drowning, my friend and new found mentor Jennings G, on the other hand, a man of twenty-five soon to receive his doctorate in philosophy from UCLA, had even read and absorbed more than most academics do in an entire lifetime. Along with the rest of my fellow students, I promptly found myself astounded by his incredible knowledge and memory, prodigious vocabulary, and his uncanny ability to quote chapter and verse from everything 59 and anything he had ever read. Even more importantly, his power to analyze, synthesize, and contain this ever-growing information within a context amendable to the humblest of intellects. Impeccably dressed in starched white shirts, ties and a sport coat, slacks inevitably pressed to a crease that would cut your hand, his cheery countenance well-scrubbed and glowing with vitality. Jennings was also the quintessence of organization. His lessons on Plato, Socrates, Aristotle, and other greats, such as Augustine, were always carefully outlined on the blackboard and completed with articulate and meticulously exact due. One of his oft-expressed mottos read as follows, 'Organization and schedule are the keys to success.' Nevertheless, his presentations were rarely limited to straight lecture and he made ample provision for student response through carefully inter-related and challenging questions that required us to engage in the unique experience of actually thinking." ROH: Who wrote that? EB: Gordon Allred. This is a eulogy he wrote for the funeral. I'll give you a copy. [See Insert]. There's a picture of him at Weber College in his younger days. Let me tell you, Gordon Allred's father was Thatcher Allred, who was in a department at Weber College who was a dominating factor in stage production. His mother was a poet. He came from a very talented family. I have a book that Gordon wrote about the Japanese Kamikaze pilots. He spent some time over there with a pilot who had survived. The book is spellbinding if you're interested. HB: I don't think you told them that he was born with a handicap. 60 EB: He was born with a club foot and he participated in pole-vaulting. Nobody knew about it unless you were an intimate friend of his. He never divulged that. He had a professional singing voice. He performed in operas and sang on television. People that knew him, like I did from day one, admired his ability to surpass all of his difficulties. But he never, ever complained. I think he was a little bit above the crowd and very intellectually powerful. Perhaps it was overabundant to the average student. He delved into the topic of the origin of life in order to show students that there were two sides to the equation, but he never pushed it. He went into Darwinism and just said, "This is something that people think about it. I'm not telling you what to think." He opened their minds and wanted people to be able to think instead of just being told. From my perspective, Hazel and I had nothing to do with Weber State. Then we went into Ogden one day and saw the campus there and I decided to go take a look. Carol Biddle was the catalyst. I walked in to her office and I said, "I'm Ted Boyle and maybe I have some money to donate." She said, "First thing, I want you to read this book by Sadler." So I went home and read that book from front to back looking for indices of Jennings Olsen. There wasn't a single award. I noticed the lesser degree people were getting awards and I said, "What happened to Jennings Olsen? Why isn't he mentioned somewhere?" That triggered my interest. I went back to Carol and said, "I want to do something for Jennings Olsen." That's where it started. I think Jennings was probably not a sociable person. I think he may have isolated himself in his books and his will to increase 61 his knowledge of religion and the world. It was just his background. He came through hell and high water and he was a person who should have been eulogized at the highest level—with his physical problems and coming from kind of a broken home. I really think that Jennings was so worldly that Weber County wasn't ready for him. He got his doctorate from UCLA and I think he would have been president of the university there. I think he was misplaced and in this community he was misunderstood. He didn't get the recognition he deserved. ROH: You've created that recognition. EB: No, I haven't, and I am so displeased that not one dollar from his staff, his friends, his family—there hasn't been one. I say, "What am I missing?" You would have thought someone, in the total time he taught there, would have said, "He taught me something and I'm going to put ten dollars in." I'm being facetious. ROH: You should get credit for stepping up. EB: It's still not recognizable as something that is popular. I think it's something that's there, but it's not an attention-getter. I really think that Dr. Olsen was in the wrong place at the wrong time. His manner of attacking world religion and making people understand where we all came from. All he wanted was for students to open their minds and think. He wouldn't tell him it was right or wrong. I'm disappointed because I think I tried and there's nothing to show for it. I thought maybe it would catch fire but I think it's going to die a natural death. ROH: It's there and people can find it. We appreciate the fact that you did this because I, for one, wouldn't know anything about Dr. Olsen if not for you. But each person 62 who gives to the university does it in a way that they are passionate about. You never know what's going to happen. EB: Maybe someday it'll be like when they resurrect these ancient scholars. Unfortunately, he didn't produce any work of his own. I have personal letters but I don't know if they should be made public or not. We were so different—he was an intellectual and, as I told you, I barely got passing grades. Maybe opposites attract. ROH: Is there anything you would like to add before we finish? EB: I'm infatuated with Ogden still, though I've left, and I want to know what happened to the Ogden I knew in the 1930s and 1940s. I can imagine it was the railroad departure and the entrance of the supply depot and Hillfield. Maybe it attracted a lesser culture. But it was king of the hill—people from Salt Lake traveled to Ogden to shop. It was a place of honor. As Tom Brokaw said, "The greatest generation," I think the class of 1940 from Ogden High was the class of a generation. I'm not being facetious, but that class had more activity and more people who were going places and doing it with little resources. The final shot is the Ogden Standard Examiner. I felt that in the 1930s, and 1940s, and 1950s, the Standard Examiner got inside of what was happening in Ogden—the people and what they were doing and where they were going. It was a very informative paper about doings. It seems to me that they've gotten off track now. You don't feel like you're a part of it anymore. ROH: Thank you very much for your time.

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Issue 11.3 of the Review for Religious, 1952. ; A.M.D.G. Reviewfor Religious MAY 15, 1952 Newman: Defender of Mar~y . John A. Hardo~ Custody of-,the Senses " Evereff J. Mibach" The S°acred Heart . ~. ~4;chaoIJ. Lap;e,re ¯ Quinquennial Directive, III . Joseph F. Gallen Questions and Answers Summer SesSions~ Book Reviews VOLUM~ XI NUMBER 3 RI::VI W FOR RI::LIGIOUS VOLUME XI MAY, 1952 NUMBER 3 CONTENTS CARDINAL NEWMAN, APOLOGIST OF OUR LADY-~ J~h~ A. Hardon, S.J . 113 SUMMER SESSIONS . 1 IGNATIANSPIRITUALITY Augustine G. Ellard, S.J . 125 CUSTODY OF THE SENSES--Everett J. Mibach, S.J . 1'~3 THE SACRED HEART: A THOUGHT FOR RELIGIOUS-- Michaei J. Lapierre, S.J . OUR CONTRIBUTORS . 150 THE QUINQUENNIAL REPORT: OBLIGATIONS AND DIREC-TIVES, III Joseph F. Gallen, S.J. 151 TEN YEAR INDEX--NOW AVAILABLE . 158 UNIQUE SCHOLARSHIP . 158 PIUS XII ON THE RELIGIOUS LIFE . 158 QUESTIONS AND ANSWERS-- 13. Restoration of Solemn Vows . ". . . 159 14. Dispensation from Eucharistic Fast . 160 15. Revenue from Ceded Property . 160 16. Is Ranching Permitted? . 161 17. Prescriptions for Privacy . 161 18. Obligation to Confess Doubtful Sins . 162 VOCATION PAMPHLETS . 162 BOOK REVIEWS-- The Mystical Evolution in the Development and Vitality of the Church; The Breviary Explained . 163 BOOK NOTICES . 165 BOOK ANNOUNCEMENTS . 167 REVIEW FOR RELIGIOUS, May, 1952. Vol. XI, No. 3. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Jerome Breunig, S.J.; Augustine G. Ellard, S.J.; Adam C. Ellis, S.J. ; Gerald Kelly, S.J. Copyright, 1952, by Adam C. Ellis, S.J. Permission is hereby granted for quota-tions of reasonable length, provided due credit be given this review and the author. Subscription price: 3 dollars a year; 50 cents a copy. Printed in U.' S. A. Before writlncj to us, pleas~ consult notice on Inside back cover. ' Cardinal Newman, :Apologist Our,La y, . Joh'n A. Hardon, S.J. IN THEIR formal prote~t in 1950 against the definition of Our Lady's As, sumpt!on, the~Anglic~n bishops Of England declared,. "We profoundly-regret that the Roman ~Catholic Chm:ih has chssen .b~; this act to increase dogmatic differences in Christendom a'nd has thereby gravely injured the .growth of understand!ng be-tween Christians based on a common possession, of the fundamental . truths of the Gospel." ¯ (London Times,. August 18, 19 51J.). We may assume that the'Bis.hops of Y, otk and Can[erbur'y were sincere in m~aking-this decli~ration, but how should we estimate and deal with their attit&de of mind, which is so common among ,Chris-tians out'side the true Church? Why should, faith in Mgr}', as one~ Prote.stant theologian phts'.it, be the "swordof separation", between .Catholic and non-Catholic Christianity? Fortu_nately we havean excellent guide ifi this matter in "Cardinal Newman, ~ho himself ~p~ssed through all the stages of-p)¢judi~e'ag'ainst Catholic devotion to.the Blessed Virgin !VI, ary, and finally became an outstan.ding de-fender. of her dignity against the attacks 6f.her enemies. " Newm, an'~ Anglican Deuotion to Ma~rtt ' Newman became a Catholic in 1845, afte~ forty-fou~ years in the established Church of England. L.oqg before his conversion,' however, 1~ was already devbted to the Blessed,Virgin Mary. Among the ~arly, influences in his life at Oxford .was Hurrel[ Froude who "taught me to look with admiration towards the Church of Rome. He fixed deep' in me the idea of devotion to the Blessed.Virgin." Froude had "a high. seyerefidea of the intrinsic excellence of Virgin-ity: ¯ and be considered the Blessed. Virgin 'its great Pattern.~' (A., 22, 23.) ~ - Througl~olat his Anglican. days, Newman often preached on the digni~y of.Christ's Mother, stressing esl~ecially her transcendent. purity and nearness t6 God. "He never.tired of repeating that Christ was born of a'Virgin "pure and.spotless.'" To his mi,nd, it Was in-lThe key [t~ the references is: A. Apologia (1~47) : P. Pdrochial and Pia~n Serf mons, II (1~18); L.'P. "Letter to,Pusey" in Di~culties o~-Anglicans (1907). 3OHN'A. HARDON Review [or Religious conkeivable that the only.-beg~tten Son of God should have come. into the World' as other men. "The thought may not be suffered that He,should have been the son of shame and guilt: He came by a new ~nd living way: He selected and purified a tabernacle for Himself. becomlng the immaculate seed of the woman, forming His body miraculously from the substance of the.Virgin Mary" (P., 31). On the Feast of the Annunciation in 1832. he preached a sermon on Mary's sanctity in which he was accused of teaching ~he Immacu-late Conception."That whicti % born of the flesh," he said, "is flesh." So that no one can bring what is clean from what is un-clean. In view of her prospective digr~ity-as the Mother of Christ, Mary was endowed Withgifts of holiness that are be~.ond descrip-tion. "What must have been the transcendent purity of h'erwhom the Creator Spirit. condescended to overshadow with His miraculous presence . This contemplation runs to a higher subje~t, did we dare follow it: for what, think you, was the sanctified humanstate of that human nature of which God.formed His sinless Son?" (P., 132.) Newman would not draw the illation, but his audience did. Later in life he referred tot this sermon as a witness to his abiding affection f~r the Blessed Virgin"Mary. "I hid a true devotion to the gl~ssed ViFgin.". he says, speaking of his Oxford. days, "in whose college I lived, whose Altar I served, and whose Immaculate Purity I had in one of my earliest printed sermons made much of"-(A. 149). Early Prejudices against "'Mariotatr{ ': Against this inspiring background, we are surprised to find cer~ tain blindspotsand inconsistencies in Newman's Anglican devotion to the Virgin Mother. Until a few years before his conversion, he hesitated to call Mary the Mother of God. Convinced, it seems, of the fact of her divine maternity, he could not bring.himself to give her this exalted title. The Son of God. he preached, "came into this World, not in the clouds but born of a woman; He the Son of Mary, and she (if it may be said)"the Mother of God" (P., 32). gome of Newman's critics have remarked on the length of time he spent in coming to a d~cision about entering the Roman Church. Ten, fifteen years before his conversi6n he' spoke of "the high gifts and strong claims of the ChUrch of.Romd on. our admiration, rever-ence, love and gratitude." He wbuld ask himself how a non-Catholic "can withstand her attractiveness, how he can "refrain from being melted into tendernessand rushing into commun'ion" with her, on Ma~ , 1.957. " OUR LADY, S DEFENDER beholding the Church's bea~;.,of doctrine and vindication of he~ Newman answers for himself. On the one hand he. found the Roman Church most attractive in her doctrine an'd ritual; on the o~ber hand be resisted her advances. "My feeling," he .confessed, "was something like that of a man who is obliged in a court of jus-tice'to bear Witness against a f~iend" (A., 50). There was a con-flict between "reason and affection," between what be thought hi~ reason told him against the errors of Rome, and what his si3ontane-ous Christian affections loved inRoman Catholicism. Now the strange fact i~i~hal~ Newman. reduced all his Anglican objections ~o the Chtlrch of Rbme'tb o,rie b~t~ic element in her system, namely, her devotion to" the saints and partictilarly to the Mother of God. "Writing as.a Catholic, he.says, "I thought¯ the essence of her (the Roman Church's) offence to consist in the h0nours which she paid to the Blessed Virgin and the saints, ,and the more I grew in devotion, both to the saints and to our L~dy, the more impatient I was at the Roman.pr~tctices, as if those glorified creations Of God ~nust be severely shocked, if pain could be theirs, at the undue ven-eration of which they were the objects". (A., 48). One¯day, as an Anglican. he summarized the pros and cons for becoming a Catholic. Point six ~n a series of nine is clear: "I could not go to Rome. while she suffered honours to be paid to.~he Bl~ssed Virgin and the Saints which I thought in my ¯conscience to be incom-i~ atible with the Supreme, Incommunicable Glory of the One In-finite and Ete'rnal" which belong solely to God-(A:, 134). Four years before his conve?sion, in 1841, he received an appeal from a zealous Catholic layman urging him not to hesitate any longer about submittingto Rome, when so little doctrinal difference separated the Anglicans from the true Church. Newman replied in a long letter, in which he said. "I fear I am .going to pain you by telling you, that you consider the approaches in 'doctrine on our part towards you closer than they really are: I cannot help repeating what I have many tim~s said in print that your ~ervices and ,devo-tions to St. Mary in matter of fact do rfiost deeply pain me. I am or~ly stat~rig it as a fact." (A. 173.) A year later. Newman wrote to Dr. Russ~ll to thank him for an English translation of St.,.Alphonsus L. iguori's sermons. Dr. Rus-sell. who was president of Mayno.oth in Dublin. had. says Newman, "perhaps more todo with my conversion than anyone else." In ,the 115 ,. JOHN A. I~ARDON Ret~idW f6"r l~tter, NeWman asked his friend whether anything had been left out in the transla'tion of Liguori'~ sermons, and was, tg.ld that there had been omissions in One sermon about'the Blessed Virgin. This small detail appears to have been,the turning,point in Newmail's apl~roach, to the .Church. D'escribing ivin the Apologia he says, "It must be "observed. ihat the writings of St. Alfonio,~is I knew-them by the extracts commonly mad~ fror~ them. prejudiced me as much agaifi~t~ 'the Roman Church a~ anything, el;e, on accou, nt of what was called tl~eig .'Mariol.atry.'.'' But, and this i~ significant, ~'there is nothing of the kind in this book" which Russell had sent hirn2 "This omis-sion in.the.case of a book intended for Catholics. at le~t showed that such passages as are fdund in the works of Italian authois were not acceptable to every part of ,the Catholic world. S~ch de~r~tid~al. ~ manifestations in honour of our L~dyhad be~n .my great crux as re- "~ ~ards ~atholicism." (A.,.176.) Once he became cdnvinced that the, Roman Church was willing to d~mngu)sh between faith arid external piety in devotion to Mary,. and to recog,nize that piety,-unlike fa'ith, canbe different for dlfferent people, his entrance, into the Church was only a matter of time. e 'letter-to Dr. Russell was sent iri November. 1842, and in February of the following year. Newman made a formal public retraction "of all the hard things which I had said.against the Church of Rome" (A., .1,81). - - _. In Defehse of Mar~'s Honor . ¯ A~ter his cdnversion. Newman drew fre~luent!y on his own ex: ¯ perience tohelp remove ~he obstacles which 6thers had to face in their" journe~y to" Rom~---notably the (ommon prejudice against so-called Catholic excesses in devotion to the Blessed Virgin. However, for the most part this was 0nly private and persbnal, assistance to pros-pec~ ive converts or in answer ,to specific"charges made by ir~dividual Protestant~,. Not until 1865~ did he have.an opportunity to defe'nd :l~Iary's honor and .to vindicate~the Roman piety.in her.regard in a way.that was to win for.him the gratitude 6f generations 6f Ehglish-speaking Catholics. In 1865 his old f'riend Edward Pus£y published.~he Eireni~on, im which he promised a peaceful settlement of the differences between Canterbury ~ind Rome, if only Rome Would meet certain conditions' .which'he recommended. One of the major obstacles which had 'td ¯ be removed in .~he. interest of re-ufiion was the Roman Church's cultus~f th~ Mother of God. "I believeY he said, "the system jn 116 May, 195'2" . Ouk LADY'S DEFENDER regard to the Blessed Virgin iLthe.chief hindiance~to ~e-union." Of all the objecti, ons which the.average ]~gli~hmanhas against Rome. "the vast system as to the:Blessed:Virgin ¯ . to all of us has been the, special, ciuxof the Roma~a system." (Eirenicon, 101.) Pus'ey' opposed the ~urrent.Catholic devotion to the Blessed Vir-gin on two scores: he claimed it was simply excessive, and it lacked a solid'foundation.in Cfiristian tradition. He singled out fo.5~special censure the dogma°.of the Immaculate Conception Which had just" been definedeleven'years,before. This was the quintessence of papal presumption~ in.defining as revealed doctrine what only a handfu'l of zealots had originally believed to be true. Puse)~'s main diffictilty, however was similar to what Newman's hhd been, that Catholic piety towards Mary was derogating.from -the h0northat was rightly du~ to her Son. St~itements like "God does not will to give anything except through the Blessed Viigin," and "He has pl~aced her between Christ and the Church" were unin-telligible, he thought, if Christ is. the sol~ Mediator between God.and man. -Granted that."the'devotion of the peo'ple to the Blessed Vir-gin outruns the judgment of the priestL" but what "if the whole weight of Papal authority is added to the popular doctrines, and the people a.re bidden . . . to bestill more devoted to the Ble'~sed Virgin ¯ . . one sees not ~here there shall,be any pause or bound short 6f thal~ bold conceptioln that 'every prayer, both of individuals and of th~ Church. should b~ addressed to St. Mary.~ ""(Eir~ni~o.n, i86~, 187.) Newman's answer to Pusey, while called a Letter, extends tO 170 pages~in Longmans' edition. Thebody of the letter.fails into .three parts, each dealing with a separate charge made by Pusey. has been justly called a "inaste.rpiece of Marian literature," which-deserves to be better known not on~ly as a revelation of Newman's 6wn love for Our~Lady, but.as a source book. of apologetics to.de-fend our Catholic devotion to the Mother of God. " Marian Doctri;~e not Marian Devotion "I begin," .say~s Newman, "l~y making a distinction--the dis-tinction between faith and. devotiom" By faith.in the Blessed Vir-g~ n he means all that Catholics~believe has be~n revealed to us about the Mother of God. By. devotion he .mean~ such'religious honors and expiessions of affection as follow f~m the faith.' "Faith and ' dev6tion are as distinct in fact as they are in idea. We cannot. in-deed. be de~out without faith, but we may believe with6ut feeling 117 JOHN A. HARDON Reaiew for Religious devotion." .-Against the Protestant Objection that Catholic doctrine about Mary has grown by adcretion over the centuries, Newman an.2 ¯ swers that what has grow.n is subjective de;cotion, that is, r~aliza, tion and expression of faith, but not ttJe faith itself. And again, in detrain countries Catholics are accused of makin'g almost a goddess of the Madonna, while elsewhere their piety is mo~e restrained. The same distinction applies: without defer~ding genuine¯ excesses, it is still true t.hat some Catholics are more affectionate and expressive in their devotions than others, but the doctrine about Mary'is always the same. ~ "This distinction," for Newman, "is forcibly brought home to a convert as a peculiarity Of the Catholic religion, on his first intro-duction to its worship. The fiii.th is e~erywhere the same, bul~ a large liberty is "accorded to private judgment and inclination, as regards matters of devotion . No one interferes with his neighbor: agree-ing, as it. were, to differ, they pursue independently a common end, ,~lnd by paths, distinct but converging, present themselves before God." (L. P., 28'). Starting from this distinction, Newman pr6ceeds to explai'n. some of the fundamental doctrines which" Catholics ~hold regarding the Blessed Virgin. Her Immaculate Conception, for ,example, is a stumbling block to non-Catholics because they do not knob¢ what we mean by original ~in. "Odr doctrine of original sin is not the same as the Protestant. We with the Fathers think of it as some-thing negative, Protestants a~ something posit!ve."' . They.hold that '~'it is a disease, a radical.change of nature, an.active poison internally ¯ corrupting the soul, infecting its primary elements, and disorganizing it; and they fanc'y we ascribe a different nature, from ours to the Blessed Virgin, different from that of her parents, and from that of fallen Adam~" .We hold nothing of the kind. "We consider that. in Adam she died as others; that she was included, together with the whoIe race, in Adam's sentence, . .but we. deny that she had original sin; for by original si'n we mean something negative, the deprivation of tfiat supernatural unmerited grace .which Adam and Eve had on their first formation." Catholic belief .ir~ the'Immacula'te C~nception is only a natural ~orollary to the more fundamental truth' of the Divine Maternity. Newman is a specialist here, tracing the clear lines of tradition from the earliest Fathers of the Church. "To the Greeks she was Theoto-kos, to the Lati~as Deipara, to us the Mother of God. Intoone para-graph he crowds the testimony of the. ages on the elemental dignity 118 JOHN. A. HARDON - - Reuieu~ fo~" Religiou* of the Virgin Mary.°. "our:Go~' Was carried in the womb of Mary," says Ignatius who was martyred A.D:-106. "The Maker of all," says Amphylochius, "is born of a.Virgin.'.' "God dwelt in a womb," says Proclus. Cassian says, "Mary bore her Author." "~The E;~'er-lasting," says Ambrose, "came into the. Virgin.' . He" is' made in thee," }ays St. Augustine. "Wh6 made thee~" (L. P., 47,~ 65.) On the practical side, !Newman deals With the question of Mary's intercessory power which, he explains, follows "from two basic truths: first that it is good a~ad useful to invoke the saints, and sec-ondly that the Blessed Virgin is singu, larly dear to her Son. The first may be assumed among believing Christians, but the second notso obviods. ¯ Granting tfiat prayer of intercession is "a first prin- .ciple of the Church's life. it is certain again that the vital fofce' of .that intercession~, as an availing l~ower, is sanctity.The words of the man born blind speak the common-sense of nature: 'If any man be a-worshiPper.of God, him He heareth.' " What thin must be the position Of the Blessed Virgin before the throne of God? . If the Lord was willing t$ spare Sodom and Gomorrha in answer to Abra-ham's piayer, if the prayer of Job for his friends saved them from the anger of God, if Elias b~.his prayer Shut and opened the hea-v~n~, if Jeremias, Moses, and Samuel were great mediators between God and His people, ."what offence is it to affirm the like of her.who was not merely," as Abraham,. Moses, and Elias, "the friend, but was the very Mother of God." (L. P., 71,'72.) Doctrine about Mary °Alfect~ed by Devotion Having laid the doctrinal foundhtion for Mariah piety, Newman examines the charges made by Pusey that Catbollc devotion tO the Blessed.Vi~gin i~ exc~siy~ and out of proportion.to its dogmatic basis. This accusation would be. justified only if man were all intel-lect and his religi6n were only intellectual. But "religion acts on the affections." And "who is to hinder these, when once roused, from. gathering in their strength and running wild? Of all passions; love is themost unmanageable; nay more,, I would not give:much for that ¯ -love which is never extravagant, which always .observes theproprie-ties, and can move about in perfect good taste, under all circum-stances. What motbeg, what husband or wife, what youth or maiden in love, but says a thousand foolish tbifigs, in the way of endear-ment, which the. s~eaker wouldI be sorry for strangers to hear, ye~ they ~re not on that account unWelcome'to .the parties to whom they are addressed " (L. P., 79, 80.)! \ i 119 JOHN A. HARDON Ret~ieto for Religious "Let me _apply' what ~ have been saying to the teaching of., the Church on the" subject of the Blessed Virgin . When once we haste mastered the idea that Marry bore. suckled, and handled the Eternal in th, e fo~m of a child, wh~t limit is conceivable to the rush and flood ,of thoughts wfiich0such a doctrine involves?¯ What.awe and ~urprise :must attend upqn th~.knoWledge tha't a creature has. been brought :so'dose to the Divine Essence? "It was the creation of a new idea and of. a new sympathy, ofa new faith and worship, when the holy Apostles announced that God had become inc~irnate; then a supreme love and devotion ~ to Him became possible, which see~ed hopeless before¯ that revelation. ,.This was the first consequence of their teaching. But besides this,'a second range of though}s ~vas opened on mankind, unknown before, and unlike any other, as soori as it was understood }hat that Incarnate God had a mother." (L. P., 83.) Mariolatry is a familiar "reproach on the lips of Protestantsand of Newman himself before his conversion¯ But it is based on a libel.¯ The two ideals of Christ as Mediator and of Mary as mediatrix are perfectly distinct in the minds of Catholics, and there i~" no inter-ference,. between them,. -"He is God m~de low, she is woman inade high.-.When~he became man, He brought home td us His incom-mun'icable attributes with a distinctness which pr~cl~des th~ possi-bilit~ r of lowering Him me'rely by~ Our exalting a creature. He alone has an entrance-into our sou/, reads our secret th.oughts, ~pe~aks to our" heart, applies~ to us ~piritual pardon and strength . Mary is only our, Mother by" divine appointment, given us from the Cro~s: her presence is abgve,,not on earth; her office is external, not within us. Her power is indirect. It is her prayers that av, ail, and her pray-e'rs a~:~ effectual by the tiat of Him Who i~ our all in all." .It is ~rue that Mary occupi~s.a center in Catholic devotion and" worship, but that center is infi.nitely removed from divinity. "~f we placed our Lad~; inthat centre,~ we should only be, dragging Him from His throne, and making Him an Arian kind of God, that is. no God at all." q-?ben followsa ~errible¯ indictment .~gainst his°own contemporaries and those modern Protestants--who accuse Catholics of adoring the Virgin Mother. "He who charges uL" says Newman ~ "'with making Mary a divinity, is thereby denying the divinity of desus. S~ch a man does not know what divinity is." ,(L. P. 83- 85.) Catholic Excesses In thee final part of his lettek. Newman han"dles the accusation 120 ,May, 1952 . OUR LADY'S DEFENDER that devotion to,Mary obscures the dev6tion to Christ. Pro, testants . say that "our 'devotions to-our Lady must" necessarily throw our Lord,into the shade: and there, by relieve themselves of a great deal of trouble. Tl~en they catch at. anystray fact which countenances or. .seems to countenanee,their prejt~°dices. Now I say. plainly, I Tillnever defend or screen any one from' you jus~ r~buke who, through false devotion to Mary, forgets~l~us. ~But I should like the fact to be ,. proved first, I cannot .h~sti.l.y. ~dmit it. ° There is this b~oad fact the o, ther way: --that if we lo0k.~hrough Europe, we shall find, on ~l~e. ¯ whole, that just those nations and countries have lost their faith in the divinity of ChriSt. 9¢hb 15~ve given up devotioia to His Mother, .and that those on t~e other .hand. who had been foremost .in her honour, hav~ re'tained their brtl~odoxy. Contrast, for instance, the Calvinist~ With ~l~e Greeks, orFrance w~th the North~ of,Germany, or the Protestant ~nd Cath~li6'commumons in-Ireland. .In' the- Catholic Church M~ry has shown herself, not the rival, but the min-ister 6f her Son: she has prbtect~d Him. as in His infancyl,soino the whole h~story of theRehg~on. (L. P., 92, 93.) , " ¯ Non-Catholics make much of the fact that Catholic .churches are filled with statues and p~ctures of the Blessed Virgin, that there are so many prayer~ in her honor, that she is given so import_ant a place in-the liturgy. .Newman answers with t.w_o distinctions: first Jris not .true that Mary enjoys rile center of" devotion in.th~ liturgy, and secqndly~ Protestants judge Catholics by themselves when they as-sume that v~hat, should 15e idolatrous ~ or dishonorable, to Christ among the~nselves is also th~ ~ame among Catholics. Thus "when stranger's ar~ so unfa~cora.bly impr(ssed with us, because they see'Im-ages of our Lady in our,,. Churches and crowds floc.king aboht her, . they forget that there "is a Pres~nce within the sacred walls infini'te-ly more awft~l, which claims_ ahd obtains~from us a worsh!p tran-scendently different from any devotion.~'we pay toher. That devotion. might, indeed, tend to'idoiatry, if it were encouraged in Protestant churches, where ~here is nothing higher than it to attract the wor-shipper; but. all the images that a Catholic church ever contained, all' the Crucifixes at its Altars brought together, do not so affect its fie.- quenters,, as the lamp which betokens the p.resence or absence there ol ~the Blessed Sacramer~t." "'The Mass againconveys .tous the same lesson of the sovereignty of the Incarnate Son: it is a return to Calvary, and Mary is scarcely named in it.'" In the same way, Hoiy Commianion, "which is, give~ in the 121 JOHN A, HARDON Review for Religious mor_ning, is a solemn unequivocal act of faith in the Incarnate God, if any be such; arid the most grakious admonitions, did we need one. of Hissovereign and sole right to-possess us. I knew a lady, who on her. deathbed was Visited by an excellent Prote}tant. frieni:l. The latter, with grea~ tenderness for her soul's welfare, asked her Whether herprayers to the Blessed Virgin did not at that awful hour, lead tb forgetfulness of her Sa¢iour. 'Forget Him?' she replied, 'Why. He was just now here.' She had been keceiv!ng Him in communion." (L. P., 95, 96.) Newman had one last and the most difficult rebuttal to make. Pusey had drawn up a list of quotations from various Catholic writers who speak of the Blessed Virgin in terms of extravagant ~a~ection. But this is an unfaircriticism. "Some of your authors." Newman admits. "are Saints: all. I supp6se, are spiiitual writers and holy men: but the majority are of no great celebrity,: even if they bare any kind of ~¢eight. Suarez has no-business among them at all, for, when he says that no one is saved without the Blessed Virgin, he is speaking not of devotion to her. but of. her intercession. 'The greatest nam~ is St. Alfonso Liguori: but it never surprises me to read anything extraordinary in the devotions of a saint." Howeyer. when faced directly with Pusey's quotations.Newman confesses, "I will frankly say that when I read them in your volume, they affected me with grief and almost with angei: for they seemed to ascrib~ to the Blessed Virgin-a power of searching the re'ins and hearts, which is the attribute of God alone: and I said to myself. how can we any longer prove our Lord's divinity from Scripture, if those cardinal passages which invest Him wiih divine prerogatives; after all invest Him with.nothing beyond what His Mother shares with Him? -And how again, is there anything of incommunicable greatness in His death and passion, if He who was alone in the gar-den, alone upon the cross, alone in .the resurrection, after all is not alone, but shared His ~olitary work with His Blessed Mother. And then again, if I hate those perverse sayings so much, how much more must she. in proportion to, her love of Him? and how do we show our love for bet, by wounding her in the very apple of her e.ye? This I felt and feel: but then on the other band I have to observe that these strange words after all are but few in number: that most of them exemplify the difficulty of determining the exact point where tri~th passes into. error, and that they are allowable in orie sense or connec-tion, though false in another. .Thus to say that .pgayeg (~nd. the 122 Mag, ,1952 OUK LADY'S'D~FENDER ¯ Blessed ~ Virgin's prayer) is omnipotent, .is a harsh expression, in every-day prose; but, if it i~ explained':to mean that there is nothing whi_ch~prayer may not 0bta~in from God, it is nothing else than th'e very promise made us in Scrlpture. '. (L-. P., 103, 104.) Pusey's worst accusatlqn was that according to c~rtain Catholic writers devotion to the Blessed Virgin' is necessary for salvation. Newman challenges this statement, "by Whom is it saidthat to pray to our Lady and the SaintsI is necessary to salvation? The proposi-tion of St. Alfonso ig, th~at 'God gives no grace except through Mary, that is through her intercession. But-intercession is one (hing, devotion another." If devotion to the Blessed Virgin were nece~sa[y, then "'no Protestant could l~e saved: if it wereso, there would be -grave; reason for doubting of the salvation of St. Chrykostom or St. Athanasius, or of the ~rimitive Martyrs; nay, I should like to know whether St. Augustine, in all his voluminous writings, in-vokes her once. Our Lord ~tied for those he~ith~n Who did not know Him; and His Mother intercedes for those Christians who do not know bet: andshe intercedeshccording to His will, and, when He wills to sav~ a particular sloul, she at once prays for it. I say, He wills indeed ~ccording to heI, r. prayer, but then she prays according to Hisw ~i"ll .". (L. "P., 105, 106.) " .Newman s Apologetic Method It no exaggeration to say that Newman's Letter to Pusey is'the outstanding work of' Marla, n apologetics written m Enghsh. ~n the ¯ past century. Its stholarship and transparent honesty made it wel-come to those outside the Church. even to Pusey, as he admitted in a letter to Newman. But morI-e important, it gave to Catholics a pro-found analysis of the prinCiples on which their devotion to the Mother of God should be l~as~d. It alsg"gave them an object lesson in the method they should follow in dealing with non-Catholic Christians, with a ~iew to conver. nng them to'the true faith. The method must be a consummate respect for the non-Catholic's sin-cerity, and should recognize that ¯after all ,is s~id and done, faith is a free gift of God to be obtained in answer to humble prayer. Thus in the beginning I ¯ ¯ of his letter, Newman makes ~t clear that he considers the opposition, to. be m good faith. I know, he says, "the joy ~it would give ~hosle conscientious men [Pusey .and/his lol-iow~ rs] to be one with ourlselves. I know how.their hearts spring up with a spontaneous tran what yearning .is I~heirs aft~ ;port at the very thought of union;~ and r that great privilege, which they have 123 SUMMER SESSIONS - not, .communio.n with th~ see of Peter, and.its present, pa.st ~nd fu-ture,."' (L. P., 3.) But~ after all the clafms of ~onscience are settled by reason and argumentati6n, the most important thing is still n~eded. And so in tfi~' last paragraph of his letter Newman c6dclud~s'with a prayer. He asks Go~l to."firing us'all togethkr in unity . to destroy all bitterness on your side and ours.to quench all jealous, sour. proud, fierce an-tago, nism on'our side: and-to dissipate all captious, carping, fastidious ¯ refinements of reasoning on ~'ours.". And finally, "May that bright and gentle L~idy, the Blessed Virgin Mary, overcome you with her ¯ sw, eetness, and revenge herself on.her foes by interceding effectually fo~ their conversion." (L. P.,. 118.) ,.,S ummer Sessions The Department of Religious Education, ,Fordham University, New york, offers gradu.ate courses in the following, branches of"the-ol6gy during the 1952 Summer SeSsion: Sanctifying Grace-by Rev. Elmer O'Brien, S.~3. (Toronto) : the sacraments 6f Penance and Extreme" Unction by Rev. Paul Palmer S.d. (Toronto); Com-m~ andmefits I-IV by R~v. doseph Duhamel. S."3. (Woodstock Col-lege) : Church History by Dr. Donnelly (Fordham) : and Methods of Teaching Religion in High School l~y, Rev. ,l~hn F. Dwyer, S.,I. (Fordham). Each course carries two points of c~edit. Concurrently with the Sfimmer Session. the Graduate School and the School of Education will jointly conduct a FRENCH INSTITUTE FOR SISTERS exclu~iyely. 06 duly 21 and 22, the Division of. Educational Psy-chology, Meagur~ments and Guidance will sponsor its second annual two-davy INSTITUTE ON RELIGIOUS AND SACERDOTAL VOCATIONS. This Institute. will be .held-for the diocesan: a.nd regular clergy, for ¯ ~eligious brbthers and sisters. Its purpose will be to discuss the prol~lems involved in recognizing, encouraging ~ind fostering voca-. tions to the diocesan priesthood and to the religious. "The Summer Session extend~ from duly 7th to August 14th. , For further infor-mation, address the executive .secretary of the Sfimmei Session, F6rdham University, New York, 58, New York. [Additibnal announcemen~s dr'summer sessions are given in~ the March number. pages 95-96. A note for deans of summer schools is given in the ,January -num-ber, page 56. ] '124 Ignat:ian Spirit:u, li y Augustine G. Ellard. | ~NATIAN spirituality is c~iae of.the modern" schools. It acknowl- ~ ]edges itk junior status,¯ u ir~heritance that the oldeafn, ds~.~dlhadolo'lys aonfd' ,C gartahtoefliucl lsyp aircict.euia~lt s',t rtahdei rtiiodnh have put at its disposal Father Eludon, in his St. Iqi~atius. of Loyola, devote~ the whole of ch~ipte, r twelve to showing thal~ just .w.hen he was wo_rk[ng out his own ideas and ideal~ St; Ign.atius °was u'nd.er't.he i~nfluenc~ of a rattier large number of different currents'of spirituality. The two principal instruments of his conversion were the Life of Cbri'st by Ludolph-~of Saxony and the Liues of the Saints by Jac0p? de V'oragine. The' former wa~a Carthusian, and the latter a'Do-mini~ an. Ignatius of(eia thought: "St. Dominic did this., St. FranciSo. that: shc~uld not I also do as they?" fiis a matter of fact, for a time, he thought of becominga Carthusian. His favorite book through-out life was Thomas ~l Kempis: thus he put himself in debt to the Devotlo M~derna" that the B'roth~ers of' the Common Life arid the monks of Wi'ndesheim were. propagating. Th~se three w~rks were majbr forces in.his formation. In addition to these he came under the personal'influence of the Ber~e,dictines at Montserrat, of the Do-minicans with whom he.lived at Manresa, of'th~ Franci~cans, of the Hieronymites, of the C, ister~cians, and probably of others ~llso. "It is the,opinion of at least one man who has made a very Speciai study"bf Igna'tian spirituality, "namely Boeminghaus. that Ignatius 'fused two streams of spirituality'which before him had come down in more or less p~irallel lines .(B,oeminghaus, Die Aszese der "lgnatia~- ischen EScercitien. 10-34). These traditions were those typified by Thomas ~ Kempis and St. Fraficis of Assisi. ]During tl~e later years of ~tbe Middle Ages the~scbool of spirituality ~hat was most fresh and vigqrous was that of the Cbristi~in Renaissance, just referred to under ¯ the Latin name:.tbat it u~ually goes by, n~mel]z, "Dev,0tio Moderna " It m~i~ked a reaction ¯against "excessive speculation--in piety and stressed the supreme importance of beihg 2or.dctical in one's religious life. " In particular, it tended to put more method into the spiritual" life arid especia.lly into the mental pray~r that should animate and vivify it." In a word, one may ~ay that its asceticism was that which we are' all familiar with from the Imitation of Christ. The second stream was the Franciscan. 'It t.aught ~i0uh. souls to . 125 t AUGUSTINE G. ELLARD Review for .Reliyious take the~Gospel literally, to seek evangelical simplicity and poverty, to look to qesus in His ,human nature as He really existed in time and place, to respond to Him as a person" with love and dev6tion, to keep unitedowith Him as intimately as possible, and finally¯ to live and Work with Him. Hence vitality, enthusiasm, and personal response characterize it, 'as practical method¯ add earnestness marked the other. Boeminghaus sums u'p his idea in suggesting that, to a gr~it extent, St. Ignatius took his method from the Christian Renaissance group and the content of his system from the Eranciscan tradition, and then united them in his own original way. I.n these pages Ignatian spirituality is taken to include not only the teachin~ of St. Ignatius himself, but also that ofhis order. For the saint's o(vn doctrine the priinary written sources are, besides.his Spiritual Exercises and the Constitutions o~ the.Societal of Jesus, his Spiritu'al JoUrnal and some of his letters. Certain letters are very important and do not always get the attention they deserve by. those who profess to :present his doctrine, especially on mental prayer. Some of the letters, too, are equivalent to liitle didactic tre;itis~s; examples ~ire the.celebrated Epistle on Obedience and the letter on perfection, to the students of the Society at Coimbra (May 7, 1547). The spiritual teaching of the Jesuits is to be found partly in certain official documents, for instance,, letters of the Fathers General, and principally in the numerous published works of Jesuit ascetical and mystical authors. Moreover, Ignatian spirituality is Understood to comprise both that according to which Jeguits themselves try to live, including a certain conception of the ~eligious life, of the ~'ows, and .especially of obedience, and also that which tb?y propose for others who accept their instruction. Of course, it ~s not implied in presenting Jesuit ideals that all Jesuits fully realize them. I, BASIC IDEAS The fundfimental element in any school of spirituality is the theory or set of ideas underlying it and giving it life" and direction. There must be some definite conception, for example, of God, of Christ, of human nature, and of the world. Different initial views on these fundamental realities or their relations necessarily give rise to different attitudes of will and divergent practical principles¯ St. Ignatius's mentality was not at all theoretical. .Hence the genera.1 intellectual outlook in his system is simple and concrete¯ It is 126 May, 1952 IGNATIAN SPIRITUALITY ¯ decidedly, akin to that of the Synoptic Gospels rather than to St. John or St. Paul. It is no~ learned o~-theological, like, for instance, that of the Dominican Fathers or of the French Oratory. God is conceived, mostly as'a great and good king, as a grand monarch on the divine scale. It is emphasized esp.ecia]]y that He is the creator and hence the so~'ereign lord of all. St. Ignatius liked to refer to God as "His Divine Majesty," or "~he Suprem~ Goodness." Among the divine attributes libe.rality is often, singled out for men-tion. God is not thought of as "All in ~all". or as "Prime Mover" or as "the Divine Spouse." Christ, the God-man, is so rich in various aspects that no ,one ~p~erson or group of Hi~ disciples could exhausl them all. Hence different schools of spirituality "emphasize different phases Of the great reality that He i~. One. c6uld consider Him as an adorable divine king sitting at.tl~e righ~t hand of the Fathe.r, surrounded by a heavenly court of angels arid saints, and receiving the homage of prayer and work from devout,men 'on earth. Another could con-centrate attention and affectibn above all on the scenes of the crib and the cross. A third, utilizing the concepts of theology, could make mt~ch of the Word.Incarnate. St. Ignatius sees Christ mostly as the. son of the divine King,*and a king Himself, but with a king-- dom still to be conquered. He is a crusading king, at the head of his army, announcing, his intentions, and inviting men to qolur~teer for service. T.he pecu, liar temper of a school may depend much on how it conceives human nature. To cite"an historical' example.: ancient Alexandrine spirituality took intelligence rather than any other fac-ulty to be the great thing about man and acco{dingly it stressed the place of contemplation in the perfect life. The modernFrench School (Cardinal de B~rulle) is noted for its pessimistic" (onception of human nature and the effects upon it of original sin. St. Ignatius is characterized in this mat.te~ by a certain optimism and voluntarism. Human natuie is indeed sor~ethirig that needs chastening and. training, but basically it is good and to be dev~loped and put to work ¯ in the cause of Christ. If all creatures have their value, a Fortiori humannature has; in fact man is the end and purpose of all other things. Bodily 'strength is not to be diminished by indiscreet aus-terities, but ~o be brought under control and made effective for the service of God. The voluntarism of St. Ignatius .is abundantly illustrated throughout the Exercises; he never ceases to refer'to "what I wish." 127 AUGUSTINE G. ELLARD Rebiew [or R~ligious ¯ The Ignatian view of the world, too, is°rather distinctive. Un-like many ascetics of old he did not look upon it °as something' evil to be fled from and shhnned.as much as possible. Nor like St. Ber-nard" did he consider it better to avoid creatures than~ to use them. He did not share St. Francis's tender sentiment toward lowly¯ crea-tures as brothe~s¯ and sisters. St. Bonaventure'~ and many holy t - men of the Mi~tdle Ages stressed the fact that all things are likenessesof~ God'and should be looked upon as enlightening us about Him and attracting us to Him. St. Ignatius is more utilitarian and practical. For him everything in creation is a means tO help men to work out .their d~stiny; everything is to' be rega.,rded and treated solely with'. ~" reference to that purpose. , . . .- ~,~ Co[responding to the ideas that one conceives of God and of.m~ will be ond's ideal of pedec[ion, tha't is, what one takes tobe the . completely right relation between God and man. ,Of course, the 'ggod disciple.of St. Ignatius ~uld be entirely submissiv~ to his Cre-ator and Supreme Lord. He would make God's ends-'his own and seek to,achieve them by the means that God prefers. .To the divine libe?ality he also .rdsponds with magnanimous liberality. Enrolled in the apostolic campaigh ~ith Christ, he endeavors to agsociate him-self as closely as possible with hik great leader, to work with Him as effedtiv~ly as~ossible, and to imitate Him in all respects, but espe- "cially in b~aring pdverty and~humifiation nobly. Thus in_ every-thing he strik, es to love and serve the Divine Majesty. He conforms his will altogether to that of God. "What I wish", becomes pre-cisely whatGod wishes. ~ II. LEADING PRINCIPLES " Logically and fiaturally the basic ideas of a system of spirituality, . "in themselves more or less theoretical, give rise to practical principles indicating the appropriate action that should follow. I. The Divine Purpose,~ arid Plan The first and supremeprinciple of Ignatian asceticism, is oto seek the e~d. for which God created one. "Man is created to praise, rever-ence, and serve God our Lord, and by thi~ means'to'sa+e his soul": ~the "First Principle' and Foundation" in the Spiritual. Exercises (23) .1 ' ~Quotations from" the .Exercises ~re from Loui~ ~J. Puhl's'translation; the figure~ re-fer to' the paragraph enumeration introduced by the editors of the critical edition, Madrid, 1 ~ 19. ~ 28 IGNATIAN SPIRITUALITY As God begins,' ~nd we may also add, ends, wi~h a certain definite purpose, so does St. Ignatius, and so too will hi~ disciple. In fact, man is invited to intend just what:"God intends. Between God and man there are to be no cross-purposes. .Moreover and especi,ally, one. should seek, not a .part of what God intends, but all df it, and to work it out always by using, precisely the means and method pre-ferred t~y God: what is'this but to have just the same iglan as God? Praising and referencing God is substantially, the same as.glori-fying Him. -Striving for the greater glory of God, ."Ad majorem Dei. gloriarff," is very .probably. ~vhht th~ name of Ignatius. is most a'pt ~o .suggest to most people who .have some knowledge of him. It is,well known that whenever SI~. Ignatius wrote or dictated he was cofistantly referring to the glory of God[. In the little book of the Exercises the glory or praise of God is p_roposed as.the end no less than thirty-three times.In the C~nstituffons of ttie Society the ref-efence 6ccurs about-135 times in ~2i47 .pages (the" edition of 1937: so Lawlor, "Doctrine of Grace in the Spiritual Exercises'" THEO-LOGICAL STUDIES, 1942, 524). Nor Was the expression always on his lip.s only. Seeking to make God be'tter known and loved" was ever in his thoughts .and aspirations and supremely strong and do}ni-nant among them.- Hence explicit and uninterruptedaiming at. thh' greater glory of God is a conspicuous mark°6t: Jesuit spirituality. A similar and more, or less equivalent idea that .was a great ~avorite with St. Ignatius and Occurs still more frequently is "serv~ ice)' "Locutions such as 'to the greater s~rvice of God," 'to the greate~r service of God and the help of soul~.' andtheir-like, are re-peated 157 times in the Constitutions" (lb'id.). Servin~ God is bf course the same'as Working out His purpos.es or .extending His glory, and it may be said to be central in Ignatius's whole conception of what-man's relations and activities tbward God should be. Some religious leaders wduld'no doubt put prayer or e~en mortification in the, central pl~ace; for Ignatius, everything, "prayer. recollection, self-a. bnega~ion, and so on, mu~t be subordinated to the glory and seroice of God~ Int(hding what God intends, seeking His glory, serv.mg Him~-all this implies the need and use of means. St. Ignatius is broad enough f0 regard all created things as these~mean~. "He is insistent too that they are to be used neither more nor less than in the measure of their ~utility with respe& to,the final end. " In no way or degree are they to .be sought for their.own sake as goals.if, they be pleasant.and attrac- °" " ~ : 129 AUGUSTINE G'. F~LLARD Ret~ieu) for Religious rive, and no repugnance to a useful but disagreeaigle mean~ "is to be allowed to interfere v~ith Using it. To the noblest end the best means is alwa,ys, to be chosen. Hence, another celebrated term and idea 6f Jesuit spirituality: namely, indifference. 2. AssOciation with Christ. A second leading principle in St. Ignatius's system is "'Associate gourself with Christ as closely as possible." or '.'Know, love, and imitate Christ as far as possible." Tb~ divine purpose and plan become more specificaIly the progra.m 6f Christ. All Christiahs of course strive to associate themselves with Christ, or to" know and' love and imitate Him, but not all in precisely the Ignatian.way, that is. in the spirit of "The Kingdom" and tl~e~ "Tw, o Standards." As we have seen. St. Ignatius likes to consider Christ as ;'Our Lord, the .E~ernal K~ing,'" a prince who is"organizing a military ex- ¯ pedition or crusade, to conquer the whole worId and bring it back to loyal" submigsion to itsdivine sovereign. He summons all good men to become recruits in his army, to share his warfare, and then. to rejoice with him in the fruits of victory. Both the royal commander and his soldiers are to live and fight-under the same conditions of toil.-combat. and suffering, that subsequentl~r they. may enjoy the ~same glories of victory together. The motives for enlisting are con-sidered so attractive that nobody with good sense could decline: one v~ould.at least join the expedition as a.common soldier. But with. this degree St, Ignatius is not at all satisfied. In view of the.singularly magnetic qualities.of the Leader and the excellence of His cause, anybody with a spafk of spirit about him will volunter for distinguished service. He will be glad to show. his love and affection by offering himself for deeds of greater value b~yond the call and strict requirement of duty. He will not wait to be attacked, but Will himself take the offensive and carry tb~ war into the enemy's te(ritory .("acting against"), in particular be will first make a perfect conquest of his own interior foes, and a~gres'- sively overcome his own "sensuality and carnal and w0rJdly love." He Will prof.ess himself ready to imitate his great king in bearing humiliations and poverty. It is thergfore, a cardinal principle of Ignatian spirituality that to the summons of Christ the.King,one should respond with all the magnanimity ~n'd generosity that one can muster. ' The eager new recruit soon gets lessons ir~ the basic principles df strategy of his own leader and also ~f the enemy 'chief. These are 130 May, 1952 IGNA'I~IAN SPIRITUALITY presented in the colorful exercise called "A Meditation oh "Two Standards." They are further deve!oped affd enforced in rules for, the discernment of spirits. Lucifer's'tacticsare to be {~nderstood well, and since they are insidious one is ever to be on guard against his deceits. His general ruse is first to seduce men into an inordinate quest for riches and honor, these being indifferent, and then into pride and finally into all vices. The intention of Christ is just the" contrary,~that is, by example and precept He induces men to cultivate" the spirit of poverty, or even actual poverty itself, to conceive "a desire for insults andcontempt," to acquire the. virtue of humility, and thus then to attain all the different virtues. It will be noticed that St." Ignatius 'makes gre, at eff0rys to have his discipline look espe-cially to. t~o aspects of Christ's moral cha~acte), namely, His poverty and His humility. In the Constitutions of his order and in certain of his letters he adds a third great virtue, tha't is, obedience. At least for the mem-bers of'the Societ~ this gets so much emphatic commendation and i,nsistence that it,is in a sense the point in which Jesuits are supposed to specialize. 3. The Third Mode of Humilitv ~The "'third mode of humititg" is so highly characteristic of St. , Ignatius's whole¯ doctrine and so important in itself that it should, it seems,.be proposed ~a third leading principle. It is pre-sented in ~he Exercises as 'the last disposition to be sought in the ideal prepakation of soul to discern and choose the will of God in o.rdering one's.life. It" is also the highest point that one.could re~cb in conquering self, in achieving the victory over one's .disorderly and rebellious impulses, and in-bringing them into that order.which the divine plan and the program of Christ¯req'u!re. In the first mode of humilisy man submits to God in everything that is' of serious, obligation. The second degree disposes one so to submit as to avoid not only venial sin but also every defect of in-difference and hence all positive imperfections (failure to "carry out counsels). In the third. kind" '.'whenever the prfiise and glory of God would be equally served, I desire, and choose poverty with Christ poor, rather than riches, ir~ order toimitate and be in reality more like Christ our Lord,; Icho~se insults with Christ loaded with them, rather than honors; I desire to be accounted as worthless and ¯ a fool for Christ, rather than to be este,emed as w)se and prudent in 131 AUGUSTINE G. ELL~ARD ' Reuieu~ [or Religious thi~:.world. So Chr.ist wastrea~ed before me" (Exqrcise~, 167). In a_ word,, the p~fect associate of Jesus makes himself like,Him~as far - as possible, iriall virttles, but especially, other consideration} being equal, in pove, rty and humility.° l~vidently reverence and love'and dexiotion to Him rango no farther. Practically one'piefers just what, Christ prefers. " " 4. To Love God . - A fourth leading principle in Ignatian spiritual training'is "'in all things to live and serde the Divine Majesty" (Exercises, 233). Eveiy schodl of spirituality, merel~r to be Christian, must keep in the ¯ forefront the primacy of.love: , Some people have b'een, dishppointed that in expr.essing the end for which God created man St. Ignatius did not mention love. True, it is not named ~here: but as surely and as fully as it enters into the divi~e plan and intention, it is ther'e implication. " The constaht desire,.'too, to choose only thatwbich is most conducive tO the end would invol-ie much love" for God. Even. inmeditating upon. hell it is St. "Ignatius's.mind that love should have a certain priority~' one prays :'that if. through my fault~ I fc~rget the love of the eternal Lord, at ieast the fear of.thes~ punishments ~vill keep me.' fr6m falling into sin''~ (Exercises, 65,). Throughotit. the second, third, and fourth weeks of the Exercises the preva.iling general objective is to 'achieve. with an intimate l~nowl~dge and exact imitation, an ardent love for ~he God,man. The. climax is reached in the celebrated "Contemplation to, a[tain the Love°of 'God" (Exercises,- 2 3 O- 2 3 7). , Love shows that it is genuine by '~de~ds rather than. wqrds." It consists especially "in a mutual sharing of goods." 0n-His part God presents us with the whole gamut of creation, the to~ality of Hi~ ~xternhl goods, :and then in addition ':the same Lord desires to give H'imself to~' His beloved "according to His divine decrees."" In graieful and. generous respqnse one breaks Out into the,"Suscipe,'" relinquishing to the great Infinite Lover the complete possession an'd disposal ofoneself. Every word.in this rnagn!ficen~ exercise prepares one to love the ingffable Divine Goodness literally." with all the ener-gies. of one's soul and bod~r and to demonstrate the truth ofonUs affection by.' reall~dciing everything that,¯pleases God and nothing that could.displease Him. Before worl~ing out the ConstituiiOns for his Society~St. Ignatius laid:it dowri as the first principle that it was not any ~xterior regu-lations that were to g~uide the order, but rather the interior law of 132 Mag,1952 IGNATIAN SPIRITUALITY love and charity.tl~tt the~ Holy Spirit inscribes in the human.heart. One of the Society's first rules is tl~at its members shouldstrive in all their acts to serve and plea~e.the,infiniteiy ~oi~d God for His~ own sake and with. a view to repaying His 10ve and His immense li~eralit~ to them. Hope 'for rewar, ds or fear.of.pu6ishment are to,have only as~cbndary~ role. God is to be .loved in all His creatures, and con-versely too they all in Him. ÷ A distinction has been drawn between two philos0phies.of love: 6he. called pb~tsical, emphasizes the tendency of love to base itself'on unity and~to proceed, to ever greater unior~: it is seen for exa~nple, in ¯ the desire to be with one's parents or relatives. The other; termed ecstatic, emphasizes duality or. diviSion and the iffclination in certain cases for a love} to go outside of himself, as it were,.or t6 give him-self up for the sake,of the beloved: it is exemplified in the self-sacrifice. of mothers for their children or of soldiers for their country-men.-. ,Likewise attention has been.called to .two theological concep-, tions of charity: one, that of personal desire, we might, say, considers the act whereby one wills the Infinite Good to oneself to be charity; so, for'instance, St. Bonaventure. The-other, that of pure benevo-lence, regards this act ds belonging to hope and excludes sucb s~If-reference from charity: so"Sdarez; it would love God. Simply and ab~olutely_.for His infihite goodness 6~ ~or Himself. - C6rresponding to these two philosophical and t'.he01ogical views one may digcern two general, ty, pe~ of spirituality;: the .first centers around the direction of seeking greater:union with'God, It would firid Gospel .warrant in the text: "That they ~ill may,be one: that, as Thou, Father. art in M~, and. I am in Thee. they als0 may be one in us" (John 17:21,, Spencer version)¯ It, wbhld lik~ to save its life.' °A mystery of predil.ection for it is the .Ihcarnation. the supreme~ union of God and ma.n. It is illustrated in the li~ds and doctrines of Saints Augustine. Thomas, Teresa John bf the Cross, John Eudes, and many otber~. It makes for contemplation, and would 'likb to "'taste" or "'enjoy': God. The second type of spirituhlity takes rather the direction of self-giving. It gets inspiration from tbe text: "Greater love has no. .one'than this that one should lay down one's life for one's friends" (J~hn 15:13). ILisglad to lose its life ' (Mark 8!35). Naturally the passionand death of Christ are favorite mysteries. M]~,rtyrdom would be its ' great consummation. Repres_entatives of this type are . St.° Fr~in~is of Assisi, Thorhas ~l Kempis, Francis de Sales apparently, AUGUSTI~qE G.F.LLARD " Reoiem (or Religious arid "~ertainly Margaret Mary Alacoque. St. ,Th~r~se/s idea of love Was "to give all, na~, to give oneself!" .Clearly with these latter, exemplifying the ecstatic tendency of love, and the pure-benevolence conception of c~harity, and the self-sacrificihg type of spmtuahty, St. Ignatius and his school are to be ranged'., The whol~ tenor of his spirit, with its climax in the third mode of l~umility, or in serving the Divine Majesty in everything, is not toward union, but service; not toward enjoyment, but sacrifice; not to~vard rest in God, but work for Him (See De Guibert, ~tudes de Th~ologi~ Mystique, 239-281). 5. Union and Familia(it~ u;ith God Finally, a fifth major principle in St. Ignatius's generaI method .concerns umon and [amiliarit~ toith God. He'was wont to formu-late it in some such terms as these: "to seek God in all things"; "to fifid God in all things": to be a-pliable "instrument" in "the divine hand." Ih the Constitutions, IX, 2, St. Ignatius givds a rather long and particularized account of what the ideal general of the Society should be. Naturally this picture is at~tbe same time a characterization.of the Saint himself. Among the qualifications required in a future gen-eral the first is as ~ollows: "that he should be most fully united with God our Lord and familihr with Him. as well in prayer as in all his actions." Similar prescriptions are made for other~ who are to, be appointed to lesser offices (Epitome Instituti,No. 740). Thus the Founder showed his supreme concern that above all else members of the Society Should cultivate the closest and most intimate union withGod. The iarge.place which work holds.in the Jesuit ideal and the re-lations between prayer and work in it are highly characteristic. In no other school, as far as I know. is there so great a tendency, to favor work at th~ expense of prayer. A deep' foundation ofmortifi-cation and solid virtue being presuppos'e.d, from, say, the novitiate, or some similar training and including a thirty-day retreat, praye~r is to be cultivated until one has the proper disposition, that is, the will to love God with all one's heart and to carryout the whole of the divine design for one. Butthen, in view of the grave nedessitles.of souls and the needs of the Church, one should leave prayer and give all one's energies to doing God's work, saving-and.sanctifying men, long ago pronounced to be, of all divin~ things, the divinest. When a man goes about his work precisely as God's, doing just what He 134 Marl, 19 ~ 2 IGNATIAN Si~IRITUALITY indicates, because He Wills it, a'nd in tb~ manner that He wisbes, it is relativel~r easy and natural to pass back and forth between pra~rer and work, Striving to'do God'~ work according to the mind and in the spirit ,of God may be said to be itself not the least f~rm of prayer. Faithful disciples of St. Ignatius are "contemplatives ~in action." To illustrate the union that shoulci exist between one who works for God and God Himself, a favorite comparison of St. Ignatius was that of instrumental adaptation. "l=he .human worker should bea completely pliant instrument in the divine hand. A perfect personal instrument would be fully sensitive and responsive to all the motions of that hand. To give one such instrumental flexibility is, according to St. Thomas, the tendency of the gifts of theHoly Spirit (I, IL 68, 3). The most exquisite docility to the Holy Spirit is a capital aim" in the doctrine of one of the Society's most distinguished spir-itual masters, Ft. Louis Lall~mant. III. DISTINCTIVE PRACTICES Certain practices are characteristic of Jesuit asceticism. Nowadays some of these are more or less universal in the Church. But in origin, or at Ieast in their wide difft~sion, they are due largely tothe influence of Ignatius. I. Spiritual Exerciseg, Retreats perhaps the practice that is most obviously distinctive of those who follow the Jesuit ~chool is that they make retreat~ and attacl~. great lmpor.tange to them. And more pafticulhrly, they do'it accord- . ing to the scheme and sequence of exercises sketched out long ago by the knight-conver~ .at Manresa. The Exercises were'originally cab culated to last for a solid month, and in this in~egral, form they are made by all Jesuit novices and again by young Jesuit priests, toward the end of their training. Other Jesuits regularly repeat them in a condensed form for eight days every year. $6 als.o, for varying peri-ods, .do many who do not belong to the Society and still make use Of ,its.spiritual a.,ids.The numerous students in Jesuit high schools .and, colleges throughout the world.make annual three-day retrea,ts. More-over m.a~y dev0u~ lay men and women make Jes.uit retreats annuall,y. .,.:~.S~.~.Ign.atiu.s himse.l.f did not advocate regular retreats. The cus-tom gradu,~,.lJ;¥.-gre.w in tb, e. Sgciety and w~s made. a-matter of rule only in 1609. ' It is very.!argely due tO Ignatius's influence, directly o~r ~nd~rectly,. that now the practice of making annual or regular re- 135 AUGUSTINE G. ELLARD °, Reoie~o [.or 'Retigiotis 'treats is f, oi religious and clerics a point of. canon lavi, and a received~ ascetical usage in the C~hu~ch. . ¯ o , : . .'~ :2. The Particular Examen Another" practice that was originally most characteristic of l~fie Ign~tian approach, is ,the particular examination 9[ conscience. Essen-tially it is :nothing el~e than using in the. war with one's'.faults ~bat ancient priii~iple ot: strategy: "Divide and con'quer!" In'more mod-ern and universal terms one might say that it exemplifies the rule,: "Specialize! 'Concentrate on a .l!m!ted field!" The,particular examen was always a great.favorite with St.-Ignatius. It is now one of tlqe common techniques of Catholic asceticism. Sometimes,. it iS censured by men who concentrate all if/dr strutiny of it upon some minor, de-tail or other .in the method and overlook What is substantiaia~out 'it. On tlqe other harrd, even some ~f the minor features of it have of late been getti,ng ~ommendation from scientific psyc.hologists. . 3. Directi6n A~ third practice.that is distinctive in its way of I~natian spir-ituality is its idea of direction. S't. Ignatius considered it especially useful,, if-nbt, necessary, to prevent one from ~alling victim to the illusions that may come either from one's own imagination and ~mo-tions 0~ from the deceits and snares of the evil spirit. As compared with (h~ older school~, Stl Igna'tiu~ advocates., if I mistake not, a more thorough-going and a more.methodicM'u~e of it. On the .other hand. he did not employ it like St. Francis de Sales or others in seventeenth-century France. The Exercises were originally designed ¯ to be made individually with a private and.experienced director and the exercitant was'urged to be very frank and open with him. In the Societyit is expe'ct~d that subjects should make themselves, even their innermost co~nsc.iences, all their good and bad points; culpable or in-culpable, fully known to their superi6rs orconfessors and in return . receive individual~pat~nal guidance. Any eager adherent of 3esuit asceticism will, if possible, seek constant expery direction from an-other in the problems of his in(erio~ life. Complete candor of soul and docility toward a director or supe,rtor fit in very' well with cer-tain qualities of character that wer.eparticularly dearto St. Ignat!us: namely.his preferences for mortifitation that is interior, of judgment and will; for prudence, humility, discipline, and obedience. 4. Mental Pra~er " " An~ outs.tanding, mark of any system of asceticism is its doctrine 136 May, 19~ 2 [GNATIAN SPIRITUALI~'~ on prayer. If one compares the' modern theory and practi~e of.p~aye.r with the.ancient or the medieval,' One will n~tice great differences in the relative positions of vocal ~nd m~ntal prayer. T.he cha~g~s had been coming of. necessity inthe historical evolution of the spir~itual and the religious life. In determining the. actual extension.anti fO~m" that they have taken since" the sixteenth centu.ry th~ ,influence of St. Ignatiu~s, direct or indirect, was a major factor. In making the Exercises and then later irl striving "to arrive ~at perfecti6n in whatever state or way of life God our Lord .may gra.nt. us to 'choose';- (135), it is ~onkidered most {¢ital that one's koUl' should be illled with "the iiatimate understaqdjng and rql~sh'of the" ¯ great Christ~ian truths (2). Often. eno~ugh pegple refe~ to the first ineth~d of mental, prayer ifi th~ Exercises:, ~h~ on~ ~here named from '~tiSe thr~e powers .of the soul," fi's "'the.Ign'atian method." As a matter of fact, in that little-booklet the Saint proposes at least six methbds, and thi~ c~ne,0used for the consideration of abstract truths, is almost immeasurably out-numbered by the ~'qontefiaplations," according ~o persons, words, ~nd actions, that deal especial,l~ with the life and pa~ssion of Christi o Except.~when misconceived by ill-informed critics or misu'sed by ignorant persons, Ignatian methods of prayer do not hinder liberw of spiri~ or stand in the~ w~y bf ~he Hgly Ghost:s irispiration~s. It is the most rudimentary¯ principle of ,Jesuit spirituality to keep the ~na clearly, in: mind, to preserve lib.erty with respect to the mearts, and, to select and use the most apt .of the means. Even in the Exercises/writ-ten qspecially for beg)nners.to aid them in the. specific and passing task of rightly d~t~rmining their vo.cat.ion, the admonition is given: .It "should be noted:. I will remain quietlymeditating upon the point in.which I have found what I desire, without e?gerness~ to go on till I. have finished"-(76). And again later on: "If in contempl~- ~tion, say., on the Our Father,he finds in,one or two words abundant -matter forethought and much relish and consolation, he should not b~.anxious to go on,~though the whole hour be taken t~p with what he has found" (254)., Incidyntally; one.may notice that thus from the start St.~Ignatius promotes the tendency to pause in contempla-tion rather ~h:in to busy onesel, f with discursive or analytic reflections: Outside of retreat time ,Jesuits and their followers may and should cultivate those'$orms of mental pra~er, including'the?highest "degrees of cqnteml~la~tion, that will: most effectively advanc~ them in loving God'and in.execating His d.~signs. Naturally,. off course, .th~ . / AUGI.JSTINE G. ELLARD Reoiew for Reliqious prayer of aposto!ic workers will differ from that of cloistered Carme-lite nuns. Similarly 'the'inspirationsof the Holy spirit will be in harmony with one's divine ~;oc~tion, nbt coiatrary to it. St. Ignatius was a great mystic himself, as his Spiritual dournal amply attests. In others asa rule he looked to solid virtue 'and mor-tification rather" than exalted'st'ates of prayer. If we may generalize" , from a letter to Francis Borgia while the latter was still the Duke of Gan~ia, that form of prfiyer is to be considered-best in which divine ¯ favbrs are received most liberally: "The .best thing for each particu-lar person is that in which God our Lbrd communicates Himself most freely, bestowing His most holy gifts and "s'piritual graces, be- ;cause 'He sees and knows what is most suitable fo~ him, and, asguring of His gifts. F6r."strengtb is madeperfect in weaknesk." "He scattered the proud in the co'nceit of their hearts.", and "the rich He sent a~ay empty." ." If'we reflect:but a .little we.soon learn that convent eficl0sures are not necessarily a barrier to Gdd;s d~signs. While'furnace walls con-taih ~he raging fire~ within them. they_do not prevent the heat from going out to the objects roond about. While'they contain, they also protect; and by pr0tecting,~they enable the heat to b~ intensifie~l., Cloist~r has a purpose m ways the sam~. Within its shelter religiofis can protect and intensify their ,knbwlei:Ige and their love of God. ~Should this love become lively enPugh, its influence will flow out beyond the convent walls ifito the minds of other men. Jhst as'in the natural organism"the hidden organ's make thei~ inflhence' felt in different ways throughout the whole boffy so i'n .the organism which is the.Mystical Body of Christ._ the hidden organs to which, among others,, we. may liken the lives and work'of religious, advance and consolidate .the "b~ilding .upof the Body :of Christ, until we all at-tain to the unity of the Faith and of the deep Kr~6wledge of the Son of ~od, to.perfect manhood, to the mature measure of the. fullness of Christ". (Eph. 4: 12). And, in truth, if each religious in every mon-', aste?y throughout the world, burned according to the measur~ 0f.his grace," with an intense love of the Sacred Heart and with a desire" to repair the outrages heaped against that love, he could surely hope to ¯ find ~n" the world about h~m. instead of doubt greater, faith m God's 149 MI~HA'EL 3. LAPlERRE \ truth, instead of degpai,r greater hope in God's promises, instead of hatred greater love for the Person of the Word Incarnate. If the Sacred.Heart, by the choice of a contemplative, as the mis-sioner of this d~votion, intended to point out to religious," that ' He expected to find~ in them devotees of His Truth and dyrlamos bf His Love, He certainly, wl~ile giv.ing us cause for joy in such a. compli-ment, made it clear to all, that He felt greatly disappointed in His expectations. For in His fourth appearance to St. Margare~ Mary, He made this complaint to her, "Behgld this Heart which has so loved men that it has spared nol~hing but has been poured out .totally and has been consumed as a pro.of of its love; and for gratitude, I receive from the greater part of men only ingratitude by their acts of irreverence and by the coldness, and the conte.mpt they ha~'e for Me in this sacrament of Love. But what touches roe closest is that the very hearts which are consecrated to roe act thus." It is a smarting, rebuke; it stings to the quick .the'person conse-crated to Jesus Christ. And each of us, if I' may dare to spdak for each; may strike his breast humbly confessing With th'e publican, "'Lord be merciful to me'a sinner." Yet this is not a reason for dis- .couragement. While we are aware that the Sacred Heart,expects to find in His chosen soflls a cradle for the growth and a beacon for the shining of'His love, we, mindful of our emptiness, may take to heart th~ese other words to St. Margaret Mary, "And for the accomplish-ment of this ~reat design, I have chosen you as an abyss of u~awortbi-nes~ and ignorance, in order that all should be wrought by Me." If. we can do nothing else,, we can,with divine grace, try to see ourselves as we are and gladly permit the Sacred Heart to inflame our souls. with His divine Love and to radiate through them into the minds and hearts of men too easily forgetful, amid their works and worries, of His Divine Presence. If we open our hearts to Him, the Sacred Heart will do the Jest; if we do this little, we shall do much. "Amen I say to you this poor widow has put in more than all those who bav~ been putting money into the treasury.For they all have put in out of their abundance; but she ,out of her want' has put in all that she badd' (.Mark 12:43.) OUR CONTRIBUTORS MICHAEL J. LAPIERRE. a new contributor, writes from the ,Jesuit Seminary, Toronto, Ontario. AUGUSTINE (3. ELLARD, professor of ascetical and mystical the, ology, and EVERETT 3. MIBACH, a, former missionary from China, are at St., Mary's College, St. Marys, Kansas. dOHN A. HARDON teaches ,fundamentai theology at West Baden College, West Baden Springs, Indiana. dOSEPH F. GAL-LEN, who teaches Canon Law at Woodstock College, Woodstock, Maryland, con-. dudes his series on the Quinquennial Report in this issue. 150 The, Qu!nquennial .Report: Obligatiohs and Directives !11. Joseph F. Gallen, S.J. ¯ " IX. A~breuiating and Prolonging the l~ostutanc~ . t!~iVi~.AS th6 time assigned by. the common law (c. 539) or by W' the Constitutions for the postulantship abbreviated or prolbnged: if so. for bow long a time and by what authority?" Pontifical. 147: Diocesan, 134: Independent Monas-teries. 74. " The law of the Code demands the postulancy only for li.~eity and not for the validity of either the noviceship or the professions. By the common law of the Church the postulancy is demanded only. in ins{~tutes of perpetual vows. in which all religious women but in institutes of men only-the lay brothers are obliged to make a postu-lancy of six months. The particular constitutions may and fre-quently do prescribe postulancy in institutes of perpetual vows for the classes of religious not obliged to the postulancy of the Code. for example, teaching brothers. The constitutions may also prdscribe a postulancy longer than six months. This is rare.ly done. Thus one congregation, whose constitutions were approved by" the Holy See in 1937, has a postulancy of a yea.r. This postulancy can be prolonged for six months. The noviceship in t, his institute- is two years in duration. Another institute has a postulancy of nine months, but it can be pro.10nged for only three months. The duration of the postulancy prescribed by canon law is com-puted in the same way as the.canon'ical year of noviceship. Therefore, a pgstulanc.y of six months that begins on 3anuary 1 ends and the noviceship may be begun on July 2. Any considerable abbreviation of the postulancy is .forbidden. However. rgligious superiors may for a jUSt reason abbreviate the postulancy, for a few days. The usual reason will be that all the postulants of a group may receive the l~abit and be~in the noviceship on the same day. It is d.ifficult t6 see how th~s abbreviation permitted to religious superiors can be longer tl4an two weeks. For a more extended abbreviation recourse is to be made to the. APOstolic Delegate. Higbe( superiors also have the right ofprolonging the postulancy but not be~rond six months. Here ai~o an extension.of a ~ew d. ays 151 JOSEPH F. GAL~LEN Reviet~'for°Religi~u~ m'ay be-made that all the p0s~ul~nt~ 0f a gro, up may b~egin' the novice-. ship ~n the.same day. Outside of this case I believe that the reasons for a prolongation, of the postulancy-must be peculiar to an indi- ~'i~tua!, and the reason will ~ractically alwaysbe a doubt of the suit-. ability of the postulant for admission to the noviceship. ~ greater .- liberty is permitted to the higher'superiors .it the constitutions pre-scribe a duration of, "at least six months." However, When the con-stitutions enact precisely that. "the prescribed time of the postu-fancy is six months," I believe ii is illicit to exte'hd l~he posttilancy annually and.for all postulants ~o nine months or more, for ~xample, that all may. complete a scholastic year ,of studies during the postu-° lancy. A law whose observance is cominonly and.habitually not en-forced is an anomaly. A human law admits an excuse and dispensa- . tions in parti~ula, r cases, but piesumably a law tends to l~he Common good and is therefore to be at least commonly observed. The H01y See in approving constitutions, is now wont to insist that the dura-tion be stated as-six months and riot for at least six ~nonths. This is an md~cat~on that the Holy See does not, wish the-duration of the postulancy to be ,cornpietely under (he" contiol of higher.super!ors. Another indication of the mind Of the Holy See is that.the Norma~ of 19~1 permitted a prolongation only in' particula, r cases)s Fur-thermore, the prolongation of a determined postulancy, even in an individual case, for thesake of siudids seems to me to b6 beyo~nd th~ power.0f prolongation granted bythe Code to higher supe[iors. believe it is~the implicit intention of the Code that the reason for the pr01'ongation should be a doubt as to the postulant's suitability for admission to the novic~ship: It is not to be forgotten that a postu-' lant who has satisfac~torily completed the time of a determined postulancy has ~ulfilled all the donditions demanded from.him by law for admission to the noviceship. Is it like'ly, that highel superiors are acting legitimately in postponing that admission? An extension of the postulancy 'for studies in'the case ofeither an individual or a group demands a dispensation from,the competent authority. If the higher superiors of an institute inten,d to make such. an extension a .Pe[mandnt practice, they should give" thought to ~'change. in this article of the cbnstitutionsl We then have the anomaly of a law that no one obsdrves .or dntexids to observe. Not all canonists will agree with these interi~retations. Thd Apostolic Ddlegate,has the faculty of abbreviating or prolo.n'ging,thi postulancy prescribed by the Cod~. ~SNormae Secundum Quas S. Congr. Episcoporum et Regularium Procedere Solet in Approbandis novis Institutis Votorum Siraplicium, 28 iun. 1901, n. 65. 152 . May'~ 1952 "QUINQUENNIAL REPORT It is certainly; illici~ to -prolong the noviceship o for ,the" sake ,of studiets. Canoii 571, § 2 explicitly demands a doubt of the suitabil-ity of the novice "for" profession as the reason fora prolongation, of the novlceship. It is equally illicit, without an induh from the Holy See, to transfer the canonical.year to the second year.of no~riceship for th~ sake of studies. '" The, adtual cases discussed above are indications of a ~ider and more serious problem that should be faced by many cong~egatio.ns.of brothers and sisters, that is, are'they unv~isely lessening the period of,' spiritual form~ation for the sake.bf~ a more rapid,intellectual training? Cahon lair does not forbid a'fo~mal and intensive course of ~tfidies during the postulancy and the ~econd y~ar of noviceship, but it.would b~ very imprudent.to assume that every~hihg not forbi.dden by posi-tive law is by t, hat. v, ery fact praiseworthy. The Code-also does not, command nor recommend ~uch a course and it implicitly forbids a -course that destro~rs or seriously impedesthe p.rimary purpose Of the pqstula~y and, especially.of the second year. of noviceship. It can be doubted that a~full college ,course is compatible with the intensive dedication to sp, irit-uaYthings that i~ ~the primary purpose also of the second year of noviceship. It see~as strange that this.year of novice-ship: which has been introduced by some institutes to)give a deeper spiritual formation, should l~e so ~ompletely de;coted to s, tudies. Con-gregations of brothers and sisters should sincerely face a. very impor-tan. t question: has the, factual system of only one yea'r Of inten~iv~ spiritual formation' produced satisfadtory resufts? . X, Poverty '-'Is a perfect-.common life acc6rding to c. 594-. the RUI~ and the C0nstltut~ons, observed everywhere, but ~specialIy .in novitiates and house~ of studies ~(cc. 554 § 3:587 § 2)? "W.hat has beeh done' and-is being donne positively. to'safeguard andpromote .,th~ vibtue ~and sp)rit 9f poverty ? "Do Superiors and officials, out of, religious charity and in order to ward off. for. the religious o.cc'asions, of .sinning against pgverty, provide within the limits of poverty, "wha~ is necessary and appro-priate, in the'way df food, clothes and~othe~ things? " "Do they allow the religious to ask for or receive these. ihings from externs ? "Are there complaints about these things; are these complaints seriously considered, and are a~uses on the part of Superiors and sub-° jects alike'corrected with, equa! severity?''~. Pontifical, 206-210: Di- 153 JOSEPH F: GALLEN " Reoieu; f,o'r Rdigioua" ocesan, 189-193: Independent Monasteri_ed, 117-120. . Poverty in all its aspects of the vow. of law, especially of com-mon life, and ot~ Spirit has been repeatedly emphasizedand explained in the REVIEW FOR RELIGIOUS. This policy is, only. an imitation of ,that of the .Church and is sanctioned by the experience and wisdom of the ages, which have always seen the deterioration of religious in-stitutes forewarned by the symptom of 'a weakene.d poveriy. It is most interesting to note that only 6ne'of the que.s.tions listed ¯ above, and that only partially, the third question, directly touches the vow of p.overty One is on the spiri~ of poverty, tiredall the other four are on the laws of common life. The great.source, of abuses in poverty is in the neglect of the laws on common life. Since so much has been written on poverty in this REVIEW, it will suffice to underline again the matter of the fourth question, "Do they allow the re.ligious to ask for or receive these,things from externs?" ¯ The law on common life on this point prescribes ,that religious should at least habitdall~ and ordinarily procure their, material neces-sities from their own institute. This law does not forbid a religious from receiving an occasional and exceptional free gift of such a neces-sity, provided this is done with permission, .the proprietorship apper~ tains to the institute, and the quantity¯and quality do not exceed what would have been given by the institute. The reasonableness of this law is evident. No spiritually sanereligious will.hold that the "degrees'of pove.rty are proportioned to the wealth of our families and friends.¯ ¯However, it is not unthinkable that some superiors have given permission for such things as vacations, vacanons at home, -trips, and courses of studies, "'provided ~l?u get the. money.'" An ancient law of the Church commanded that a monk who was found at death in possession of a notable¯ amount of money should be buried outside ihe .monastery, in a dunghill as a sign~ of perdition, and that his money should be buried with him. We can be assured that this law has been abrogated: it belongs to the ages~of mote masctiline and prlm~tlve penance¯ We can, however, neglect the ~sperity but lmltat.e the vigor of this law by burying in oblivion that ill-sounding per- .mission: "You may do it, provided~dou get the"roone~j." XI9 Vacations at Home andoutside the Institute "Is it allowed by reason or under color, of a vacation, that time b~ spent with one's parent,s or outside a house.of the Institute?" Pontifical, 2~4; Diocesan, 244. ¯ The implication of this question is not to deny a vacation to reli- Mag, 195Z QUINQUENNIAI~ ]:~EPORT gious. It can even be doubted that the summer program, of many religigus permits, the vacation they should have and need. Canon 606 § 2 forbids religious superigrs to permit rtheir subjects to live outside a house of-'their own'institute except for a serious reason and for as brief a period of time as possible. The pro, per place, therefore[ for.the rest- that religious, need is a vacation house of the institute it-self. Prudence more than commends the principle that r~ligioils should work for seculars but.relax wi~h their own. We can detect in the question quoted abovea fr6wn and perhaps the beginning of ascowl at vacations at home and outside the insti-tute. The same lack of merriment had been noticeable in the writings of canoni~ts. Father Creusen, S.J., had written: "The constitutions which permit' the. spending of vacations With one's fdinily are not. ocleaHyabrogated by this canon (can. 606, § 2)."19 The most ben!gn interpretation .could not construe these words as laudatory. The same author had also stated: "Although a certain amount ofstrictness in. forbidding visits to one's, family may at first stir up. ~ome resistance on the part of.relatives, it is usually a source of great edification, pre- .,serves religi6us from numerot~s, imperfections and faults, and draws to the institute souls desirous of a truly interior life.''20 In this strict-ness he was s.upported by Bastien.21 ¯ Three most repiatable canonistsl Vermeersch,'22 Coronata?3 and De Mees~er24 hre even stricter. They hold that vacations at home are in themselves~'foreign to the religious state but the difficulty of abolishing the practice is a just reason for tolerating a very brief.absence of this kind. This question of the. Holy See can lead us to a more sincere and prayerful study of the text: "If any man come to me, and hate not his father, and mother . he cannot be my disciple." All religious know that these wdrd~ dan be interpreted too harshly; not all are equally aware, that they can be interpreted too s6ffly. Vacati6ns at home and outside the in-stitute ase forbidden by the law of common life if they ar~ given only to those who can secure the money, from their families or friends. XII. Work and t.be Spiritual Life . "DoSuperiors carefully see to it that. {he work of teaching be pr6perly harmonized with religioudsls "ciphne? Pontifical, 303 ; Diocesan, ~283. ~gCreusen-Ellis, R61igious Men and Women in the Code, n. 292, 3. 20Creusen-Ellis, ibid., n. 29f, 2. "- 2~Bastien, Directoire Canonique, n. 592, 4. 22Vermeer¢ch-Creusen, Epitome Iuris Canonici, I, n. 763,~ 1. 23Coronata, Institutiones Iuris C~nonici, I, n. 612. ?4Br~s, Juris Canonici Compendium, I, n. 661. 155 ',JoSePH F. GALLEN. ¯ " :Re~vie~w for Religtous. 'The aspect, of work that causes the most exte'nsiye, practical ob- , stacle to religious disc.ipline-is 6verwork~. The dail¢, teaching sched~- ule of brothem and sisters in "parochial ,and high., sc~hgols is sufficient labor in itself. ~,Vhen extracurrici~lar and parish activities andworks, ¯ extension and' summer cburses, vacation schools, and domestic duties in the ~eligious house are added, the burden .is more tl~an intolerable and will leave.°very little energy and even time for the spiritu~l life. Som~ Bishops in their didcesan statutes touch this. very pr~a~ical matterof work'incompatibie with the life and duties of sisters. ,The statutes of C~66kston0 enunciate the basic prificiple-very clearly: :'Neither ~ill SiSters. be permitted to do any church or parish work ~- without the permission of, the Bishop. Let i~ be borne in mind that their fieed all time possible to perfect themselves in their sa~red pro.'- fession of teaching, nursing, and caring for orphans, apart' from thei~ ~eligio~s exercises and necessary relaxation.''2s~ Th~ .wording of this law would exclude all housework, all duties of clerks and stenogra-phers in the .rect~ory, and also the. position of sacristan ifi parish ~hurches. Thediocese of Richm6fid affirms more briefly the sa~e principle as that contained in,.the. Crook;ton legis.lation.26 The' . Pitts.burgh statutes" forbid a sister, wi.thout the, perm.issibn of the. Bishop, to be a sacristan, jan.itress, or to do any servile work in s~ic~ risties, sanctuaries, orchurches.2~ The statutes of Cincinnati also forbid sisters' to be sa~'ristans in parish chfirches.28 A very conspicuous source of work that interferes with the reli-gious life and with teaching in institutes.of religious women is the addicti6n to domestic duties. The lustre of. flobr and furnitu?e ~ shou.ld not,be ranked as the primar.y purpose of a convent. It is hardly reasonabl~ to dust the dustless or to polish" the lustrgus. The r~ligious teacher in her free., moments shotild naturalist gravitate to prayer, study, and readi~ag, but it.is not an exaggeration to state that ~n s0me.institutes of religious women .domestic duties are very apt to exclude free moments and toconsume free moments. .The time as-si~ g~{ed to prep'aration for class endangers good teaching and excludes progress in knowledge. The excessive occupation in manual work can be rooted blindly ~in°the traditions and training of the particular institute. It. begiiis in the post,ulancy and novicesh, ip. Many a young ¯ girl enters religion thirsting for sanctity but she soon acquires a spir- 2SCrookstdn, p'. 26. 26Richmond, ~n. 188. 2vPit.tsburgh, n. 64. 28Cincinnati. p, 82. 156 May, 1952"J ', QUINQUENNIAL REPORT itual throat that is forever parched b~" a. riovi~eship spent i_na.laundry, Safictit9 is not encouraged¯ when (l~e greatest emphasis and praise is given, to th~ accomplishme.nt of the dustless floor,' the gleaming chair, and to skill in 6perating a dishwashir~g machine. An institute of religious women can not only ~blind but als0 cheat itself. It can be, conten~ with a mere legalistic observance of the laws on the (anonical year. The ¯postulants and isecohd~year novices are v~ithout scrfi°ple .completely occupied in studies. ,The canonical novices are kept With-. in the novitiate, but ~lSe.y are employed for half¯ the week in ~a l~iundry or in similar dombstic duties andothey receive very litt'le instruction. The net result is a savin~ df expense andl the p.roduction of pc~orly trained religious. The'Cash balance is "in the bl~ick," but the human balance is-"in the. red." , Materi.al debts ar~ a heavy bhrden to r~li- ~ious institutes but they are ultimateIy paid. " A great, practical truth that ~eligi~us institutes should never, forget, is that human liabilities are on our books until their death. Higher superiors should sincerely arid ¯conscientiously reflect on the. constant principle of ~he Holy See in appro~ving constitutions that novices may not be employed in do- " mestic duties toan extent that interferes with. the prescribed' exercises' of the novic~eship. A primary obligatibn-of every'higher superior is the proper training of' the .postulants and novices. XIII. Communication o~ the Pro~essed with ihe Novices . ¯ ~'Are the novices, according to law.and the Constitutions. kept separate from the professed, and is any undue communication be-tween them tolerated (c. 564. §§~1, 2)?'-' Pontifical. 1-66; Diocesan. 153; Ind.ependentMon~s.teries, 87. Ihdependent monasteries and, religious °houses are l~ractically;con- .fined to orders of nuns. So~me of the questions proposed to the'se in-stitutes.' such as the difficultie~ experienced in the observahce of cloi-ster and the ability of the monastery to ha~ecompetent officials for the various posts of government, religious formation, and ~vcork are of general interest. H6wever. these matters now appertain more to a study of the apostoli~ Constitution "Spobsa Christi. Canon law forbids communication between the professed and the novices in all institutes, and one of'the ques, tion.s, proposed.also to independent monasteries, asks whether this law has been observed. A, professed in the sense of the Code is one who has made at least the first_religious,profession.' The professed .of ~,tern~.porary vows, eyen' , though they may be called .novices" in some instituters, 0canonically a~e not nowces but professed rehgmus. They are therefore ~forbidden to 157 JOSEPH F. GALLEN RevieW'for Religio~s. have communication with the novices. It will be interesting to see what the Sacred Congregation will do about ~he usage that is found, e~pecially in independent mon0steries, of treating th~ professed of temporary v:ows as novices and of keeping them with the novices for the entire period of temporary profession. TEN'YEAR INDEX--NOW AVAILABLE ' The Teri-Year Index of the REVIEW FOR RELIGIOUS (1942~ 1951) is now,available. It is a green-covered booklet of sixty-four pages including a general index with a.n integrated listing of all ar-ti'cles, authqrs, editorial comments, questions, and answers, communi.- cations, decisions of the Holy See and other items of interest to reli-gious, and a separate index of all books reviewed and noticed. The engries in the content index have been grouped according to subject matter, for instance, admission to religious life, beatifications', con-fession, indulgences, mariology, novitiate, . poverty, vocations, vows, and the like. All the articles of an autho'r are listed beneath his name. We appreciate the ~nerous response we have already received and. the encouraging ~omments. Kindly do not ask us to bill you. The, cost is one dollar per copy. Pleas4 send the money with the order to REVIEW F~)R RELIGIOUS, St. Mary's College, St. Mar, ys, Kansas. UNIOUE SCHOLARSHIP The "Walter Springs Memorial S~holarsl~ip," "at-Regis College, Denver, seems to be something truly unique. Walter Springs, a Negro student .of the early 1940's[ died a victim of race prejudice while in the armed forces in thi~ country. While at Regi~ he was a good student, a splendid athlete, very popular with the st_u'dent body. He was a convert, baptized in the Regis chapel. Some of his classmates .recently decided to perpetuate his memory with a s~holarship--~ *dual scholarship which each year will take care of one Negro student and on4 white student, "s~pplying each with books, tuition, board and room, and whatever other expenses are neces- PLUS Xll ON THE RELIGIOUS LIFE An English translation'of the address of the H'oly Father.to the First Congress of Religious at Rome, December 8, 1950; which was summarized by Father De Letter, .S.3.; in his article, "Contemporary Depreciation of the Religious Lif~" .(R.EVIEW FOR RELIGIOUS, 3anuary; 1952), is given in the April, 1952,-number of Life of the Spirit. This magazine can be obtained from Blackfriars. Publications,~ 34 Bloomsbury Str~'et, London, W. C. 1,.England. . ¯ .158 .Ques!:ions andAnswers Our chapter has voted ÷hat we should now fake solemn vows accord-' ing'÷o ÷he prescriptions of "Spo~sa Christi." Are ~he minority wh~ did not wish ÷o assume ÷his privilege bouffd to fake solemn vows with ~'he rest? ¯ Similarly, are ÷he lay Sis÷ers wffh perpetual vows, ~s well as ÷hecholr Sis-ter~ wi÷h ÷empor~ry vows who h~d no p~r÷ in the election, bound .~'o ~÷~ke solemn vows, or m~y provisions be mede for those who prefer if, to con-tinue ~ith dmple vows? Fi"rst. it may b.e~ well to call a'ttention to the text o~ the general statutes of the Apostolic Constitution. "Sponsa Christi." Article 3. § 2: "All.[monasteries in which 0nly simple.vows are taken can ob-tain a r~storation o~ solemn vows. Ifideed, unless trul~ grave reasons prevent it, tl~e~ will be solicitous about tal~ing, them again." These words do not contain a permission to take solemn vows without more ado, but theF extend an ~nwtanon to such communities to re-quest the ~avor ~rom'the ~oly See through the' Sacred Congregation o£ Religious. Naturally, tb~ first step will be to ~nd out the ff~ind o~ the communitF by a vote o~ the chapter, I~ that proves ~avorable. then a petition should be sent to the Hol~ See through.the local'or-dina~ y of the monastery, requesting permission to take solemn vows. The permission is granted under the ~ollowing conditions, taken ~rom a recent decree to that effect: 1. "In the a~oresaid monasterF, the nuns, °having first made temporar~ vows according to the norm 8~ canon 574. may take s~olemn, vows. 2. "The papal, cloister, as prescribed by the Code o~ Canon Law and by the Apostolic Constitution 'Sponsa Christi' and the In-struction of the Sacred Congreganon o~ Religious 'Inter. Praeclara' (ofNovember 23; 1950), should be observed. 3. "When all these circtlmstances have been provided for, the local ordinary, either personall~ or through a delegate, can in the name o~ the HolySee receive the solemn vows o~ the superior o~ the m0naster~; she, in turn,.can recmve the solemn pro~ession o~ the otbe~ nuns, provided they have.been professed for at least three,years.' 4. "If any of the present membdrs of the community wish not [to oblige themselves by sdlemn yowls.,, they are free to 'remain v~ith simple vows, but they must realize that they are nevertheless bound 159 QUE.STIONS AND AI~SWERS . . Reuieu.; [or Religio/us to a strict observance of all the lhws of papal cloister. 5. "Extern Sisters, having completed their period of ter~porary vows, are tc~ be admit'ted 6nly to simple perpetual vows. 6. "Finally, it is committed to N.N. (the local ordinary) to p~blish, this decree in the monastery of N.N. once he is certain that the required conditions have beew fulfilled. A document attesting -to the publication "a~nd execution of this decree is to be_preserved in . the archives of' the monastery, and a copy of that document is tO be sent to this Sacred Congregation." No comment is needed since the document Sl~eaks for itself, We maynote, however, that the opening~words of n. 4: "if any of the present, members of. the community." seem to imply~ tha~ all futu're members will be obliged to take solemn vows. " A religic~us who is suffering f~om. gastric, ulcers must ~'ake medicine during the nlght~ How can he oBtaln'a dlsp~ehsafio~ from the ,eucharistic fast so that he mayreceive H

Issue 13.3 of the Review for Religious, 1954. ; A. M. D. G. Review for Religious MAY 15, i95.4 Pontificate of Pius X . , . . . J.P. Leonard Pray Reasonably . Joseph F. Gallen ¯ -Nature and Grace . : . Joseph P. Fisher New Little Office . o Adam C;.'Ellis Secular Institutes . . . Fr,~ncis N. K~orfh ¯ Father Larraona:s Golcl~n "Jubilee Questions and Answers ~ .~ Book Reviews News and Views ~ VOLUM~ Xlll,' NUMBER 3 VOLUME XIII MAY, 1954 NUMBnR 3 CONTENTS FATHER LARRAONA'S GOLDEN JUBILEE .1.1.3. THE PONTIFICATE OF PIUS X~ ~ Most Reverend d. P. Leonard, 8.J . 114 BI[,ESSED PlUS X--SOME D.ATES . 124 OUR CONTRIBUTORS . 124 PRAY REASONABLY--Joseph F. Gallen, S.d . 125 NEWS AND VIEWS-- Pius X; Adaptation and Prayer: Silver Jubilee; Congress in Canada; Summer Sessions; Institute of Spirituality . 137 NATURE AND GRACE--Joseph P. Fisher, S.J .142 NEW REVIEW OF SPIRITUALITY . 148 NEW EDITION OF THE LITTLE OFFICE--Adam C. Ellis, S.J. 149 MORE ABOUT SECULAR INSTITUTES--Francis N. Korth, S.J. 153 PLENARY INDULGENCE FOR SEVEN SORROWS BEADS 159 BOOK REVIEW (Nature and Grace). . . 160 BOOKS ABOUT MARY . 160 BOOK ANNOUNCEMENTS . 161 MARIAN YEAR PLAY . 165 NOTICE FOR PUBLISHERS . 165 "QUESTIONS AND ANSWERS-- 16. Form of Address for Sisters . 166 17. Bowing while Kneeling " 166 18.Duty of Delegate to Members Electing Him . 167 19. Cashing of Insurance Policy by Novice . ; 167 20. Tabernacle Veil for Benediction after Mass . 168 21. Flowers on Altar during Penitential Seasons . 168 PRAYER FOR SICK . " . 168 MORE INDEPEiklDENT AURELIANS . 168 REVIEW FOR RELIGIOUS, May, 1954, Vol. XIII, No. 3. Published bi-monthly: January, March,May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, under the act of March 3, 1879. Editorial Board: Augustine G. Ellard, S.J., Adam C. Ellis, S.J., Gerald Kelly, S.J., Francis N. Korth, S.J. Copyright, 1954, ,by Adam C. Ellis, S.J. Permission is hereby granted for quota-tions of reasonable length, provided due.credit be given this review and the author. Subscription price: 3 dollars a year; 50 cents a copy. Printed in U. S. A. Before writin9 to us, please consult notice on inside back cover. ON DECEMBER 8, 1953, the Most Reverend Father Arcadio Larraona, Secretary of tb~ Sacred Congregation of Religious, celebrated the fiftieth anniversary of his religious profession in the Congregation of the Missionary Sons of the Immaculate Heart of Mary (C.M.F.). Father L~irraona was born in Spanish Navarre, November 12, 1887. At the age of twelve be entered the apostolic school of the Claretian Missionaries at Alag6n, near Zaragoza. After completing his classical studies, he made his novitiate at Vich, in the Province of Barcelona, and pronounced his first religious vows on December 8, 1903. His philosophical and theological studies were made at the University of Cerv~era. He was ordained priest in Zaragoza~ in 1911. Not long after ordination be went to Rome to do post-graduate studies in canon law. He received the degree of Doctor Utriusque Juris (Doctor of both Civil and Canon Law). Several years later, in 1918, he succeeded Cardinal Massimi in the chair-of Roman Law on the Faculty of San Apollinare. He held this posi-tion for over thirty years. In 1920, together with Fathers Maroto and Goyeneche, he founded the Comrnentarium pro Religiosis. of which he is the chief editor today, and in which he continues to publish what will un-doubtedly become the most exhaustive commentary on the canons of the Code concerning religious ever attempted. For twenty-five years and more he has been attached to^ the Sacred Congregation of Religious--first, as Consultor;. then as Under Secretary; finally, as Secretary. He became Under Secretary, November 27, 1943. By an Apostolic Brief dated November 11, 1950, Pope Plus XII appointe~'d him Secretary. He has also served other Sacred Congregations of the Roman Curia and will be espe-cially remembered for the active part he took in the formulation of the Code of Canon Law for the Eastern Church. It was our privi; lege to have him preside over the First National Congress of Reli-gious in the United Sates, held at the University of Notre Dame, August 9-12, 1952. The editors and readers of REVIEW FOR RELIGIOUS extend their best wishes to Father Larraona on this. happy occasion, and they ask Our Blessed Lady, during this Marian Year, to obtain for her faith-ful son an abundance of spiritual blessings. 113 The Pon :it:ic :e ot: Plus X Most ReverendJ. P. Leonard, S.J. .| F THERE IS ANYTHING that strikes us when studying Church | history it is the amazing fact that she has weathered the most fearful storms and survived attacks both from within and from without that should, normally have wrecked any institution, how-ever solidly egtablished. The secret lies in the'words of Our Blessed Lord to His apostles: "Behold, I am with you all days even until the consummation of the world . " With special cogency do these words of Christ apply to him whom He appointed head of the Apostolic College and invested with the supremacy of power, to Peter and his successors. "And the Lord si~id, 'Simon, Simon, be-hold Satan hath desired to have you that he may sift you as wheat: but I have prayed for thee that thy faith fail not; and thou, being once converted, confirm thy brethren' " (Luke 22:31-32). The meaning is plain: as the Church rests on the Papacy as .on an unshakable rock bed, so the Papacy itself derives its security and its strength from Christ the cornerstone. The history of the Church is the history of the Papacy. It is the Papacy that ensures her well-being and expansion, that wards off the blows which are leveled against her; it is the Papacy that fos-ters and promotes her many works, that organizes and directs her mission of teaching, of guiding, of sanctifying the souls redeemed by the precious blood of her Founder. It is the Papacy that steers the 15ark of Peter over dangerous seas and through lurching reefs. We find this verified in the splendid succession of Pontiffs who occupied the Chair of Peter during the past hundred years and not least in Pius X, who was beatified June 3, 1951. Many of this holy Pontiff's activities are apt to appeal to us in a particular manner as they bear directly on the pastoral ministry. Not that his action was restricted to matters of internal organization and parochial duties. Like his illustrious predecessor and his no less illustrious succes-sors in the Chair of Peter, he had to tackle all .the intricate ques-tions of the day, ,keeping his hand on the pulse of ailing humanity so as to ~uggest suitable remedies for the many ills of mankind. ~Still it is true to say that his greatest care always turned to the direct in-terests of the Church and to the realization of the program which hc outlined at the beginning of his reign, and which "he crystallized 114 THE PONTIFICATE OF PlUS X in'the motto: lnsta{tre omnia in Christo (Eph. 1:10)--"to renew all things in Christ." I. HI~ SOCIAL MESSAGE AND DIPLOMATIC RELATIONS That Pius X, for all his-absorbing solicitude fo~ the internal organization of the Church and the spiritual improvement of the Christian communities, nevertheless kept in close touch with the so-cial,' economic, and political trends bf his time, we gather from his wise ordinances in the field of social action and from his relations with governments. 1. Social Action Aware of the important contribution which Pope Leo XIII had made towards the solution of the Social Question and in full sympa~ thy with the principles laid down in the encyclical Return novarurn, ~Pius X pledged the fullcooperation of the Church to the establish-ment of a healthy social order. In a motu proprio dated Dec. 18, 1"903, he drew up a list of nineteen propositions,, collected from various encyclicals of Leo XIII, in which he pointed out the chief pitfalls to be avoided and the safe course to be followed. He had sensed dangerous leanings towards socialism and was keenly alive to the prevalence of a growing spirit of independence and insubordi-nation to ecclesiastical authority. Soon after, he dissolved the ex-isting Catholic welfare and social-reform organization of Italy, the Opera dei Congressi, and substituted a new organization aiming at eliminating the causes of friction and at creating an atmosphere con-ducive to a healthy social action. His encyclical II ferr, o proposito (June 11, 1905) outlined a scheme of "Catholic Action~' which Plus XI wasito develop later on. W~hat he achieved for Italy, he also tried to effect for FranCe, where the Sillon (the F,urrow)--a social movement avowedly Catholic in aim--was rallying the support of the more enthusiastic and enterprising among the French Catholics. The movement, however, showed signs of drifting into dangerous innovations. Pope Plus X ordered it to be reorganized under episcopal control ~Aug. 25, 1910). In Germany, where the Catholic minority was still fighting for its rights, the guilds and ~/olkst~erein were organized on a strong sociological basis. But the Pope had to warn them against an ex-cessive independence (encyclical Singulari quadam, Sept. 24, 1912, on Catholic and mixed labor organizations in Germany). Social Relief--The kindness and charity of Pius X were a 1-15 J. P. LEONARD Reuiew for Religious byword in Rome and throughout the world. Not content with greatly encouraging charitable institutions and relief organization-s in aid .of the destitute, he set a noble example. So great were his charities that people wondered where his funds were coming from. His sympathy and support were always on the side of the weak and the .oppressed. Witness his outspoken condemnation of the harsh treatment meted out to the Indian labor in the rubber planta-tions of Peru (cf. the encyclical Lamentabili statu, June 7, 1912.). When in 1908 the town of Messina was almost entirely destroyed by an earthquake of extraordinary violence, the Pope organized a relief commission and placed the home of Santa Martha by St. Pe-ter's at the disposal of the refugees. Calabria, too, experienced his outgoing charity during the great earthquake that visited that prov-ince. Seven million francs were collected and spent in works'of re-lief and reconstruction. Nor was the Pope's solicitude confined to Italy. Public misfortunes everywhere found him ever ready to step in with a generous donation. 2. Diplomatic Relations Plus X was a lover of peace and he had nothing more at heart than to secure harmony and collaboration between Church and State. The principle that guided his policy in his relations with governments was clearly set forth in an address to Argentine pil-grims to Rome: true to God and to the Church, the Catholics were pledged to loyal allegiance to the civil authorities so long as the rights of God and the liberties of the Church were not compromised. "The Church," he said, "will always defend the constituted au-thorities, imposing love, obedience, respect and observance of the laws, helping the State to provide for the maintenance of peace." But in many countries the Church had fallen on evil days, and Plus X was hard put to it to maintain cordial relations. The spo-liation of the Papal States was still relatively recent, demanding an attitude of aloofness and protest against the Italian Government. Pius X followed the policy of his predecessors, while cautiously exploring all the avenues to a reconciliation. By opportune repre- " sentations and by exerting his personal influence he succeeded in pre-venting a divorce bill and other irreligious legislation from going through the Italian Parliament. In.,Fran.ce the religious situation was particularly difficult. In 1901 the Law of Associations against religious orders and congre-gations resulted in thousands of religious men and women being 116 May, 1954 THE PONTIFICATE OF PlUS X compelled to go into exile and closing thousands of institutions. In 1904 the famous Combes at one blow closed more than 14,000 congregational schools. In 1905 the concordat of 1901 was denounced by the French Government and diplomatic relations with the Holy See were sun-dered. A decree of separation of Church and State was passed and an aggressive campaign against the Church was launched (cf. the encyclical Vel~emer~ter, Feb. 11, 1906). The question of ecclesiastical property became a thorny one. The Government proposed the establishment of what was termed cult.ual associatior~s. Though some leading Catholics were decidedly of.the opinion that the scheme might be given a trial, the Pope in consultation with the French episcopacy rejected it as uncanonical (encyclical Graoissirao ot~icii, Aug. 10, 1906). It was a severe blow as it deprived the French clergy of all State help and made them de-pendent on Catholic charity alone. But it had the advantage of freeing the Church from all State domination. Said Mgr. Gauthey, Bishop of Nevers: "Pius X at the cost of sacrificing our property emancipated us from slavery. May he be forever blessed for not shrinking from imposing that sacrifice on us!" Pius took advan-tage of the newly won freedom to consecrate over a score of bishops, filling all the vacant sees without any .reference to the Government. _Nor was the Government x}ery happy over the results of its tyran-nical onslaught on the Church. The firm attitude of Pius X caused it 'such embarrassments that after a period of twenty st6rmy years it agreed to another, and canonical, settlement for the administration of Church property. Portugal fol!owed the pattern of France. In 1910 a revolution broke out and a republican government of a strongly anticlerical bias took over. As a result, the religious congregations were ex-pelled and their property confiscated. The c6ncordat of 1886 was repudiate.d and a decree in favor of separation of Church and State was enacted. In neighboring Spain, too, trouble was brewing. But Latin America, on the whole, remained loyally attached to the Holy See. On the other hand, the new Government of Turkey sent an am-bassador to the Vatican and shortly before the outbreak of World War I a concordat was signed with .Serbia. Pius X had not been trained in diplomacy. What guided his outlook and policy was a deep understanding of the Church's mis- Sion and the consideration of the primacy of the spiritual over the J.P. LEONARD temporal. His direct way of dealing with critical situations may not have appealed to those who favored more subtle and round-about methods of approach, but it was not less effective, while the simplicity and affability of his manner were singularly impressive and disarming. On the other hand, his firmness sprang from a deep-rooted conviction that if God permitted trials to befall His Church, it was with a view to her ultimate good and greater free-dom. While trustingly biding his time and God's chosen 'hour ,he gave his unstinted attention and care to other tasks of a more con-genial nature. II. ORGANIZATION AND LIFE OF THE CHURCH 1. Pope Pius X's name is associated with important ecclesiastical reforms. The Roman Curia--His first care was to reorganize his own household and to improve the administrative machinery at the cen-ter. His Curia had to deal with an overwhelming mass of ecclesiJ astical material. To dispose of it expeditiously is an herculean task. Pope Plus X set about overhauling the complicated organization, introducing administrative changes which experience has proved to be very wise and effective (constitution Saplentl consilio. June 29, 1908). According to the reformed system, the work is judiciously distributed among twelve Congregations, three Tribufials, and five Offices, each with its personnel and its appointed task. To give but one example, up to the reign of Plus X such coun-tries as England, Ireland, the United States, Canada, and Holland had been under the jurisdiction of the S. Congregation of Propa-ganda. The Pope placed them under the jurisdiction of the Consis-torial Congregation, thus restricting the territorial domain of Propaganda and relieving it of a considerable amount of work. Roman Commissions--As early as March 19, 1904, Plus X appointed a special Commission under Mgr. Gasparri, later Car-dinal, as secretary, to codify canon law--an urgent and most diffi-cult task already recommended by the Vatican Council (motu pro-prio Arduum sane munus, March 19, 1904). The Pope watched the prodress of this great work with the liveliest interest. But he did not live to see the pr?mtilgation of the new Code (in 1917). He also reorganized the Biblical Commission, set up a commis-sion for the revision and correction of the Vulgate text of the Bible, and in 1909 founded the Biblical Institute for Scriptural studies. Another commission was entrusted with the revision of the brevidry. 118 May, 1954 THE PONTIFICATE OF PIUS X New Ecclesiastical Units--Nor was the Pope less concerned with the progress of the Church at large. During his tenure of office, Plus X created twenty-eight new dioceses, sixteen vicariates apostolic, and. fifteen prefectures apostolic. 2. But above all he directed his attention to matters of ecclesi-astical discipline, to promoting the liturgical and devotiona~ life of the Church and to Christian doctrine. " Training of the Clergy- As I~ishop, his chief care had been de-voted to the formation of the cler~gy. No wonder that as P~ope the functioning of the seminaries became the object of his constant so-licitude. Small and inefficient semin,aries were suppressed. Where necessary, r,egional seminaries were established. A new order of studies based oh that of the Roman seminary was promulgated, and bishops were exhorted to spare no pains in seeing that the candidates to the priesthood were properly trained in learning, ~iety, obedience, and zeal. His exhortatioh to the clergy all over the world gives ex-pression to his inmost desires and tender solicitude in this direction. It was published on the occasion of the 50tI~ anniversary of his own priestly ordination (Aug. 4, 1908). Full of affection and wise counsel it concludes with the words: "Reform of the priesthood is the~best gift that can be offered Us on the occasion of Our own sacer-dotal jubilee." Care for the lntegrit'g of the Faith--The purity,of the faith Pope Plus X cherished like! the apple of his eye. Aware of certain dangerous tendencies that threatened the objective and immutable character, of the Catholic teaching, he ~¢as loud in his denunciation and drastic in his condemnation. In the decree Larnentabili (July 3, 1907) he singled out .sixty-seven propositions for ecclesiastical censure. This syllabus was followed shortly afterwards by the en-cyclical Pascendi (Sept. 8, 1907) in which he dealt with modern-istic innovations, and laid down wise rules as to how to combat these pernicious doctrines. Among the means he advocated, he in-sisted particuiarly on the censorship of books and the creation of a "Committee of Vigilance." Subsequently, by the motu proprio Sacrorurn Antistitum (1910), he prescribed the oath against Mod-ernism. ' Solicitude /:or the Divine Worship--Anxious to preserve pure and intact the sacred deposit of faith and the traditional teaching of the Ch~urch, Pope Plus X was no less concerned with the honor of the house of God and the splendor of the liturgy. He earnestly de-sired that the liturgical functions should be a worthy manifestation 119 J. P. I~EON_ARD Review for Religious of faith and devotion. Lex orandi lex ~redendi. To that end he insisted that Church music should be in keeping with the decorum and respect due to divine worship~. As a parish priest, as Bishop of Mantua, and as Patriarch of Venice he had shown himself an ardent promoter of the Gregorian chant and had befriended and patronized the distinguished ~omposer Lorenzo Perosi. As Pope he published the Motu proprio on sacred music (Nov. 22, 1903) stating the general guiding principles of the Church and drawing up clear regu-lations. , "Sacred music," he wrote, "should possess in the highes~ degree the qualities proper to the liturgy, or, more precisely, sanctity and purity of form from which its other character of universality spon-taneously springs. It must be hold/, and must, therefore, exclude all profanity, not only from itself, but also, from the manner in which it is presented by those who execute it. It must be true art, for otherwise it cannot exercise on the minds of~ the hearers that in-fluence which the Church contemplates when she welcomes into her liturgy the art of music. But it must also be unfioersaI, in the sense that, while every nation is permitted to admit into i~s ecclesiastical compositions those special forms which may be said to constitute its native music, still these forms mustbe subordinated in such a man-ner to the general characteristics of sacred music that no one of any nation may receive any impression other than good on hearing them." S~ecial emphasis was laid on congregational singing. Says Plus X: "Special efforts are to be made to restore the use of the Gre-gorian chant by the people, so that the faithful may again take a more active part in ecclesiastical offices, as was the case in ancient times" (Motu proprio, n,. 3). The Motu proprio also directs that a commission be appointed by the Ordinary to watch over all musical performances. This papal ordinance served a useful purpose. It not only clearly deter-" mined the character of genuine Church music, but it recalled to the attention of the Catholic world the dignity and beauty of the liturgical services and impressed the minds of the faithful with a proper sense of what was due to the majesty of God and the sacred-ness of, His Temple. Devo6on, to the Holy Eucharist~Pius X has been rightly called the Pope of the Holy Eucharist. To combat the lingering in-fluence of Jansenism, he recommended the reception of frequent and even daily Communion. He relaxed the Eucharistic fast in favor of the sick so that they might receive holy Communion twice a month. Marl, 1954 THE PONTIFICATE OF PlUS X or oftener, though unable to.keep the fast. By the decree Quam singulari, dated Aug. 8, 19'10, he ruled that children should be ad-mitted to First Communion shortly after they have attained the age of discretion. What untold blessings for the young accrued from this bold and salutary innovation it is difficult to say. It was of the nature of a minor revolution in the training of the young and laid ¯ them under an everlasting obligation to the loving kindness of the Sovereign Pdntiff. It was at the express desire of Pope Plus X that the Eucharistic Congress of 1905 (the sixteenth) was held in Rome--an event of unprecedented grandeur which set the pace for yet greater develop-ments. As a fitting sequel to that memorable function the Pope pub-lished in December of the same year the decree Sacra Tridentina Synodus advising daily Communion. Devotion to Our Lady--Equally earnest ~vere the Pope's efforts to promote devotion to Mary Immaculate. He extended the commemoration of Our Lady's apparition at, Lourdes to the whole Western world. In 1904 he caused the fiftieth anniversary of the proclamation of the dogma of the Immaculate Conception to be cele-brated with unusual pomp and solemnity. On this occasion he published an encyclical (Ad diem illum), and a Marian Congress was held in Rome, culminating in the crowning of the image of Mary Immaculate in the choir of St. Peter's. Religious Instruction -- Intent on safeguarding the faith against the inroads of Modernism and on promoting piety among the faith-ful, Pius X realized--as no one better--that the best means of achieving his object lay in making the teaching and example of Our Lord better known and loved. Hence his great insistence on reli-. gious instruction. As a parish priest and bishop he had been most assiduous in instructing his people. As Pope he laid special stress on this obligation of the sacred ministry, setting the example by preaching a homily on the Gospel in one of the Vatican courtyards every Sunday. Catechism teaching received a fresh and vigorous impetus after the publication of the encyclical Acerbo nimis, on the teaching of Christian doctrine (April 15, 1905). In this document Pius X attributed the prevailing religious crisis to the widespread ignorance of divine truth and laid down strict regulations concerning the duty of catechizing. He enacted that (1) all parish priests, and, in gen-er, al, all those entrusted v~ith the care of souls, shall on every Sun-day and feastday throughout the year, without exception, give boys 121 J.P.,L~ONARD Reoie~ for Religious and girls an hour's instruction from the catechism on those things which everyon~ must believe and do in order to be saved; (2) at stated times during the year they shall prepare boys and girls by continued instruction, lasting several days, to receive the sacraments of penance and confirmation; (3) they shall likewise and with special care, on all the week day~ in L~nt, and if necessary on other days after the feast of Easter, prepare boys and girls by suitable in-struction and exhortation to make their First Communion in a holy manner; (4) in each and every parish, the society.commonly called "Confraternity of Christian Doctrine" shall., be canonic~lly erected: through this the parish priests, especially in places where there is a s.carcity of priests, vcill have lay helpers for the catecbetical i~struc-tion in pious persons who will devote themselves to the office of teaching. To give effect to this enactment Plus X bad a new cate-chism prepared for use in the Diocese of Rome and in its ecclesiastical province and expressed a desire that it should be adopted throughout Italy. Nor was he less emphatic in prescribing catechetical instruction to adults. We know that the ruling on the subject contained in canon law (cc. 1329-1336, particularly 1332, 1335) Was inserted by his special recommendation. Thus did he hope to oppose an effective remedy to what be deplored as the pernicious, source of the prevailing religious indifference and neglect of the Church's services. CONCLUSION ~,Ve have considered some of the activities of the saintly Pontiff. Summing up his reign, U. ]Senigni writes in the Catholic Encyclo-pedia: "In a few years Plus X has scored great, practical,-and lasting results in the interest of Catholic doctrine and discipline, ,and that in the face of great difficulties of all kinds. Even non-Catholics recognize his apostolic spirit, his strength of character, the precision of his decisions, and the pursuit of a clear explicit programme." (Cf. conclusion of article "Pius X.") ¯ Outward achievements of consequence are indeed a credit to a man, a proof of ability~, a monument to his name. But they do not tell the whole tale. Yv'hat is of greater importance is to probe~the inner spirit that lay back of the actions and prompted them. St. Ber-nard, ~riting to his former disciple Pope Eugene III, reminded him that outward works, however .holy~ and worthy they might be in themselves, were of no value unless they were inspired and sublim-ated by a pure intentiori and actuated by holy motives: they might 122 May. 1954 THE PONTIFICATE OF PlUS X even be fraught with danger inasmuch as by their m, ultiplicity and deadening pressure they were apt to choke and stifle the spirit, as too much wood heaped on a flame causes it to be smothered. In the case of Plus X, we know for certain, nothing of the kind wa, s to be feared: he never allowed himself to be diverted from his own great purpose and ideal: All for Christ! To restore all things in Christ ! There was more than this lofty singleness oi~ purpose, this un-swerving orientation of all his activity towards a cherished goal. All those who had the privilege of approaching him and dealing with him were deeply impressed by the character of holiness that radiated from him and was reflected in his manner, speech, and every action. Baron yon Pastor says of him: "He was one of those chosen few men whose personality is irresistible. Everyone was moved by his Simplicity and his angelic kindness. Yet it was something more that carried him into all hearts, and that 'something' is best defined by saying that all who were ever admitted to his presence had a deep conviction of being face to face with a saint--and the more one knows about him the strc~nger this conviction becomes." It was this conviction that led the Cardinals of the Roman Curia as far back as February 1923 to petition that the cause of his beati-fication and canonization be introduced, Their fond hope has be-come a glorious reality. Pope Plus X was solemnly beatified on June 3, 1'951--50,000 pilgrims crowding St. Peter's to venerate him and to invoke his blessing. But long before the authoritative decree was read out, the popular voice had anticipated the official pronouncement. People had not the slightest doubt about the re-sult of the process, more than 200 witnesses testifying to his heroic virtue. What they prayed for during the years that intervened be-tween his death and his glorification, what they desired with all the ardor of their hearts was that the day should not be too long de-layed, that they should live to see their hopes come true. During the Holy Year it was quite a usual sight to behold groups of pil-grims kneeling on the spot over the Pontiff's tomb and reciting the prayer for his beatification. Rome has spoken. The happy event has brought jubilation to millions of souls. We share the joy of our fellow Catholics all the world over. With them we acclaim the new Beatus and recommend ourselves to his powerful intercession. But let us do more. Let us take to heart the lesson of his saintly life. Let us impress upon ou,r minds and hearts the wise directions he addressed to the Catholic world during his fruitful Pontificate, 123 J.P. LEONARD par.ticulaily those that concern us more directly in regard to our per-sonal safictification and in regard to our pastoral duties. Let us im-plore him to obtain for us an ardent love for Christ Our Lord, an unflagging zeal for His dear interests, a sincere devotion to the Holy EuCharist and :o Mary Immaculate, and, last not least, a loyal at-tachment to the Vicar of Christ on earth, an active interest in the Church's welfare, a self-sacrificing gift of ourselves to souls in the exercise of our calling. Blessed Pius, p?ay for us. Amen. Blessed Pius X--Some Da'l'es 1835:Giuseppe Sarto born of poor parents at Riese, in the territory of Venice. 1858: Ordained a priest.--Parish ministry. 1875: Canon of Treviso, rector of the seminary. - 1884: Bishop of Mantua. 1893: Cardinal and Patriarch of Venice. 1903 : August 4, Elected Pope. Oct. 4, Encycl, E supremi: restoration of all things in Christ. Nov. 22, Motu proprio on Sacred Music. 1904: March 19, Commission for the codification of canon law. 1905: April 15, Encycl. Acerbo nimis: teaching of Christian Doctrine. 3une 1 !, Encycl. II fermo proposito: 'Catholic Action.' Dec. 20, Decree Sacra Tridentina &.lrmdus: daily Communion. 1907: Sept. 8, Epcyd. Pascendi: against Modernism. 1908: 3une 29, Constit. 8apienti consilio: reorganization of the Curia. Aug. 4, Exhortatio ad Clerum Catbolicum. Haerent anlmo. 1910: Aug. 8, Decree Quam sinqulari: Communion of children. 1911 :.Nov. 1, Constit. Dit~ino aOtcttu: new disposition of the psalter in the.,brevi-ary. 1913: Oct. 23, Motu proprio Abhinc duos annos: reform of the breviary. 1914: Aug. 20, Death of Plus X. ' 1951: June 3, Beatification. 1954: May 29, date scheduled for canonization. (Even this brief list of documents makes one realize how deep an influence Plus X has had on almost every aspect of the life of the Church.) OUR CONTRIBUTORS MOST REVEREND J. [3. LEONARD i:; Archbishop of Madurai, India. JOSEPH F. GALLEN is professor of canon law at Woodstock College, Woodstock, Mary-land. JOSEPH P. FISHER is master of novices at St. Stanislaus Seminary, Floris-sant, Missouri. ADAM C. ELLIS and FRANCIS N. KORTH are members of our editorial board and professors of canon law at St. Mary's College, St. Mary's, Kansas. 124 Pray Reasonably Joseph F. Gallen, S.J. ALL will agree that prayer is supremely,necessary in the religiou.s life; all will admit also that the necessity in modern times is an intensification, not a minimizing of prayer. The same agreement should extend to the principles t.hat the amount of pre-scribed prayer should not be. impracticable or even impossible, that it should harmonize and not conflict with work, that quality, quan-tity, and preference should be based on the purpose of the religious life, self-sanctification and the sanctification of others, and that pro-longed prescribed prayer does not necessarily produce a prayerful re-ligious. The following pages are ~n examinfition of the practicable amount and quality of prayer in lay religious congregations of ac-tive purpose. ~Attention is directed principally to the excess and ex-ternal defects of prayer. All will not agree with every opinion here expressed, but the purpose of the article will be attained if it leads to a more common recognition and practical study of a very im- 'portant problem) l, Hour o/: ddt~g. This should be such as to give sufficient sleep. It should not be so early that it is excessively difficult in itself and causes the burden of too long a day. An efficient hour of rising also depends on the climate. It is my opinion that the hour of rising for religious of active purpose in the United States should not be earlier than five-thirty. This applies also and especially to religious engaged in l~ospital and institutional work. Some now rise ~it five o'clock and even somewhat before five. The early hour is frequently caused by an unthinking tenacity to what~has been done in the past, to the equally unjustifiable principle of making the horarium exactly the same in all countries in which the institute has houses, and, I believe, especially and more commonly to the excessive number and duration of the religious exercises. The Holy See in its practice in approving constitutions has stated more than once that the religious exercises should not be multiplied excessively. Habitual physical exhaustion is not conducive to a life of pray-er. Some other pertinent facts that are worthy of practical reflec-tion under this same heading are: the lack of a weekly holiday and 1Please see our observation~ relative to "Adaptation and Pra}'er," p. 138.--ED. 125 JOSEPH F. GALLEN Retyieu~ [or Religiou~ of a summer vacation, excessive occupations during the Christmas and Easter vacations and during the summer, the burdening of days free of class with too many added spiritual duties, and overwork in general. 2. Mornin9 pra~ters. Neither the Code of Canon Law nor the prac-tice of the Holy See contains any prescription on morning prayers for religious. The constitutions of lay congregations usually en-join morning prayers in common. An enactment that all the mem-bers of the co.mmunity must be present in the chapel for vocal prayer five minutes before the beginning of meditation is reasonable and helpful. No objection can be made to the usual practice of saying these prayers in common. There would also be no imp.erfection in a practice of saying them privately. The excess in vocal prayer in many institutes begins with the morning prayers. I find it difficult to admit as reasonable any duration of these prayers beyond five minutes. This opinion seems to be evident with regard to those in-stitutes that prescribe the daily recitation in private and especially in choir of the'Little Office of the Blessed Virgin Mary or any equiva-lent amount of vocal prayer. Very many lay congregations are in this category. The repetition of the same prayers, for example, Our Fathers and Hail Marys repeated many times for various ahd, perhaps, almost endless intentions, is something that should be avoided as the matter of common vocal prayer. Such practices tend to make prayer monotonous, mechanical, and formalistic. An ex-ample of the lack of balance of vocal with mental prayer would be a usage of twenty or twenty-five minutes of ordinary morning prayers and a half-hour of meditation. I believe that the proper balance here would be five minutes of morning prayer and forty-five minutes of meditation and that no other meditation should be obligatory for that day. 3. Meditation. Here, unfortunately, is the greatest weakness in the prayer of very many individual religious and even of entire in-stitutes. Many do not in fact evaluate m~ntal prayer as the most important prayer for the gefieral and special purpose of the religiou~ life, personal sanctification and the sanctification of others. Canon 595 commands religious superiors to take care that their subjects make a daily meditation but it does not define the duration ~of the meditation. It may be argued that the practice of the Holy See as stated in 1901 favors an hour of meditation, half of which may be made in the afternoon. It' is also recognized that the Holy See con- 126 May, 1954 PRAY REASONABLY siders meditation as one of the most important daily exercises and that dispensations should be granted only very rarely and for very serious reasons. The Sacred Congregation of Religious now con-stantly approves constitutions that demand only a half-hour of meditation. A few congregations have an hour in the morning and a half-hour in the afternoon. I presume that most authorities would incline to a daily medi-tation of an hour. However, such practical facts as a seven-hour day in school, a twelve-hour day and perhaps a seven-day week in a hos-pital or institution, and the amount of prescribed vocal prayer can-not be ignor.ed. I believe that the practical and proportionate amount of mental prayer is forty-five minutes, unless the institute prescribes the Little Office or a similar amount of vocal prayer. In this case a, half-hour of meditation seems to be the only practical norm. A half-hour is the absolute minimum, and no other exer-cises, such as morning prayers, should be permitted to detract from this amount. This is not the time to adduce many arguments and authorities to prove the necessity and value of mental prayer for the religious life. It will suffice to quote the present Roman Pontiff. His words in the apostolic exhortation Menti Nostrae are concerned directly with priestly sanctity but they apply with even greater force t6 the religious life, since its .obligation is that of striving for complete evangelical perfection: "Hence We feel Ourselves under serious ob-ligation to exhort you, in a special manner to the practice of daily meditation, which the Code of Canon Law also recommends to all clerics. Just as by this daily meditation zeal for priestly perfection is strengthened and re-enkindled, so also from neglect of this p.rac-rice arises that disgust with spiritual things whereby piety grows cool and languishes, and whereby not only is each one's pursuit of sanctity broken off or slowed down, but the activities of the sacred ministry likewise suffer no small harm. Wherefore, in all truth We assert that the special efficacy attached to meditation cannot be sup-plied by any other means and, consequently, that nothing else can replace the practice of daily meditation." Meditation discloses another general defect in prayer. One of the difficulties in meditation is the insistence on a common book of pre-paration or points, which are read in common to all. This practice is only one manifestation of the false general principle that all prayer must be in common. The standard proof advanced is that Our Lord is present wherever two or three are gathered together in 127 JOSEPH F. GALLEN His name. It can be retorted that the soul of every individual in the state of grace is the temple of the Holy Ghost. The plan of prayer in any religious institute should leave sufficient time and opportunity for individual 'prayer, for the individual to follow the inspiration df the Holy Ghost, and for the satisfaction of individual desires in prayer. The same meditation book and the same spiritual reading book do ,not suit nor al3peal to all. The individual should be per-mitted here to ~hoose his own book. He shou!d also be permitted to make his spiritual reading and to say the rosary in private and at the times, he finds most convenient. The Holy See has approved con-stitutions that explicitly permit the individual preparation of the meditation and spiritual reading and the rosary in private. Another manifestation of excessive uniformity i'n, prayer is in the po~sition during meditation. In many lay congregations, if not practically all, it is the custom for all to sit down .always for the en-tire meditation, except for a few minutes at the end. This is a very practical means of attaining a sluggish meditation. The principle of evident common sense is that the individual should take the posi-tion that he finds most conducive to prayer at t~h$ moment. 4. Mass. No one will question that this is the supreme act of the day. The recollection of the sacred or great silence, morning pray-ers, and the meditation should have prepared the religious for Mass. It is to be presu.med that all know how to assist profitably at Mass and are conscious of the necessity and value of thanksgiving 'filter Communion. I do not think it necessary to delay on daily Mass and Communion but I am convinced that it is imperative to draw attention to the very universal cult of.thd "second Mass." Religious who have only a half-hour of morning meditation usually recite the Little Office for twenty or twenty-five minutes be[ fore Mass. At the end of the thanksgiving they will thus. have spent an average of an hour and forty or forty-five minutes in con-tinuous prayer while .still fasting. In~ a few institutes this time reaches two hours. Every principle of common sense says that this is enough prayer for the early morning. There should be no fer-vent stampede to the chapel or even outside the house for a second Mass. "But the Eucharist is the center of our lives!" Even with regard to the most h~ly things it is a clear postulate ~f God's law that our conduct should be reasonable. There has been enough prayer thus far; there will be too much prayer during the regt of the day. Now is the time for other things, especially for a reasonable, Ma~l, 1954 PRAY REASONABLY if brief, period of free time and of relaxation of body.and mind, for work and preparation for class. We can reverence the Eucharist reasonably by assisting at one Mass as perfectly as possible. It is at least interesting to note how many institu'~es allow only thirty or thirty-five minutes for the community .Mass inclusive of thanks-giving, and yet a second Mass in their chapels always commands a very large attendance. Why not give the proper time of forty ,or forty~five minutes to the community Mass? This custom of attendance at a ~econd Mass suggests at least to my mind similar practices and a very important and basic question. Some institutes have an astonishing number of novenas during the year. There is a pronounced susceptibility to anythin~ bearing the name of litany. The mention of sufficiently rare practices of devo-tion is not infrequent. No month or day that offers an opportun-ity for special devotions in common is passed over. Visits to the Blessed Sacrament are distinguished by prescribed xCocal prayers and frequently enough by the repetitign of the same vocal prayers. The market for extraordinary and even unreasonable practices ;of piety is notably wide. There should be some practices of devotion in the lives of all religious, but I think it is legitimate to a'sk v~hett~er prac-tices of devotio'n have not engrossed and smothered the s~iritual liv'es o~ too many, religious, whether devotionalism has not supplanted the prayer of sanctity, mental prayer. Have we too many pious and devout men arid women rather than saintly religious? many practices of piety but few really interior and deeply prayerful religious? long prayers but too little mortification? many hours in the chapel but relatively little desire for detachment and self-conquest? 5. Little O~ce of the Blessed Virgir~ Mar~. The recitation of the Little Office in choir or privately is not commanded by the Code 9f Canon Law nor by the practice of the Holy See in approving con-stitution~. There are lay congregations that recite no office; but the Little Office is more usually prescribed in such institute~. The Holy See in 1901 commended, generally speaking, the choral recitation of at least a part of'the Little Office to these congregations. Constitu-tions enjoining only the private recitation of the office are relatively few. The amount and extent of the choral recitation prescribed in other institutes is sufficiently varied. In'some congregations the whole o.ffice is recited daily in choir in all the houses; in others this same obligation extends only to the mother housh, while houses en-gaged in the external works of the institute recite the entire office in 129 ' , JOSEPH F. GALLEN Reoieu) for Religious choir only on Sundays, holydays, and other vacation days; finally, some institutes demand that only a part of the office be recited daily in choir. The Little Office in lay congregations is a laudable approxima-tion to the public prayer of the Church. The widespread efforts to make the choral recitation more correct, prayerful, and edifying are equally praiseworthy. However, our present question is primarily the practicability of the prayer assigned in lay cbngregations. The choral recitation of the entire Little Office appears to take an hour and ten minutes. Considering the crowded and burdensome day of such institutes, I think this is entirely too much. In my judg-ment no more than a half-hour daily should be given to the choral recitation. Furthermore, if an institute imposes the Little Office in choir or privately, I do not believe that any other vocal prayers should be prescribed daily, especially in common, except the rosary and the vocal prayers of morning and evening visit. The quantity of religious exercises assigned to any period.of the day should not be overwhelming. We can accept as a maxim that a very good way of obtaining little prayer is to assign too much pray-er. For example, is it reasonable to impose the burden of a solid hour and a ball or two hours of spiritual duties in the afternoon and after a seven-hour day in class? Is it likely that the time ac-tually given to prayer will be proportionate to the time assigned to prayer? Does such a usage make reasonable allowance for'physical fatigue, necessary work, hospital or institutional schedules, prepa'- tion for class, and advance in knowledge? Religious should also be allowed the satisfaction of completion in prayer; they should not be subjected to the somewhat nagging tendency of having prayers constantly tacked on. Why should a long period of ordinary vocal prayers be added to the chorhl recita.- tion of the office? Why must several Our Fathers and Hail Marys, litanies, and acts of faith, hope, and charity be always tacked on to the office? , 6. Examen of conscience. Canons 592 and 125 oblige religious su-periors to take care that subjects make at least one daily examina-tion of conscience. The Code does not impose any determined method, frequency, or duration. Some congregations make the examen only once a day. The more usual frequency is twice, at noon and at night. The duration also varies, and five, seven, ten, and fifteen mintifes are found in constitutions approved by the Holy See. A general and particular examen twice daily of seven minutes 130 Mag, 1954 PRAY REASONABLY appears to me to be the reasonable and proportionate norm. Constitutions of lay congregations that prescribe the particular examen more commonly state that the particular examen is to be made at noon, the general at night. This has always seemed to me to be a strange practice. There is no doubt that the general examen may be separated from the particular and that the general may be confined to the evening, although the preferable practice for religious is to make both together. The strangeness is found in making the particular only at noon. Is it the intention to strive for the con-quest of a particular defect or the acquisition of a particular virtue for only half the day? If not, isn't it rather unnatural to examine oneself on this matter from noon to noon? 7. Spiritual reading. The Code of Canon Law contains no pre-scription on this matter, but the practice ~f the Holy See demands that an appropriate amount of time be given daily to spiritual reading. The varying times found in constitutions are thirty, twenty, and fifteen minutes. I believe that twenty minutes is the practical and proportionate amount. It can be reasonably suspected that the value of spiritual reading as an aid and remote preparation for mental prayer has not been too universally realized. The book and manner of reading should habitually be reflective and prayerful rather than merely informa-tional. The one book read in common for all, usually in the chapel, is the very common practice. I do not think that this practice is justi-fiable. As stated above, each professed religious should be permitted to choose his own book and to make the reading at the time that he individually finds most convenient. It is presumed that the book will be profitable and that the religious will follow any direction of competent authority. It is understandable that all should assemble for some of the religious exercises, for example, morning visit, medi-tation, examen, preparation for meditation, and night visit. Other-wise it can be reasonably feared that the faithful performance of these exercises will be too deficient. The religious necessarily as-semble for Mass and the choral recitation of the office. Not only the crowded and laborious day but also the fact that the religious should be trained in and given an opportunity to exercise individual re-sponsibility urge the conclusiqn that such duties as spiritual readil~g and the rosary should be in private and at the times chosen by the individual religious. 131 JOSEPH F. GALLEN Reuietu for Religfo,,~ Some institutes have an exercise called lecture. This apparently means an assembly in which~ the superior reads a chapter or two of the constitutions or something from another spiritual book and gives any general corrections or makes any announcements that he or she thinks necessary or opportune. This exercise is usually prescribed almost daily or at least several times a week. I do not. see the ne-cessity or value of such an exercise in the crowded day of the reli-gious we are discussing. Private spiritual reading will be rfiore effi-cacious. If desired, the chapter of two of the constitutions could be read more practically in the refectory at one or two meals of each week. I find it difficult to conceive of a religious community so gen-erally errant that the superior must have the opportunity of giving a common correction sever, al times a week. Few announcements in a religious community are of such a private nature that they cannot be posted on a notice' board or, if private, cannot be communicated in other ways than by a special assembly. I see no reason why it should be necessary to give the superior such an opportunity more than twice a month at the very most. Some constitutions explicitly state the very reasonable interpre-tation that a,n unusual religious exercise, such as an instruction, conference, Benediction, Holy Hour, or chapter of faults, dispenses from the obligatory daily spiritual reading. 8. Rosary. Here also canons 592 and 125 apply and oblige supe-riors to take care that their subjects say the rosary daily. Five decades are sufficient. 9. Visits to the Blessed Sacrament and similar matters. The same canons oblige superiors to take care that their subjects visit the Bles-sed Sacrament daily. Visits that total fifteen minutes a day are cer-tainly sufficient as far as canon law is concerned, anh there is no doubt that the prescribed visits in lay congregations far exceed this amount. The obligatory visits in common should not be multipiied ex-cessively. I see no reason why these should not be confined to the mo~ning and night visits and to visits after each meal. The dura-tion should not be too prolonged. Five minutes should suffice for these visits. They should~not be put at a time that causes a conflict with or inconvenience to work. For exdmple, it is not reasonable to prescribe a visit at an hour when practically all the religious must be at work. Visits as found in lay congregations manifest the overemphasis 132 Ma~l, 19,54 PRAY REASONABLY on vocal prayer in common, particularly of the repetition of the same prayers. The usual repetition is that of Our Fathers and Hail Marys for a multiplicity of intentions. The obvio.us first recom-mendation is that the intentions for which such prayers are being offered should be most thoroughly examined. It is certain that some of these constit'ute the unreasonable perpetuation of the individual fervor of superiors of the past. The intentions should be restricted to those that can be classed as necessary or of unusual and common value. I see no reason why the prayers for most of these intentions should be in common. Why would it not suffice to post~or to read in the refectory once a month all the prescribed intentions and the prayers to be said by all privately for each intention? A notice could be similarly posted or read for any prayers for occasional spe-cial intentions. Prayer in common can be and is exaggerated in these institutes. We are to remember that God is the Heavenly Father of each one of us. A~ religious should be granted some time alone with his Father. Under this heading we must add the prin-ciple contained in many constitutions approved by the Holy See: no local superior should be allowed to add in any way to the pre-scribed religious exercises withoht the permission of"a higher~ supe-rior. This ,permission should be granted 6nly rarely, fqr an im-portant matter, and temporarily. A Holy Hour in common is imposed weekly in some institutes. Wouldn't it be more reasonable to confine this to the eve of First Friday? The months of March, May, June, October, and Novem-ber and the season of Lent ar. frequently the occasion of obligatory special devotions in common. The prudence of imposing common devotions during all of these times can be questioned. The duration of such devotions .should not ordinarily exceed five minutes. Pro-longed devotions of thi~ type can raise the prescribed daily religious exercises to a most formidable and even impossible total and can easily weary rather than strengthen the spirit of prayer. In institutes that do not have the Little Office the common, vocal prayers apparently intended as a substitute are sometimes excessive. I do not think that the time assigned for such prayers added to that given to meditation should total more than an hour and twenty minutes. The same general type of excess is verified in'the addition of a considerable amount 6f other vocal prayer to the Little Office. Private visits are to be encouraged, as is the Way of the Cross in private. Most of these visits should be very brief, but it is a good 133 o ,JOSEPH F. GALLEN Review for Religious practice to make one visit a day that is rather prolonged, i.e., aboiat ten 6r fifteen minutes. A religious who never makes a private visit has to be classed as quite deficient, but the emphasis on individual visits and time before the Blessed Sacrament can also be exaggerated. The encomium that a religious spends all his time before the Blessed Sacrament can be questioned. It is impossible in a laborious life. We have been implying thus far that the religious exercises cannot be prescribed without careful consideration of the long and heavy labors in the works of the institute. Another consideration is equally important. The day of the religious must permit proper ¯ prepaiation for class and other work and some time also for advance study in his field. It is a certain fact that this time is completely insufficient in practically all lay congregations. Especiall';- the higher fields of knowledge require protracted periods of study and cannot be mastered or prepared for class presentation by intellectual snacks of five minutes here and there. 10. Preparation for meditation. Eight minutes should suffice for this exercise. Individual preparation will also eliminate the dry serving of points at ten-minute intervals during the meditation. This practice h~s certainly contributed to the dehydrated and dessi-cated complexion of the mental prayer of many religious. 1 1. Silence, cloister, and l~orarium. In the religious life the sacred or ,great silence lasts from the time of a definite exercise in the evening until an appointed time in the morning. This silence demands that no one shall speak except for a serious reason and then as briefly as possible and in a low voice. The work of the institute is something of an obstacle to silence throughout the day, but as far as possible ordinary religious silence is to be observed during the day; i.e., in the house and outside of recreation religious talk only of what is necessary, useful, or demanded by courtesy. The purpose of reli-gious silence is a recollected and prayerful life. One of the purposes of cloister is to exclude unnecessary distractions and thus also to help to a life of recollection and prayer. Silence and cloister tend to recollection partially by effecting a quiet, calm, and peaceful,tenor of life. We canreasonably doubt that the horarium in lay congre-gations tends to the same effect. Isn't the daily life of many such religious a scurrying, headlong, excited, and feverish rush from duty to duty? The point I wish to make is that such a pace is an evident obstacle to a recollected and prayerful life. The excited religious is not a prayerful religious. I realize that there are difficulties, espe- 134 Mag, 1 ~ 5 4 PRAY REASONABLY cially that of overwork, in adjusting the horarium, but some ad-justment is possible. The horarium must be less minute, less insis-tent on everything in common; there must be more breaks, more free time, more attention to rest and less to keeping the religious busy; more easing of the tension; more emphasis on sincere interior prayer than on long prayers. 12. Chapter o1: faults. This is not mentioned in the Code of Canon Law nor is it of obligation from the practice of the Holy See. How-ever, the constitutions of lay congregations usually prescribe the chapter of faults. The norm of frequency stated by the Holy See in 1901 for congregations that had the chapter was that it should not be prescribed more frequently than once a week nor less than once a month. As actually found in constitutions, the greater number of institutes have it once a month, others every two weeks or weekly. A few institutes have the ch~ipter very rarely. In one congregation approved by the Holy See the chapter is held only four times a year. I believe that the proportionate frequency would be no more than once a month at the very most. In practice the chapter is an assembly in which the religious ac-cuse themselves of external violations of religious discipline. The superior assigns a penance after the accusation and in some institutes adds a counsel, admonition, or correction. The chapter is an exer~ cise that can readily become mechanical. It has been praised as very useful by some canonical authors, but I incline to an emphasis and insistence that the superior should be more of a spiritual guiding force for the community and the individual rather than an executive or a mere dispenser of permissions and that he shouId have the courage to give individual an~l private correction when this is neces-sary or advisable. 13. Annual retreat. Canon 5'95 commands religious superiors to take care that their subjects make an annual retreat. The Code does not determine the method, duration, nor manner, in common or in private, of the annual retreat. The duration ordinarily found in constitutions is eig]~t or six days. A very few institutes have a duration of seven or five days. Eight full days constitute the pref-erable duration. 'Many suggestions could be given for making retreats more profitable, but I wish to confine myself to a matter that is abso-, lutely fundamental. The basic reason why retreats to many reli-gious institutes are not producing a more marked profit is that very 135 JOSEPH F. GALLEN Review for Religious few of their religious ever really make a retreat. The usual practice in' an Ignatian "retreat to religious in the United States is that, the director, in addition to a practical conference, gives the preparation for three meditations, but in inang institutes the retreatants make only one meditation and that o.nly for the time of their ordinary morning meditation. What an unreasonable~ .contradiction! The primary instrument of~a retreat is meditation, and yet almost no one will meditate! To give preparations for meditations that have no possibility Of existence! To be faced by so many religious who are completely unconscious of the fact that they should meditate! The meditation that tells the director all is that after breakfast on the first day, If, as soon as he has finished giving the preparation, he sees all the religious leaving swiftly with a sense of completion, he knows that it is the same old story, a retreat th'at is not a retreat, a retreat wihout the essence of a retreat, spiritual exercises dominated by.passivity. Isn't this very wide practice a clear indication that mental prayer has lost its rightful place in the life of many religious institutes? It is also a practice that should not be permitted to con-tinue, The retreatants should make each meditation for at least forty-five minutes and should spend ten minutes in reflection after each meditation.- Any other religious exercises of the communl,ty that c6nflict with the time or energy demanded by the retreat should be abbreviated or omitted. In a few institutes the director is asked, after giving the prepara-tion for the morning meditation the previous evening, to repeat this preparation or even to make the meditation with the community the next morning.' The reason often given fdr the request is that this is what is done during the year, the points for the morning rfieditation are read the night before and also in the morning before the meditation. It is very difficult to be patient with such a request. The memories of nb religious community are so generally de, ficient as to justify this' request, and it is to be held as a firm pres~mption of the law of the Church and a clear principle of common sense that mental prayer is within the power of all religious. 14. Montblg recollection. The constitutions almost universally ' prescribe a day of monthly recollection. This exercise'is not com-manded by canon law, but Pius XI earnestly urged the practice even to lay people to conserve the spiritual profit of the retreat and also as an,efficacious spiritual means in itself. Inasmuch as the day of recollection participates of the nature of a retreat, mental rather than 136, May, 1954 NEWS AND VIEWS vocal prayer should be favored in any added exercise. Many consti-tutions propose or emphasize this practice as a day of preparation for death. Since the aspect Of death is apt in fact to give the practice a completely negative character'of self-examination and. to minimize that of progress, I would have preferred its omission. 15. Tridua. Some congregations prescribe a triduum, in fact, a full three-day retreat, at the close of the year. The practice is in itself commendable, but I doubt that it permits the r.eligious to have the rest during the Christmas vacation that their strenuous a~hd over-burdened life demands. I prefer the practice in use in a few insti-tutes of a day of recollection, really a day of retreat, conducted by a priest on the last day of the year. Plus X (~ur article, "The Pontificate ot~ Pius X," is reprinted with per-mission from The Clergv Monthlv (August, 1951), a periodical edited by the 3esuit Fathers at St. Mary's Theological College, Kurseong, India, and published by the Catholic Press, Ranchi, B.N.Ry, India. The summary of dates following the article is also taken from The Cterg~l Montfilv. The author of the article, the Most Reverend 3. P. Leonard, S.,I., is now the Archbishop of Madurai. The article is reprinted with only a few very slight changes. It seems certain as we go to press that the Pope will proceed with the canonization of Blessed Pius X on ,May 29. Archbishop Leonard's article will make very appropriate reading for the occa-sion; and one more change--in a sense, not slight--will be in order: "'Saint Pius, pr,ay for us. Amen." Adaptation and'Prayer Some years ago (March, 1949) we published an article by Father d. Creusen, S.d., on "Adaptation." The article was pub-lished before the Congress on the States of Perfection iva~ held in Rome (September, 1950), but the general lines of the article were in perfect accord with the proceedings and conclusions of the Con- ~ress. We now have another excellent article on adaptation, based 137 NEWS AND VIEWS Review [or Religious on the proceedings of the Congress, that will be published in "our July number. , In our present number, Father Joseph Gallen, S.J., considers an aspect of adaptation that many religious will consider "touchy." Nevertheless, if prayer is to be what it should be in the li.ves of re-ligious, serious consideration must be given to the points raised by Father Gallen, especially to all customs that concern the saying of vocal prayers in dommon and to the multiplication of such prayers. As Father Gallen says, not everyone will agree with him on all his suggestions; but it seems to us that every thoughtful reader-- whether agreeing with him or not--must realize that he himself has given much thought to the problems. We would welcome frank discussions of the questions he raises and of the solutions he offers. Silver Jubilee Father Creusen's article on adaptation, referred to above, ap-peared originally in Revue des communautds religleuses, XVIII, 97. With Father 1~. Jombart, S.J., Father Creusen began the Revue des co~rnunautds religieuses in 1925. Publication was interrupted during most of World War II; hence Volume 25 was not completed till the end of 1953. On the occasion of this silver jubilee of publication, Father Creusen received a congratulatory letter from Monsignor Montini, the Pro-Secretary of State, who wrote in the name of the Holy Father. The Revue was praised for the high quality of its articles, for the utility of the articles and documents it publishes, and in general for its beneficial influence on religious and clergy. The Holy See's praise of the Revue has a special meaning for us because we are trying to do in the United States what Father Creusen and his associates have done and are doing among French-speaking religious. Eagerly we add our own small praise to the congratulations of the Holy See. Congress in Canada By decree of the Sacred Congregation of Religious there will be a national congress of all the religious institutes of Canada, in Montreal, July 26-30. Tile Congress will be similar to that held at the University of Notre Dame in 1952. Rev. Joseph Rous-seau, O.M.I., Procurator General of the Oblates of Mary Immacu-late and Consultor to the Sacred Congregation of Religious, has been appointed General Secretary of the Congress and of its Execu-tive Council. Associate Secretaries are Rev. Andf~ Guay, O.M.I., 1138 , Mag, 1954 NEWS AND VIEWS Director of the Catholic Centre of the University of Ottawa, and Rev. Edward Sheridan, S.2., Prefect of Studies of the Jesuit Semi-nary in Toronto. In reality, four distinct congresses will be held: of French-speaking religious men, of French-speaking religious women, of English-speaking religious men, and of English-speaking religious women. Only the inaugural and concluding sessions will bring the four groups together. The Congress will be held at the Holy Cross College of S. Laurent and the adjoining women's colle, ge of Ste. Croix, in a northern suburb of Montreal. The spacious facilities of these two adjoining institutions, with their many classrooms and lecture halls and fine collegiate church, ~iIl provide ample accommodation for the sectional session halls, committee rooms, etc. The COngress will meet for four full days. On each of the four days, four short papers, each of some twenty minutes length, will be read in each section. The delegates willhave summaries of these papers by the opening of the Congress and a more complete and detailed development of each paper will appear in the Acta 8f the Congress. On the conclusion of the fourth paper, the section (of men or women, English-speaking or French-speaking) will break up into small committees to discuss the paper in greater detail and in its practical applications, according to prepared questionnaires and discussion topics which will be different for different committees. In the afternoon, the section will reunite for a general disc~ussion and for reports of each committee. A survey of the.findings, prob-lems, and solutions resulting from these committee sessions will be presented and will appear in the Acta. The sectional afternoon ses-sions will close with the formulation of resolutions, recommenda-tions, and petitions. A pilgrimage of all four sections to Montreal's famous St. Jo-seph's Shrine on Mount Royal, is planned for the evening of the last day of the Congress. Certain members of each institute will attend the Congress ex officio, namely, major superiors, masters and mistresses of novices, superiors of scholasticates. Others will attend as the appointed delegates of their institutes, in numbers proportionate to the num-bers of the institutes represented. It is expected that the Congress will unite a total of some fourteen hundred religious--eight hun- 139 NEWS AND VIEWS Review t~or Religious dred sisters and six huiadred priests and brothers--from all the in-stitutes of Canada. The program of papers, which is substantially the same for all sections, is: First day: (1) Tending to Perfection in Charity; (2) Religious Obedience; (3) Religious Poverty; (4) Perfect Chas-tity. Second Day: (1) Liturgical Prayer; (2) Prayer; (3) The Sacrament of Penance; (4). Religious Observance. Third day: (1) Judging a Vocation; (2) Methods of Recruiting; (3) The Personnel Required for Forming Religious; (4) Elements in the Formation of Young Religious. Fourth day: (1) Perfection in Charity and the Apostolate; (2) The Sanctifying Value~ of the Various Works of the Apostolate; (3) Diversity of the Apostolate and the Need for Collaboration; (4) Problems of the Apost61ate. Summer Sessions?. Marquette University will offer a course restricted to sisters on Marriage Guidance for Teachers. Among (;ther things, the course is designed to prepare the sisters (i) to present the matter of marriage in such a way as to enable the students to make a rational choice of vocation in life, and (2) to convey an attitude toward sex and mar-riage which will be a stabilizing factor in and out of marriage. Fa-ther Richard Arnold, S.J., will conducl~ the course. Marquette will also continue the courses in theology on the graduate level, de-signed especially for religious brothers and sisters. This graduate program leads to a degree of Master of Arts, with a major in the-ology. For further information write to:' The Director, Summer Session, Marquette University, Milwaukee 3, Wisconsin. Between June 14 and August '3 each Sunday afternoon a con-ference will be given by members of the Creighton University Sum-mer S,chool Staff on the religious virtues. Sister Mary Digna, O.S.B., w'ill conduct a week-end institute on the scientific factor in selecting candidates for religious life. Dr. Leo Kennedy will conduct an in-stitute on guidance and vocational counseling. Sister M. Casimir, O.P., is arranging an institute on music for the schools. Dr. Robert Nossen is director of the institute on the teaching of high school English. Sister M. Muriel, S.H.M., will teach courses in remedial reading and will likewise direct an institute in. that field. Another workshoi9 wll be "conducted in story-telling, book selection, and extra-curricular reading for elementary school children. Nine gradu-ate or under-graduate credits may be earned during the eight-week session. Rev. Francis Korth, S.J., will have a 3-hour course on 140 Mag, 1954 NEWS AND VIEWS moral guidance, and Rev. Leo Cbressel, S.d., will continue his theo-logical cycle course with "special questions in dogmatic theology." Rev. Vincent L. Decker, S.d., will teach fundamental theology, and Rev. Philip Derrig, S.J., will teach Christian iworship. Please direct inquirie~ and requests for Summer School catalogues to: Dean Wil-liam F. Kelley, S.3., Director of the Summer Session, Creighton Universit~r, Omaha 2, Nebraska. The-Rev. duniper Carol, O.F.M., formerpresident of the Ma-riological Society of America and now its secret~iry, will offer a series of lectures in Mari01ogy at St. Bonaventure University, Olean, N. Y., tl~is summer. The course will begin duly 3 and con-tinue through the first week in August. Father Carol is a well-l~ nown Franciscan theologian of Our Blessed Lady in the United States. He has written many amcles and books on Marian docmne, especially the doctrine of Our Lady as Co-Redemptrix. Other courses this summer include dogma, moral, church history, canon law for religious, and catechetics. The course at St. Bonaventure leads to a Master's degree or a certificate in theology. Ins÷itu~e of Spldtuali~y 849 sisters, representing 159 religious communities, attended .the Institute of Spirituality at the University of Notre Dame last summer. This institute, which is for superiors and mistresses of novices, will be given at Notre Dame again this summer, August 4-10. , The morning-lectures Will be given b.y the Reverend Paul Philippe, O.P.; the Reverend Gerald Kelly, S.J.; and the R~verend Charles Corcoran, C.S.C. Father Philippe's lectures are entitled, "The Role of the Holy Spirit in Counseling'i'; Fa,ther Kelly's, "Psychologichl Problems in Religious Life"; and Father Corcoran's, "The Vow of Obedience," The evening lectures will be given by the Reverend A.PI~,O.P.; the Reverend Albert J. Riesner, C.SS.R.; and the Reverend Gabriel Diefenbach, O.F.M.Cap. Father Pl~'s lectures are entitled, "The Adaptation of the Religious Life to Actual Conditions"; Father Riesner's, "Canon Law for Religious--The Vow of Poverty"; and Father Diefenbach's, "The Life of Prayer." ~ "This important institute is'one of the tangible effects of the Congress of Religious, held at Notre Dame in 1951. For further information write to: The Reverend A. Leonard Collins, C.S.C., Department of Religion, University of Notre Dame, Notre Dame, Indiana. 141 N :ure Joseph P. Fisher, S.J. IHAVE OFTEN wondered just how satisfactory an understand-ing of the relation between nature and grace most religious-- especially those untrained in theology~have. They certainly .have been impressed by the role of grace in the economy of salva-tion. In their reading and meditating they must often have con-sidered those clear words of Christ, "Without Me you can do nothing." They know that grace "is absolutely necessary for sal-vation, necessary for any advance in the spiritual life, necessary even for a start in it. Grace stands, therefore, before their eyes as all-important and so it should. Their knowledge of grace as far as it goes is, accordingly, quite accurate. But I wonder about their understanding of nature. While they have been reading and meditating on the marvels of divine grace, they have also, quite likely, been forming some notions about na-ture. And, of course, nature regarded as a competitor or adversary of grace is put in its place--and a very low and despicable place it is. Without distinctions being made, or at least clearly made, nature-- often used in ~i rather vague sense--is made to look very bad. 'Very many books on the spiritual life have remarks about nature that can well be typified by this statement in the Follgtoing of Christ: "'Wherefore, as nature is the more kept down and subdued, with so much greater abundance is grac.e infused" (Bk. III, Ch. 54). It is true that fi Kempis himself has the correct distinction in mind (the whole of Ch. 54 implies the distinction and there is an explicit statement in Cb. 55) but the force of an unmodified word has strange power. It is all very simple if we understand all the oppro-brium heaped on nature as being piled on corrupt, unregenerated na-ture, inasmuch as it is the source of the inordinate in human life. St. Paul says some hard things about nature, but anyone who wants to understand the sense in which he uses the word can check his meaning as set forth in Fernand Prat, The Theologg of St. Paul, Vol. II, pp. 61-62. It comes to this, that because of original sin there is left in all men a strong inc\ lination to e~;il. Understood, therefore, as the source of sin, nature can be despised and set at naught as much as one likes, but there is mucl~ good in nature which must be respected. 142 Ma~t, 1954 NATURE AND GRACE It may come as a surprise to some that it is a defined truth that by the light of the natural intellect man can know considerable truth about God and, it follows, much truth about many things: "If anyone shall say that the one true God, our Creator and Lord, cannot be certainly known by the natural light of human reason ~hrough created things, let him be anathema" (Vatican Council, Sess. III, de revel., can. 1). And it is certain that by the strerigtb of the natural will man can do considerable .good--not, however, salutary as far as supernatural salvation is concerned. It is no doubt because of these truths that the Baltimore Catechism has introduced the following change into the new edition: "The chief punishments of Adam which we inherit through original sin are: death, suffering, ignorance, and a strong inclination to sin." And the explanation of the last item runs thus: "Although we have a strong inclination to evil as a result of original sin, our nature is not evil in itself: it can perform some good actions in the natural order without the aid of grace." The old catechism had this: "Our nature was corrupted by" the sin of our first parents, which darkened our understanding, weakened our will, and left in us a strong inclination to evil." All this brings out the point that when one says "nature is bad, is to be repressed," one has to know what one means by "nature." God has never disowned, rejected the good in human nature as the Protestants would have it that He did. What, then, does it mean, "Without me you can do nothing"? It means we can do nothing of use to salvation without grace. That, of course, says a lot but it would be worse than a mistake to under-stand it in such a way as to deny the truths stated above. Actions speak louder than words. A~cordingly the example of the saints acts strongly to form a man's spiritual outlook. In the matter with which we are dealing, lives of the saints have had their effects. Many a person untrained in theology has come to the con-viction that the lives of many saints are a living proof of the state-ment that "as nature is the more kept down and subdued, with so much greater abundance is grace infused." And it is true that the saints have often, at least according to the accounts of their lives, disdained nature and its needs and, apparently, were the better for it. Many ate extremely little, slept hardly at all, undertook severe austerities, and yet carried on their work in a remarkable way. It is. certain that if an ordinary individual would do what the saints have d6ne in despite of nature in the ordinary providence of God he would pay the price. There is, therefore, a distinction that must be 143 JOSEPH P. FISHER Reuieu.~ for Religious brought in here. Ordinarily God does' not work miracles to make up for the rashness and mistakes of men. True it is that in His ex-. traordinary providence God takes care of His holy ones, and that is one reason why we say God is wonderful in His saints. A clear example of What could happen, and has happened, if the idea expressed above (that the more nature--even that which is good in nature--is contradicted and thwarted the higher grace rises) would be carried to its logical conclusion is this: the absolute cessation of all spiritual progress--at least for the time-~by insan-ity. That is a terrible thing to think of, but it is true. Whatever one thinks about the relationship of nature and grace, one cannot get around this hard fact: not a few human beings have come to the end of their growth in grace because the natural faculties of mind and will have ceased their natural functions and hence grace--which do~s no"t operate in a void '" is at a standstill. There are, of course, less extreme results brought about by a neglect of nature and We shall instance some of these later. For the time being it is enougl~ to make clear that God does not always--to say the least--work a miracle to stop or rectify the results of a man's imprudence in handling nature. God can if He so chooses suspend the effects of nature's physidal laws, but we do not ordinarily count on that. So far we have been rather negative in what we have said. What can be said positively of nature's position in regard to grace? At the outset it has to be remarked that anyone treating of the relation-ship between' nature and grace has to be careful not to fall into the errors of Pelagianism or semi-Pelagianism. In order to make clear, ,before we proceed further, the teaching of the Church i~n the mat-ter we shall summarize what has to be said. First of all, mere nature, that is, nature without the aid of grace, cannot, in strict justice, merit initial grace (.the first grace a man re] ceives on the way to sanctifying grace) nor, consequently, any of the series of subsequent graces that lead to sanctifying" grace. More-over, there is no naturally good work' by which unaided nature could acquire even so much as an equitable claim --- one not "in strict justice but as a matter of fitness or equity--to supernatural grace. Nor can nature merit supernatural grace even by natural prayer, that is, merely human prayer without the aid of God's grace. And beyond all this a man cannot move God to the bestowal of super-natural grace by any positive disposition or preparation on his part. A man, for example, might prepare wet wood for burning by soaking' it in kerosene, but there is no such positive preparation by 144 May, 1954 NATURE AND GRACE which a man can prepare nature and make a claim on God for grace. Finally, the only thing a man can do to dispose nature for grace is to prepare himself negatively by not putting any obstacles' in the way or by removing obstacles that are present. ' In the example of the wood used above it would be similar to drying the wood and hence removing the wetness that would prevent the wood from burning. It is to be noted in t~is last case that by this negative disposi-tion a man does not cause--in the strict sense--God to give him grace, but if God so wishes He freely gives it. The freedom of God in giving grace must be preserved. By reason of this freedom in the disposal of grace God can choose and often has chosen the ignorant to confound the wise and the weak to shame the strong. The power of His grace stands out the more in such instances. And yet in His ordinary providence He seems to respect nature; not that He has to, but it seems from the facts that He does. God has never rejected the good in nature. " For this reason theologians have always taught that grace does not destroy nature but builds on it, elevates it. God loves His creation and even after man sinned there was still much in the work of His hands that He loved. It is time, then, to consider some of the ways in which grace builds on nature. In the first place, does it make any difference in the spiritual life what kind of mind a man has and how he uses it? It definitely does. God can make the very stones cry out or can speak-through a jackass--as He once dld-~but ordinarily He uses instruments according to their natural capacity. Wrong thinking in the spiritual life, wrong direction, has led to harmful consequences. Hence the importance of having accurate knowledge on spiritual matters. In the second place, does strength of will make any difference in the spiritual life? Does it help to know the true psychology of the will.; how~ to bring it to action? Admittedly God could take a weak-willed man and by His grace suddenly make him strong. But again God ordinarily works according to a man's nature. Poor use of will has held back many in spiritual progress. It is imperative, then, that those ,striving for spiritual advancement know at least the chief elements in the psychology 9f the will. And, thirdly, does the spiritual life depend in any way on a person's physical health, health of organs and nerve~s? Again God could set physical health aside as He has done in the case. of many saints. But saints are saints, and while we may admire them we cannot and ought not imitate their extraordinary conduct unless 145 JOSEPH P. FISHER Reoieto [or Religious God clearly calls us that way. The health of ordinary,mortals often has more to do with what goes,in their spiritual lives than they think it has. Everybody knows how St. Theresa and St. Ig-natius insisted on this fact. There is a story which may serve to il-lustrate this truth rather vividly. It was published some year~ ago in the Reader's Digest and goes something like this. A certain man of considerable means had suffered huge losses in the great de-pression of 1929. Worry over his critical financial condition, over what the future might bring, and over 'what people might think, naturally reacted on his health. He became more and more sleep-less, lost his appetite, grew more and more nervous, and felt as if a complete physical collapse was imminent. In this crisis he thought of what many others had thought of as a way 6ut--suicide. But for the sake of his family and his own good name he did not want to make a crude job of it; go he decided to consult a psychiatrist on the best way to achieve his purpose with the least notice and oppr6- brium. When he gave his stor~ to the psychiatrist, the wise man sympa-thized with him, thought the matter over, and suggested this method of carrying out his intention. The patient was over middle age, fat, in poor condition, and no doubt not very far from a heart attack. So all he would have to do would be to eat a good supper, then go for a little walk, after a while start running, and then be-cause of his poor condition his heart would give out and people would say that he had had a heart attack. This plan sounded very fine to the patient and he resolved to try it. So that night he did as the doctor had told him. But when he started running, nothing happened, and so he kept running and puffing. Growing tired, he stopped and after some time returned home tired and sleepy. He went to bed rather early and slept like a baby. When he got up in the morning he was a little stiff but felt rather well. But he was resolved to try a little harder that evening. And so he did. He walked farther and ran harder and puffed even more. Again nothing happened. So he returned home and slept even better and ate voraciously in the morning and felt dangerously well. But he was still resolved to carry out his purpose. So he repeated the per-formance the next night, exerting himself even more,' but again nothing happened. He went to bed and again slept marvelously well. He arose in the morning and ate heartily and had a strange sense of well-being. He felt he could meet and conquer all his prob-lems. He was even eager to get at them. 146 May, 1954 NATURE AND GRACE This story, aside from the fact that it concerns an attempted suicide and has the psychiatrist pretending to condone the attempt, allows for a wholesome application because it shows how ill health may create a spiritual problem and good health may solve it. Not infrequently religious are impeded in their spiritual lives by tired-ness, headaches, nerves, and such .complaints. No doubt like'all "creatures" of God these distresses can be used to help one in the spiritual life, but they must be handled by the great virtue of pru-dence. Our Lord told us to be as wise as serpents and as simple as doves. With the help of our spiritual guides, we must learn when such things advance us and when they impede us in the great work we are doing. And we must come to some decision as to how we are to conduct ourselves in their regard. Finally, there is the question of the natural virtues. It will be sufficient for our purpose to indicate in general their importance in regard to the accompanying virtues. Without the accompanying natural habit the infused, supernatural virtue is left, so to speak, in the air. The natural virtue gives the infused virtue facility and solidity. A person, for example, who has the infused virtue of for-titude m. ay in practice act very cowardly. It is only/ when he has acquired the habit of acting bravely that the supernatural virtue will function as it should. And so with all other virtues. That is why Father Hull in his little book, The Formation of Character, says that "all virtues, even the supernatural ones, are radically and .functionally natural ones . " It may be well to add that religious ought not to fear to develop and use to the utmost the natural talents God has given them. All too often the words of Our Lord apply to religious: "The children of this world are wiser in their generation than the children of light" (Lk. 16:8). Certainly the wicked make the utmost use of the gifts they have to further their evil ends. Shall those who pro-fess to fight God's cause allow to lie dormant the precious powers .God has entrusted to them? Every religious should occasionally meditate on Our Lord's parable of the talents. If we have been ¯ given even only one, we are expected to wbrk with it and show proper increase. A good way of acting would be that suggested in the saying attributed to St. Ignatius: Work as, if all depends on you; pray as if all depends on God. The use of nature to the advantage of the supernatural in the various ways suggested above should not surprise us who realize that ,our God has lifted even matter to be an ally of grace. In our sac- 147 JOSEPH P. FISHER ramental' system, Water, bread and wine, and oil are wondrously dignified by the part they play in the bestowal of grace on men. And even apart from the sacraments it is rather amazing how the Creator has mysteriously decreed not only that "for the most part men be saved by men" but that often even material things have an important part in a man's salvation or damnation. The speed of a car, the presence of blood plasma, the right drug. at hand may give the time. required to baptize or absolve a soul in need. Even if it is not explicitly said, it is sometimes implied, that any kind of trust in nature will lead to an.attitude of self-sufficiency and pride. There. is no good reason why this should be so. Is 'not ,God the Creator of nature as well as the Author of grace? Are not His natural gifts gifts? Can we not say in regard to the goods of nature which God has bestowed on us what the Blessed Virgin said in the Magnificat: "He who is mighty has done great things for me and holy is his name." Surely a man must crush the inordinate in nature but he should be careful lest in doing so he also spoil what is good.- Since God took upon Himself our nature there has been a truly wonderful union between nature and grace. And God wishes us to respect and cherish this union. May we not elevate the thought of the poet Coleridge and apply his words to our matter: He pra~etb best, tvbo lovetb best All the'rigs both great and small; For the dear God who lovetb us, He made and lovetb all. (Rime of the Ancient Mariner 11. 614-617)., NEW RI:VIEW OF SPIRITUALITY Cbristus is tb~ title of a new review of spirituality directed by the French Fa-thers of the Society of Jisus. The first number is entirely devoted to "Christ Our Lord"--with a number of articles that are ~emarkable for'their doctrine, historical information, and modernity. The purpose of the review is not to promote the spirituality of a "school," but rather to perform a service for consecrated souls, re-gardless of the spiritual family to which they belong, by opening up a source of spirituality which our present Holy Father called one of the most efficacious for the spiritual regeneration of the world. The price of this new quarterly is 700 ft. per year in France; 900 ft. for foreign subscribers. Address: Christus, 15, rue Monsieur, Paris (7e)~ France. 148 New I:::dit:ion of :he Li :t:le Ot:t:ice Adam C. Ellis, S.J. THE Little Office of the Blessed Virgin Mary was long a favorite devotion of pious layfolk, especially in England, where there were two versions of "Mary's Hours" current as far back as the eleventh century. Today many of the laity use the Little Office as their daily prayer in honor of Mary. It is part of the rule for Dominican, Carmelite, and Augustinian Tertiaries, and Franciscan Tertiaries are exhorted, though not obliged, to say it. Many mem-ber~ of the various Sodalities of Our Lady recite the Little Office daily as a matter of devotion. This office is called "Little" to distinguish it from the "Great" or Divine Office, which is recited daily by all clerics in major orders, by many religious orders of men, and by most communities of cloistered nuns. Many religious conoregations of sisters and broth-ers established during the nineteenth century and later have adopted the Little Office as their special" form of common prayer and recite it daily in whole or in part (for instance, Vespers and Compline), .or at least on Sundays and holydays. Some who are prevented by the nature of their work from assembling together at a fixed time recite the Little Office privately. A" feature article in L'Osseroatore Romano for March 17 an-nounced the publication of a new edition in Latin and German of the Little Office of the Blessed Virgin Mary. Fortunately, we have at hand a copy "of this new version; and it seems to us that our readers might welcome some information about it. Papal Approval of New Texf The text of the new edition of the Little Office announced in L'Osseruatore Romano was prepared by Father Augustine Bea, S.J., professor at the Pontifical Biblical Institute (of which he was rector for many years) and a Consultor of the Sacred Congregation of Rites. The work was done at the request of the Teaching Sisters of the Holy Cross, a congregation of Franciscan Sisters whose mother house is,located, at Menzingen, Switzerland. It was to the mother general of these Sisters that Pope Plus XII wrote the following let-ter, which approves the new Little Office and which is printed as an introduction to the text: 149 ADAM C. ELLIS To Our beloved daughter in Christ, greetings and Apostolic Bene-diction. ,The fervent devotion of the faithful to Mary, the Most Blessed Mother of God, besides many other exercises of piety, has also in-cluded for many centuries, that practice by which the same Mother of God is especially honored, namely the Little Office of the Blessed Virgin Mary. This pious practice has increased in recent times, since in man~ religious congregatons of brothers and sisters its daily recitation is already prescribed by the constitutions, a prescription which indeed is worthy of the highest, praise. And so it happens. that souls dedicated to God daily propose to themselves for imita-tion the glorious virtues of the same Blessed Virgin, especially her inviolable purity and unimpaired virginity; and by this pious dailg homage they secure for themselves more efficaciously Mary's moth-erIy care and most powerful protection. Furthermore, this same recitation of the Marian Office unites them closely with the liturgical life of the Church and with the Divine'Office of the priests. Especially now in our days this love of the sacred liturgy, re-markably increased through the inspiriztion of the Holy Spirit, has also aroused a stronger desire in not a feu~ of those who daily recite these Marian prayers that they be even more closet~t connected uJith the Church's solemnities and feasts than is possible with the form of the Little Office which has been found in the Roman Breviary since the time of Our Predecessor, St. Pius V. Therefore, with special pleasure, We have learned that while you and your sisters have faith-fully desired to preserve the old and praiseworthy custom of reciting the Little Office of the Blessed Virgin Mary, yet at the same time you cherish the pious wish to have a fuller participation in the liturgical life of the Church, and that you have therefore carefully seen to it that a somewhat expanded edition of the Little Office be prepared, which is adapted more closely to the times and feasts of the liturgical year. Since We have a certain hope that this your holy fidelity to the centuries-old tradition of religious congregations will bring about for you from day to day the greater favor and blessing of the Mother of God, and also that your love for the sacred liturgy will produce in you new and precious fruits of the spiritual life, We gladly permit you, and other congregations who may so desire, to use this new edition of the Little Office of Mary in your daily reci: tation. May the Apostolic Blessing which We impart to you gladly in 150 May, 1954 LITTLE OFFICE Our Lord, dear daughter, and to all the members of ~lour congrega-tion, be a tohen of Our paternal beneoolence. Giuen at Rome, at St. Peter's, March 12. 1953, in the fifteenth ~/ear of Our Pontificate. POPE PIUS XII Use of the New Text This approval of the Holy Father grants members of religious congregations of brothers and sisters who are now reciting the Little Office of the Blessed Virgin by reason of their constitutions or by custom the permission to substitute this new Latin text for the old text approved by Pope Saint Plus V for the entire Church and which is printed in the back of the Roman Breviary. The firm of Marietti, Via Legnano 23, Turin, Italy, issued the first printing of the new text in a combined Latin-German text in December, 1953, and has the sole right of publication. According to the article which appeared in L'Osseruatore, a Latin text by it-self was then in press, and should be available by now. Transla-tions into English, French, and Italian will follow shortly, from the same press. (The Newman Press, Westminster, Maryland, is the agent for Marietti in this country.) Use in the Vernacular The Holy Father approved both the Latin text and the accom-panying German text for the Sisters of the Holy Cross of Men-zingen. They evidently have been reciting the Little Office in Ger-man with special permission. May other religious congregations use any one of the translations to be issued by Marietti without further permission? Some distinctions must be made: (1) As was stated above, any religious congregation now reciting the Little Office in Latin, may at once make use of tl~e new Latin version without ~r-tber permission. (2) Any religious congregation now reciting the Little Office in the vernacular with proper permission, may at once make use of the new text in the vernacular as published by Mari-etti; any other translation of the new Latin text must have the ap-proval of their own local ordinary before it may be used. (3) Any religious congregation now reciting the Little Office in Latin by reason of a prescription of its constitutions, may not change from Latin to the vernacular without permission from the proper au-th6rity: (a) the local Ordinary in the case of a diocesan congrega-tion, since he has the power t~ change their constitutions; (b) tile 151 t ADAM C. ELLIS Sacred Congregation of Religious in the case of a pontifical congre-gation, since only the Holy See can change constitutionk approved by it. This permission should be bequested by a general chapter. " Special Features The new edition of the Little Of}ice of the Blessed Virgin has the following, characteristics: 1. For the Latin text of the psalms it follows theVatican Psalter, a new translation of the Book of Psalms prepared at the Biblical Institute, made prir~cipally from the Hebrew Masoretic text, and approved for optional use in his Motu Proprio In cotidianis precibus by Pope Plus XII, on March 21, 1945. For the German text the psalms are taken from Deutscber Psalter, edited by Romano Guardini, with the permission of the publishers, "K6sel-Verlag." 2. The text is arranged for and adapted to six exact liturgical seasons of the ecclesiastical year: Advent, ChriStmas, Lent, Passion-tide, Eastertide, and the time after Pentecost, with special lessons for each season. 3. The new text has the special antiphons (for the Magnificat and Berledictus) and the proper orations for the more prominent general feasts of the year: Circumcision, Epiphany, St. Joseph, As-cension, Pentecost, Corpus Christi, Sacred Heart, Sts. Peter and Paul, and All Saints; also for the Commemoration of All Souls; likewise for many particular feasts of Our Lady: Immaculate Con-ception; Purification, Annunci'ation, Visitation, Assumption,, Im-maculate Heart, Nativity of "Our Lady, Holy Name of Mary, Seven Sorrows (both feasts), Holy Rosary, Maternity, and Presentation. 4. During Advent the special "O" antiphons are used at Ves-pers on the eight days preceding the vigil of Christmas. For the last three days of Holy Week the Office is conformed to the rubrics, and the Christus factus est :is added to each hour. Conclusion ~ Religious communities of sisters and brothers ~vho have been reciting the Little Office of the Blessed Virgin Mar~ in common by direction of their constitt(tions or by custom will welcome this new edition of the text, brought up to date to conform wih the spirit of the modern litu[gical movement, and approved for them by ,Our , Holy Father. 152 /V ore abou!: Secular Ins!:i!:ut:es Francis N. Korth, S.J. DIRECTORS of souls and others who come in contact with possible vocations will be interested in some information about secular institutes that are actually existing in the United States and Canada and about other groups that have hopes of be-coming secular institutes at some later date if everything works out all right. It happens at times that a religious is approached by a boy or girl who seems to have a clear call to a special practic~ of the evangelical counsels while remaining in the world; it seems to be a vocation to the life led by ~embers of secular institutes. Unfortu-nately little information of practical use has been published for helping such prospective vocations make the necessary contact with individuals who would be in a bett~r position to advise them. The present article is intended to obviate this difficulty to some extent. To this end some items about a number of groups that either are secular institutes or are on the way to possibly developing into secu-lar institutes will be given. It is understandable that in such a highly specialized vocation great care must be taken in admitting candidates; a certain amount ot~ lack of publicity could be a safe-guard. On the other hand, it also seems desirable to have some in-formation about existing groups made available among those who could be of help to candidates having a true vocation to that'type of life. Existing Secular Institutes" Among the few secular institutes existing in the United States ¯ (as far as is known), the first to be mentioned is the pioneer in this country, the Opus Dei. Opus Dei (whose full title is: Sacerdotal Society of the Holy Cross and Opus Dei) was founded in Madrid, Spain, on October 2, 1928, by Monsignor Jos~ Maria Escrivfi 'de Balaguer. Its members make som~ studies in philosophy and, the-ology; some'later go on to the priesthood. A women's branch of Opus Dei (distinct from that of the men) was begun in 1930; this is a completely separate secular institute. For the most part the gov-ernment is in the hinds of the lay members; priest members act inca spiritual kapacity, though some high offices usually are held by priests. The purpose of Opus Dei is to enable its members, while 153 FRANCIS N. KORTH Review for Religious living in the world, to achieve personal p~rfection through the prac-tice of the evangelical counsels and to spread the life of Christian perfection among all classes, especially among those whose profes-sions or positions permit a great influence on society. Opus Dei was the first secular institute to obtain papal approval (decree of praise on February 24, 1947) and the first to receive definitive papal ap-proval (on June 16, 1950). Today Opus Dei has about two hundred houses in various parts of the world; it numbers members from more than thirty countries. In the United States a house of the men's branch has been in exist-ence in Chicago for a number of years (address: 5544 Woodlawn Ave., Chicago 37, Illinois); during the past two years a house of the women's branch has also been set up there (address: 4944 Woodlawn Ave., Chicago 37, Illinois). Since November, 1953, a house of the men's branch has been located at Boston (address: 22 Marlborough St., Boston, Mass~achusetts). At present in the United States there is no diocesan priests' branch. It is of special interest to note that initial steps, in God's providence possibly leading to the honors of the altar, have been taken regarding one of the former members of Opus Dei, Isidoro Zorzano by name, a man in an ordinary profession in the world (he was a railroad construc-tion engineer). His story is told by Daniel Sargent in God's En-gineer. Besides Opus Dei a second secular institute has been given the definitive approval by the Holy See (August 3, 1953) ; it is the in-stitute known as the Missionaries of the Kingship of Christ. This group ~was started at Assisi, Italy, on November 19, 1919, by Father Agostino Gemelli, O.F.M. It is an association of women, with the purpose of dedication to Christian perfection through the observance of the evangelical counsels and of dedication to the lay apostolate of spreading the Kingdom of Christ according to the spirit of St. Francis of Assisi. All members of this secular institute are also members of the Third Order of St, Francis. There is an active section and an oblate section. While no particular aposto-late is undertaken, the members place themselves at the disposal of the Church; members of the active section serve where superiors want to use them. The activities are varied: helping the poor and the sick, operating protective organizations, taking special interest in fostering the liturgical apostolate, encouraging adoration of the Blessed Sacrament in churches, and other works. Candidates might 154 May, 1954 SECULAR INSTITUTES qualify if they, are convinced that they wish to live for Christ, are available for an active apostolate, and are engaged in work that as-sures independence. Applicants should be between the ages of twenty-one and thirty-five, should be in good health, and should realize the need of daily Mass, Holy Communion,and meditation. This institute has three branches: one for men, a second for women (separately organized but .with the same constitutions the men's branch has), and a third for diocesan priests in as far as compatible with their loyalty to their bishop. Lay members may live in their own homes or anywhere they choose. The government, except for the priests' branch, is in the hands of lay persons. An American foundation of this institute exists in Washington, D.C. (Address communications to: Rev. Stephen J. Hartdegen, O.F.M., Holy Name College, 14th and Shepherd Streets, N.E., Washington 17, D.C.) The institute has spread extensively in the country of its origin, besides branching out into four or five other countries; its total membership is probably about four thousand. In 1926 at Schoenstatt, Germany, under the guidance of Father Joseph Kentenich, S.A.C., the Schoenstatt Sisters of Mary of the Catholic Apostolate had their origin. (The word "sisters" is a German title used by all engaged in social work and does not here mean religious sisters in the canonical sense.) The members of this group dedicate themselves fully to a practice of evangelical perfec-tion and the apostolate through a specifically Marian and apostolic formation of modern women in order to aid the spiritual renewal of the world in Christ through Mary. This secular institute for wom-en is part of the general Schoenstatt Apostolic Movement with its various circles and groups, in accordance with the central idea of a universal apostolate--all fields of activity, all persons, everywhere. Some of the varied activities performed by this group include teach-ing, conducting hospitals, acting as home visitors, helping in par-ishes as teachers of children and converts, acting as social workers. The institute nt~mbers close to two thousand today and is spread over five continents. Contact with this group can be made at the following address in this country: New Schoenstatt, R.R. 5, Madi-son 4, Wisconsin. On June 30, 1950, the decree of praise was bestowed by the Holy See on a secular institute known as the Company of St. Paul. Growing out of a Catholic Action activity, this group was started by Cardinal Ferrari at Milan, Italy, on November 17, 1920, as a religious community with a common rule of life. It received the 155 FRANCIS N. KORTH Reuieu~ for Religious name of Companyof~ St. Paul in 1924. A decree of recognition and approval of its rule was received from the Holy See on July 1, 1942. In 1949 the Company of St. Paul was_ included under the new rulings of the Piooida Mater Ecclesia. Besides the pursuit of perfection through the practice of the .evangelical counsels, the pur-pose of this institute is to promote a more efficacious collaboration of clergy and laity in the establishment of the reign of Christ in modern society, both in individuals and in social institutions. Each of the three sections (for.priests, for laymen, and for laywomen) has its own superior, but all are united under one general head cho-sen from the section for priests. Some work is being done in this country by this institute, although no foundation ~xists as yet. (A contact address could be furnished on request.) Another group which has no foundation at present in America, but which has some solid hope of realizing such a foundation in due time (initial steps have been taken), is the Institute of Ou.r Lady of Life. Following the Discalced Carmelite spirituality, this secular institute was started by Father Marie-Eugene, O.C.D., in 1932 near Venasque, France. The element of dedication to the con-templative life in the world, of the silent apostolate of edification, of being witnesses to Christ either through individual activity or through works proper to the institute is the characteristic note of this organization. Any appropriate kind of work is permitted to the members; some are engaged in teaching, others in social work or various walks of public life. This institute received diocesan ap-proval in France several years ago., " The foregoing are the secular institutes known to have founda-tions or at least representatives in this country. Groups in Process of Deuetopment Besides established secular institutes, a number, of other groups in this country and in Canada are in the process of possibly devel-oping into future secular institutes. An organization which has obtained approval (as a "pious union") in two dioceses in France and in one in Canada is caIled the Daughters of St. Catherine of Siena. This group was founded in France in 1947~ by Father Thomas Deman, O.P. The Dominican spirituality is followed. Formation of the members takes place in convents of the Dominican Sisters of the Congregation of St. Cath-erine of Siena. At present all American members are affiliated with the Canadian foundation; a house in the United States is desired. 156 Ma~t, 1054 SECULAR INSTITUTES Canada has a very flourishing association of this kind which is in the process of possible development into a secular institute. Its purpose is dedication to evangelical perfection and tb an apostolate in the world according to the principle, "Caritas Christi per Mari-am" (the Charity of Christ through Mary). The apostolate is being carried on in Canada; foreign mission work is a possibility. This associaton has over twenty-two groups with about two hun-dred members, many of whom practice a profession. .Members are trained to live alone; personal responsibility is cultivated. The growth of this group has been phenomenal. A number of smaller groups are in lesser stages of development in this country. One such group is at present engaged in the home care and guidance of teen-age boys, and envisions eventual apostolic work in career-counseling, information services, engaging in Church public relations, personnel service in staffing Catholic organizations, and obtaining positions in other institutions. Another group, based upon the Benedictine way of life, is dedi-cated to the rural lay apostolate of helping pastors in their work for souls in needy rural areas. A third group has adopted St. Francis de Sales as its patron in its general apostolate of helping the pastor of a parish; under his direction such help might take the shape of visiting families in the p.arish, talking with persons about going to the sacraments and having their babies baptized, the promotion of retreats and da.y,s of recollection and the like. Still another group is dedicated to an apostolate of service in discovering and developing a Christian culture primarily through work in the poorest and most needy parishes; a member might fill in temporarily for a teacher who is sick or might help to clean the church or do other tasks. In such groups provision is made of course for fostering the spiritual life of the members. In at ,least several of them the breviary is recited in English. Since members usually support themselves in their regular professions or positions or jobs, they are accustomed to work. In one group eight hours of work per day is expected of each regular member. To help meet the financial problem in another of these organizations, the smaller groupings will have three or four members, with one earning the income for the group and the others devoting their full time to the works of the institute without re-muneration. All of these groups are still in the formative stage; as such they also usually are small in number for the time being. When further development is realized, expansion would be desirable. Besides these developing groups, there are several other, tentative 157 FRANCIS N. KORTH Reoiew for Religious groups in the early stages of thought, Possibly there are many more. If anyone in a responsible position cares to send in more information for publication about one of the groups already mentioned, or about others, such information would receive due consideration for pos-sible publication in this REVIEW. A goodly number of priests are quite interested in these new institutes because of the possibilities of their apostolate. Some priests are helping groups to develop; others direct or prepare possible candidates for some such group. One priest, for exampIe, becomes weIl acquainted with young people in the retreats he conducts; then, having knowledge of exist!ng secular institutes or associations in the stage of development, he is in a posi-tion to aid likely candidates and channel them to one of the groups existing in various parts of America. The Nagoya Group After, considering the various known secular institutes and the developing groups in our own country and in Canada, our readers might be interested in knowing something about a secular institute which has been established in Nagoya, Japan. This move is con-sidered of historical impc~rtance, according to one newspaper ac-count, because "it represents something entirely new in the history of mission countries." .The problem of catechists and lay apostles in Japan had become vital owing to the increasing number of catechumens. At the same time a large number of young women were yearni~ng to consecrate themselves entirely to a life of perfection and of the apostolate. As a result various bands of catechists worked in" different ~places. Four years ago, undef the inspiration and guiding hand of a missionary, Father'George Gemeinder, S.V.D., women catechists were grouped together for the purpose of forming a future secular institute. On January 28 of this year (1954), the Secular Insntute of the Cate-chists of Our Lady, Virgin and Mother, received the nihil obstat from Rome in regard to its constitutions; the institute was then established by the Prefect Apostolic of Nagoya, Monsignor Peter Matsuoka, on February 11, 1954. The first year of novitiate was scheduled to open on the Feast of the Annunciation, March 25, 1954. One of the women members has been made "Inchosama," which is a general term for "head of the house" or superior. Father Gemeinder acts as director; Father Anthony Zimmerman, S.V.D., is wce-dlrector. The purpose of this institute is to help the needs of the missions. 158 May, 1954 SECULAR INSTITUTES Among the varied forms of the apostolate in which members might be ~ngaged would be included the following: acting as full-time catechists at various mission stations; assisting existing organizations in the locality: acting as .teachers, hospital workers, and the like; being employed in a professional field. Candidates should have the necessary physical, mental, and so-cial qualities for carrying on the.work of the institute. After a pos-. tulancy and novitiate, during which a solid'training in spiritual mat-ters is given to help them lay a firm foundation for a life of personal perfection and for a fruitful apostolate, the members take the vows of poverty, chastity,, and obedience proper to their institute and,a promise under oath to devote themselves to the apostolate. In car-rying on their apostolic work, members might live individually or at times in community. This gives some idea of the new secular institute at Nagoya. As its name implies, stress is placed upon catechetical training and work --an all-important apostolate in a country in which so many souls have not yet heard the message Christ came to preach. Conclusion As a conclusion to these statistics on secular institutes, it might be interesting to mention the secular institutes which are listed in the Annuario Ponti[icio for 1953 as being institutes of pontifical right. On pages 832-833 four secular institutes for men are thus listed. They are the Company of St. Paul (originated in Italy), Opus Dei (originated in Spain), the Priest Workers of the Sacred Heart of Jesus (Spain), and the Society of the Heart of Jesus (France). For women fi've such institutes are given on page. 1233: the Daughters of the Queen of the Apostles (Trent), the Teresian Institute (Mad-rid), the Missionaries of the Kingship of Our Lord Jesus-Christ (Milan), the Institute of Our Lady of Work (Paris), and the Women's Section of Opus Dei (Madrid). PLENARY INDULGENCE FOR SEVEN SORROWS BEADS At the request of the Prior General of the Order of the Servants of Mary (Servites), His Holiness, Pope Plus XII. on December 19, 1953, kindly granted a plenary indulgence to be gained by the faithful who, after confession and Holy Communion, devoutly recite the beads of the Seven Sorrows of the Blessed Virgin Mary, before the Blessed Sacrament of tbe Altar, wbether publicly exposed or re-served in the tabernacle. (Acta Apostolicae Sedis, February 16, 1954, p. 73.) 159 NATURE AND GRACE. By Matthlas Joseph Scheeben. Translated by Cyril Vollert, S.J. Pp. xxlv ~ 361. B. Herder Book Co., St. Lou~s, 1954. $4.~s. With the Publication of this work in 1861 the author took his first step on the path which brought him to the forefront of the theologians of his day. In it be set out to treat the central theme of his thought--the super~natural and its place in the life of the Chris-tian. Around this thought his treatise is built and on it the em-phasis is constantly placed. This is not a textbook but a readable treatise which has been put into flowing English. Scheeben not only knew the great Scholastic writers but be was also well versed in the Fathers of the Church, both Western and Eastern. With such an equipment he manages to make clear many difficult concepts and doctrines. We are thus treated not merely to a fine doctrinal exposition but also to a stirring appeal to realize our destiny. Parts, if not all, of the book will serve well for spiritual read-ing. Thus, after a thorough explanation of man's spiritual nature, of sanctifying grace and the supernatural order, there follows'a care-ful explanation of the acts of the supernatural life, particularly faith, hope, and charity. The climax is an enthusiastic description of the union of nature and grace in the supernatural acts. --AUGUSTIN C. WAND, S.J. Books abou Mary A book of exceptional value is PAPAL PRONOUNCEMENTS ON MARY, compiled and arranged by the Right Rev. Msgr. William J. Doheny, C.S.C., and the Rev. Joseph P. Kelly. It contains transla-tions of the principal papal statements about Mary from Pius IX to Pius XII. Included are the texts of Ineffabilis Deus and Muni£- centissfmus Deus, defining the dogmas of the Immaculate Conception and the Assumption respectively, and the very beautiful encyclical of Plus X, Ad Diem Illum. This is the best kind of spiritual read-ing about the Mother of God. (Milwaukee, Wis.: The Bruce Pub-lishing Company, 1954. Pp. x -t- 270. $4.50.) 160 BOOK ANNOUNCEMENTS MEDITATIONS AND INSTRUCTIONS ON THE BLESSED VIRGIN, by the Rev. Arthur Vermeersch, S.J., is a reprint of a work pub-lished in the early part of the century and translated by W. Hum-phrey Page, K.S.G. The meditations and instructions are intended for the use of both clergy and laity. Volume I contains meditations for each of the feasts of Mary, a novena for the Feast of the Im-maculate Conception, a novena to obtain devotion to Mary, and meditations for the month of May. Volume II has a meditation for each Saturday of the year, as well as a supplement with meditations for various feasts. (Westminster, Md.: The Newman Press, 1954. Pp. I." xxiv + 438; II: xv + 468. $7.50 per "set.) The Rev. A. Biskupek, S.V.D., offers readings and reflections on OUR LADY'S LITANY. This is a good book for meditation during May, October, or any other time during the Marian Yea[. Helpful reflections are provided for each invocation of the Litany of Loreto. The author will be remembered for his three volumes of conferences on the rite of ordination. (Milwaukee, Wis.: The Bruce Publishing Company, 1954. Pp. vi + 166. $2.75.) MARY C~OD'S MASTERPIECE features sixty-two reproductions of paintings of Our Lady in full color, with appropriate texts from the Sacred Scriptures and the Liturgy~ The the Redemptorist Fathers as a Marian-Year Mother. It is a real work of art, an attractive Year. (New York, N.Y.: Perpetual Help $2.00.) The latest of his many writings about book was prepared by tribute to the Blessed souvenir of the Marian Press, 1954. Pp. the Blessed Mother is THE SONG OF THE ROSARY, by Daniel A. Lord, S.J. The book covers each of the fifteen mysteries of the Rosary in a style which the author himself explains in his own inimitable way: "I found that I could not possibly confine in simple prose the context of what I had to write or the emotions needed to accompany the writing. So I adopted a sort of natural rhythm that is not prose and yet not strictly analyzable poetry. Call it what you wis,h; I call it simply a rhythm." (St. Louis, Mo: The Queen's Work, 1953. Pp. 399. $4.00.) BOOK ANNOUNCEMENTS [For the most part, these notices are purely descriptive, based on a cursory exam-ination of the books listed.] AVE MARIA PRESS, Notre Dame, Indiana. Patch Scatters Culture. By Patrick J. Carroll, C.S.C. This is 161 I~OOK ANNOUNCEMENTS Review for Religious the fourth of Father Carroll's books about Patch. The first was published almost twenty-five years ago. It was, as one reviewer said of it, "one of the happiest, brightest, most vivacious stories of a boy's life that one could wish to read." Of the author, the same re-viewer said: "Father Carroll has the gift of spinning a story and filling it with humor and wisdom. His dialogue is even more sprightly than his narrative." The story-telling gift; and espe-cially the realistic, Irish-flavored dialogue are still ~manifest in this fourth volume which continues the reminiscences of Patch and con-cludes with an Epilogue about how Patch, now a priest, visited his homeland. "And so happy memories to you," the Epilogue con-cludes; and one who knows Father Carroll can even hear him say it. Pp. 223. $2.75. BEAUCHESNE, R

Issue 39.3 of the Review for Religious, May 1980. ; REVIEW FOR RELIGIOUS (ISSN 0034-639X), published bi-monthly (every two months), is edited in collaboration wilh faculty members of the Dbpartment of Theology of St. Louis University. The editorial offices are located at Room 428:3601 Lindell Blvd.: St. Louis, MO 63108. It is owned by the Missouri Province Educational Institute; St. Louis, MissQuri, © 1980. By REVIEW FOR REL~O~Ot~S. Composed. printed and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $2.00. Subscription'U.S.A.: $8.00 a year: $15.00 for two years. Other countries: $9.00 a year, $17.00 for two years. For subscription orders or change of address, write REVIEW FOR RF.L~CaOt~S: P.O. Box 6070: Duluth, Minnesota 55802. Daniel F. X. Meenan, S.J. Robert Williams, S.J. Dolores Greeley, R.S.M. Joseph F. Gallen, S.J. Jean Read Editor. Associate Editor Associate Editor Questions and A nswers Editor Assistant Editor May, 1980 Volume 39 Number 3 Correspondence with the editor and the associate editors, manuscripts and books for review should be sent to REVlF.W FOrt RELIGIOUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108. Questions for answering should be sent to Joseph F. Gallen, S.J.; Jesuit Community; St. Joseph's College; City Avenue at 54th Street; Philadelphia, Pennsylvania 19131. "Out of print" issues and articles not re-issued as reprints are available from University Microfilms International; 300 North Zeeb Road; Ann Arbor, Michigan 48106. A Check on Our Availability: The Examen George A. Aschenbrenner, S.J. Father Aschenbrenner is engaged in campus ministry, and at the same time, working nationally with priests and religious. He resides at Scranton University, Scranton, PA 18510. [n an earlier issue (January, 1972, "Consciousness Examen") I had written about a renewed understanding of the traditional lgnatian exercise of the daily examen. In that article I preferred to talk of an "examen of con-sciousness," because most of us had come to understand "conscience" in a narrowly moralistic sense. This had turned the examen into a fairly negative practice, soon discarded when we got into the typically busy apostolic life. To set aside specific time each day to see what we did wrong was not very much help. Nor did the practice enrich our apostolate much, because it gradually turned God into Someone always catching us .doing something wrong--and thus we wrought havoc on our self-esteem. A good sense of self-value, an ef-fective apostolate, and our image of God are always intimately connected. A Positive~ Understanding of the Examen .~: The formal examen should rather be a time of prayer about how much God has loved me in the yery existential details of my day, and how he could have loved me more in certain situations if my inner spiritual decisiveness and external presence had been a bit different. This is not just a different articula-tion of the meaning of the examen. Rather, it leads to an enormous difference attitudinally and effectively. A healthy self-esteem has to be ultimately and ir-revocably rooted in our Father's love, climaxed in his victory in Jesus. This neither excessively highlights, nor denies, my daily sinful weakness. Rather it leads to a consoling humiliation, found in a Father's forgiveness that is con- 321 :322 / Review for Religious, V~olume 39, 1980/3 stantly available in Jesus as my personal savior. In this way, the daily effect of my sinful condition is not to tear down self-worth, but to build up true apostolic humility, which itself is the source of genuine self-esteem. This positive understanding of the examen helps avoid another fallacy. Many times the full, rich prayer of the consciousness examen shrinks into a quick, superficial reflection over the day, and the five traditional elements of the examen thus collapse into the third element by itself--a general survey of the day's activities. The formal examen, however, was never intended to be just a quick thinking-over of the day. It is supposed to be prayer--and that within a fairly specific form, one related to the daily contemplation but not identical with it. And if the examen is to be chiefly about God's love for me, then gratitude should play a major affective role. Of course, it is the gratitude of a sinner who is at peace with the nothing he can do on his own, because he is still wonderfully learning how our Father's love turns everything to good--even his own sinfulness. The Examen Is Essential to Availability In the conclusion of his letter to the Society. of Jesus on "apostolic availabi_lity," Father General Pedro Arrupe made thi~ statement: To become partly immobile through lack of availability on the part of individuals and the consequent fear of superiors to give them the missions called for by our apostolate today, would constitute a most serious threat to the very existence of our vocation . lgnatian availability is the guarantee and the conditio sine qua non of our practice, which leads to salvation, and alone is of interest to the Society and the Church. A strong claim! My central point here is that the daily examen is the primary means to maintain this disposition of Ignatian and, indeed, of all apostolic availability. Even so, why should a brief period of prayer assume such great impor-tance? This leads us to another insight often neglected in the past. The formal examen-prayer, with its five elements, (usually) lasting about a quarter-hour, is always a means to the informal examen, which is a special faith-sensitivity that is with one all through the day. Often in our early years, we have turned the formal examen-prayer into an end-in-itself, giving to it a rigid fidelity that corrupted its significance. Of course it would be illusory to imagine that we can grow into living the informal examen=sensitivity without the early development of habitual practice of the formal examen and a con-tinuing adaptation of our involvement with this type of daily prayer. Through the informal examen, a person acquires a special ability for discerning (or examining) "presence" in everything. For Ignatius, this quality-presence was more important and extensive than the formal examen-prayer, inasmuch as this presence helps the person to recognize ,the grace of apostolic availability and flexibility that is being'offered in every situation. Apostolic availability is a profound faith-experience that roots one's iden-tity and security in God's love. When a person's security is too rooted in a job The Check on Our A vailability: The Examen / 323 or a place, or even a certain reputation, there results a stubborn rigidity that undermines his availability, just as availability canequally be undermined by a disordered need for change and variety--as when a person is so superficially committed that he really doesn't care whether he's changed or where he's assigned. In that same letter, Father Arrupe pointed up some of the challenges for what we have termed apostolic availability that are especially present in the new directions, institutional involvements and types of service that are re-quired in the modern world. What is fundamental; though, is that availability ¯ is primarilya readiness and sensitivity of heart, not simply a changing of job and/or place. In the heart of a person serving for many years.in the same mis-sion there can be an availability that is very apostolic and invigorating~--and often more difficult than the "availability" that leads to a new assignment. Apostolic availability and genuine perseverance in the same task orplace can never be opposed. In the formal examen, we hold up our day to be seen against the light of God's love. Sometimes this will be more instructive for us than was the experience itself., We may appreciate what we didn't even see in the actual experien.ce. At other times, we can savor the depths implicit in our sensitivity in the actual experience of the day. The continuing informal examen makes us sen-sitive in every situation to a Father's love that is always available, makes us ready to respond in filial 10ve to the Father's desire, as Jesus was--especially on Calvary. At such a point of insight, we see how often our cowardice or disordered desires reveal us to be persons of the "Second Class" (Spiritual Exercises, 154), who seek to make God come to what we desire. This is precisely backwards: consolation and greater apostolic service are to be found in our coming to what God desires. The sensitivity of apostolic availability distinguishes the heart ofa person of the "Third Class" from one of the "Second Class." The difference can become very subtle in one's interior af-fective life, but what~is always at issue is nothing less than better service for the justice of God's kingdom. Availability and Discernment In our sinful human condition, apostolic availability does not at all come naturally to us, but often is born of our decisive dealing with desolation in ac-cordance with the principles of Ignatian discernment. The seven capit.al sins, as inner affective experiences (.before we intentionally act on them), are each a type of desolate violence endemic to our sinful condition. They infringe on, and restrict the freedom of our availability. In decisively going against this desolate violence (see Exercises319), we become interiorly available to God's loving and consoling attractiveness, which a!ways frees us for whatever his Heart desires of us now. In this way, Jesus' own decisive availability to his 324 / Review for Religious, Volume 39, 1980/3 Father, in service to our world, is gradually born in our affectivity through our careful living, with all the subtlety of discernment, in the face of our inner, desolate violence. The daily examen is the most practical and regularmeans to practice, this discernment for availability. Our particular examen could then focus on the flaw or weakness that now is most keeping us from this fuller apostolic availability. What is that flaw or weakness? It is not so much something that we decide on, but rather what God will reveal: to us in his loving concern that all of us should belong to him ~ver more totally. By responding to his call through the particular examen, and directing our attention and effort primarily against that flaw or weakness, we are allowing ourselves to be drawn more into the apostolic availability of Jesus where he and we best find the Father. The Examen: An Action-Reflection Model Apostolic renewal is not simply being able to get more done. Apostolic ac-tivity is not measured simply in quantity, but must respond to the dictates of a wise sensitivity in the zealous lover of God. A certain degree of.reflectivity is essential to the growth of this sensitivity. Although in the beginning this reflectivity may seem labored and artificial, as one matures in the Spirit it becomes more integrated, less obvious, and part of the "presence" one has everywhere. There is much talk about various action-reflection models to help renew our apostolic presence, and, indeed, some such model can be an essential instrument and method for apostoli~ religious formation from the novitiate onward. I suggest that the examen is precisely such an action-reflection instru-ment, one that is built right into our daily life, and capable of fostering apostolic availability as a whole way of life open to service to the needs of our world for God's greater glory. In these models, we reflect on our experience, hoping that the reflection will lead us to better quality in our apostolic efforts. Hence the reflection is never for itself, nor directed to a self-centered sanctification, Often in the past, the examen did not have an hpostolic orientation, ~but tended to a suf-focating introspection. As we mature in outpractice Of the examen, the separate steps of action-reflection-action integrate into a sensitivity of presence in the activity that makes us available in everything for the call of our Father's love, in whatever way he desires for his greater glory in our world. Just as the routine and regularity of the daily order help to keep the con-templative monk attuned to God, so the examen can keep the apostolic religious, who is both active and contemplative, a~ttuned to God's love, and allow us, mortified by apostolic availability, to find in everything of this world a son's filial, loving service of his Father. Missionary Prayer and the Problem of Inculturation Carl F. Stark/off,' S.J.~ Father Starkloff's last article in our pages, "Oppression, Death and Liberation: Thoughts in a Context," appeared in the issue of November, 1978. He continues as superior and director of St. Stephens Indian Mission; P.O. Box 294; St. Stephens, WY 82524. The', title of the recently published National CatecheticalDirectory--Sharing The Light of Faiths'is more provocative than one might think upon first sight, if one reads it as a missionary statement. It can be interpreted in the light of a eatechesis that is meant tO instruct Catholics in the faith handed on through baptism. But if we examine those places in the DireCtory that dis'cuss the relationship between faith and culture,' we may be sufficiently disturbed to make us probe more deeply the rfieaning of what it is to share our faith. To speak of the missionary apostolate brings to mind the turbulent history of the exegesis of the so-called "Great Commission" in Matthew 28:18-20, which is placed on the lips of the risen Christ as he sends forth his joyous (though not yet spiritually rejuvenated) disciples to teach all nations about the source of their joy. This gospel mandate began a missionary enterprise that sent preachers of the Good News throughout the known world and outward to the barbarians of northern Europe, the East and to the far-off British Isles. J. Verkuyl points out that the early reformers, probably because of their sense of urgency to establish their movement among European Christians, wanted (mistakenly) to restrict Jesus' mandate to the time of the Apostolic Age.2 The ~ Sharing the Light of Faith: National Catechetical Directory for Catholics of the I~lnited States (Washington: United States Catholic Conference, 1979). See especially pp. 7-16; 85-98; 116-119. 2 j. Verkuyl, Contemporary Missiology: An Introduction, tr. Dale Cooper (Grand Rapids: William B. Eerdmans Pub. Co., 1978), pp. 18-19. 325 326 / Review for Religious, Volume 39, 1980/3 nineteenth century, however, witnessed phenomenal growth in mission activi-ty among all Christian denominations, and the confident expansionist attitudes of the period endured up to the mid-point of, our own century. Today, however, there is a widespread "malaise" among missionaries, as Walbert Buhlmann puts it, though he is careful to note that such a condition is one environment that can nurture hope.~ In any case, there is a c'risis of confidence in the Church's self-image as a "sent" community, and the crisis extends back from the mission frontiers into families and communities, and into individual souls, as Christians question their right and duty to "spread the Gospel." This is a cultural and theological crisis that offers promise of much growth in understanding of the relationship between faith-proclamation and cultural sharing, or, to view it from the dark side, between preaching the Good News and cultural imperialism. A great quantity of material is flowing, from the pens of missiologists about this prob-lem, and there are various theories dealing with the faith-culture question. I have shared in this effort elsewhere. This article, however, is an attempt at a "spirituality" that might further an experiential approach to faith and culture as it is rooted in the life of prayer. Fundamentally, prayer is at the root of this crisis that touches catechesis in the "established" Church, and ,even touches relationships between parents and children. Chesterton wrote somewhere that to deny the right of parents to teach religion to their children is to deny them the right to teach them anything. If our prayer lacks conviction, we are easy prey to dp~bts about this right and duty. In this article, I do not intend to discuss whether there should be missions; I happen to believe there should be. Nor do I intend to take up the much-debated question of a "moratorium on missions"; 1 happen to believe that missions are part and parcel of Christianity. That "mission" should be done differently, with consideration of mutual'resources and values between the missionary and the local culture is beyond iluestion.And that mission should cease to be mission and become church is a prominent New Testament value articulated by St. Paul in his dealing~ with theJocal churches. But amid all the discussion of liberation and oppression, of imperialism and colonialism, of faith and culture, there shines the Light at the center, who is Jesus Christ--the only ultimate justification for all missions. The love of God as manifested in him must be preached-- no doubt in a~.growing way much more by Africans and Asiatics and Other third world people t.o p~eople of the first and second worlds. But they, too, must heed their calling to be transparent mes~sengers. The transparency of which I speak is primarily a question of the missionary's "spiritual life, and that is the subject of this article. A recent b~ok on mission spirituality stresses the importance of the mis-" sionary's life-style for his or her witness to the Gospel. Michael Reilly writes: ~ Walbert Buhlmann, O.F.M., Cap., The Coming of the Third Church, trans. Ralph Woodhall, S.J. (Maryknoll, N.Y.: Orbis Books, 1977), p. 405. Missionary Prayer and the Problem of Inculturation / 327 How can the life-styles of these countless men and women who did so much to spread Christianity in the early centuries be described? There is no lack of testimony and evidence on this point. It can be summarized under five categories: the transformation and moral uprightness of their personal lives, their fellowship and social concern for others, their joy, their endurance under hardship and persecution, and the power which they exercised by virtue of their faith.' This iri general speaks of the awesome demands laid upon the missioi~er. Certainly no mission labors c~in be sustained without these qualities, to which we will more explicitly add perseverance in profound daily prayer, even and especially amid the many "dark nights" that cultural conflicts can create or intensify. The growih in a person's ~n spiritual life should be a continuing conv'er-sion in the intellectual, moral and religious orders, of which Bernard Lonergan writes in the transcendental phenomenology of his theological method.~ Missionaries above all, because they confront so many new and challenging experiences, must undergo such conversion, which is fed by, and, in return, nourishes a gospel-centered awareness. The,apostle must have also that unqualified, unreserved "being in love with God" that Lonergan calls religious faith,6 and this faith should be anchored in the historical reality that is:Christianity. Lonergan writes: ""There is a personal entrance of God himself into history, a communication of God to his people, the advent of God's word into the world of religious expression.'" The missionary will have to apply this dynamic of constant growth to cultural realities and religious values, as well as to his or.her own sources of spiritual power, experiencing these with both.pas-sionate involvement and prayerful detachment. The title "missionary" is not only audacious and shocking; it is unforgivably arrogant unless one assumes in it the motive that stems from the experienCed knowledge of Jesus Christ as the embodied presence of God's love in the world. This love incarnate becomes most explicit in the various' gospel texts that order the proclamation of salvation to all peoples. To preach eternal salvation is fundamental to all missionary zeal. But because salvation is incarnate for the Christian, his preaching cannot merely" project salvation into eternity, disembodied and unattached. The Good News calls people to ex-perience God's love and kindness within temporal existence, Otherwise, why take creation with any seriousness, at all? Our reading of the various reports of the life. and work of Jesus of Nazareth has been conditioned by our catechetical upbringing. We have learned to see Jesus as laying down his life when.he wills to do so, meanwhile battling with the scribes and pharisees in their apparent hypocrisy and their intransigent insistence on external conduct. But it is to the credit of the Michael Collins Reilly, S.J., Spirituality For Mission (Maryknoll, N.Y.: Orbis Books, 1978), p. 53. Bernard J. F. Lonergan, Method in Tti'eology (New York: Herder and Herder, 1972), pp. 3-25. Ibid., p. 105, ' Ibid., p. 119. 32~1 / Review for Religious, Volume 39, 1980/3 "liberation theologians" that they have forced us to become aware of the pervasive and persistent struggle of Jesus to win for the poor of Yahweh a humane existence, snatching their lives from the hands of powers that oppress them with needless burdens and joyless, unwarranted submissiveness to human domination. Thus missionary zeal is summoned to examine itself about its concern for a basic humaneness of life; it should feel great pain whenever the Good News is kept from persons because they are humiliated and demeaned, when they suffer oppression or oppress one another. Indeed, our spiritual resources must be strong enough to make us believe that faith can thrive under oppression, but our contemplation of the Gospel also shows us that Jesus fought conditions that enslaved people, Jesus' mission, and that of the Church, is to work for the conditions that permit a joyous and free wor-ship of God. This is a profound social dimension of the Gospel that more and more who read it are coming to perceive. For the prayerful and devout Christian, one of the most urgent motives-- perhaps the motive--for mission.activity, at least in the year~; of Catholic and Protestant missions since the sixteenth century, has been the brooding con-templation of countless hordes of souls going to hell because they did not con-fess Jesus Christ. With the reflective work of modern theology and Vatican Council 1I (rooted incidentally in some very good and very old "natural theology"!), we may still have concern for our neighbor's salvation, but there is also the opportunity for a more enlightened appreciation of the values to be found in the religious traditions of all peoples, and for a more modest assess-ment of the spiritual condition of the non-Christian. This appreciation of the spiritual values of other religion, along with the sense of a Gospel permeated with social values, leaves mission theorists with the task of formulating new attitudes towards the mission apostolate. In fact, this qualifying of the sense of missionary urgency has led to a growing spiritual crisis for many church people, most especially those in an active mission apostolate. Toward a Missionary Spirituality The approach to prayer that I hav~ chosen to discuss here is one that might help the follower of Christ to find "seeds of the word" and a means of salva-tion in the religions of non-Christians or in elements of tribal spirituality not explicitly Christian. At the same time, however, it seems to me a nullification of the Christian vocation to deny or to bypass the person of Jesus Christ, taken both historically and in the Pauline cosmic dimension, as the fullness of divine grace intended to be the Father's greatest gift to humanity. 1 do not say this as a scriptural or dogmatic fundamentalist: the praying Christian should also be an inquirer into the more sophisticated areas of comparative religion and scripture scholarship. Still, whatever level of hermeneutics we may under-take, the New Testament constantly reminds us that courteous dialogue with non-Christians is only part of our calling. The prayerful realization of what Christ means in my life can do no less than move me to tell my dialogue Missionary Player and the Problem of Inculturation / 329 partner how utterly central Christ is for me. What the other does with his ex-perience of my witness is a matter of his personal decision, always to be respected. But that person should know that my life of prayer has shone out through my personal testimony and conduct. Juan Luis Segundo has proposed a helpful approach to the centrality of Christ and tile witness of the Church. He reminds us that the principle "no salvation outside the Church" should not be taken as a matter of church boundaries but rather that it deals with the mediatory role of the Church.8 Segundo calls the Churcha reality at once particular (pertaining to cultural realities), since it is a historical movement serving as a sacrament, and univer-sal, since it serves as a medium of salvation: "It is the expression of the mystery of Christ himself.''9 In Christ the missionary preaches God's love to people, and if he feels unable to broadcast the triumphalistic boast that no one outside the Church will be saved, he is still conscious of the unique gift of Christ. Segundo calls the Christian "one who knows"-- knows Christ as the beginning of the Father's plan that moves into the future and permeates all of time. The Christian is not the only one to enter into this plan, but he is the one who knows it through Revelation.'° This is anything but a revival of primitive gnosticism; it is rather a consciousness (grounded in prayer) of the gift of sav-ing knowledge and the acceptance of a calling found through hearing the Word of God. Such a "knowledge" given.to the Christian is the content as well as the experience of conversion, a living faith that Lonergan calls an "other-worldly falling in love."" What the Christian knows then becomes the driving force for the labor of proclamation. It is, for one thing, a deeply biblical spirituality, for our encounter with the Word of God in Scripture and preaching is our summons to mission. However, I have chosen here to offer a more particular approach or method based on resources within my own Jesuit order, hoping that these resources will serve others in developing a mission-centered prayer life. Recent documents of the Society of Jesus remind us that the Jesuit's self-knowledge is found in the sense of being a sinner who is nonetheless called to be a companion of Jesus.'2 We redeemed sinners are by vocation a "com-munity of dispersion," ready to be sent on mission." The basic dynamic of this vocation, paralleling similar resources in other communities, is the Spiritual Exercises of St. Ignatius o( Loyola, which, made, serve to mediate the gospel-conversion-mission experience. Examining the experience of conversion and mission, we immediately con- 8 Juan Luis Segundo, S.J., Tr. John Drury, A Theology For Artisans of a New Humanity (Maryknoll, New York: Orbis Books, 1973), Vol. I, p. 76. 9 Ibid., p. 78. ,o Ibid., p. 13. " Lbnergan, Op. Cit., p. 240, ,2 See Documents of The 31st and 32rid General Con.gregations of the Society o f Jesus (St. Louis: Institute of Jesuit Sources, 1977), p. 401. ,3 Ibid., p. 405. 330 / Review for Religious, Volume 39, 1980/3 front the problem/mystery of Christ and culture, of the universal sway and dominion of the Risen Christ .and the particular authenticity of cultural values. Indeed, the Exercises are themselves a partictilar cultural phenomenon within which the Christian faith is rekindled and nourished, and which have proved themselves to contain certain universal values. One who truly receives the liberating love of God in the Exercises comes in touch with the sovereign God in a discovery so powerfully expressed by Karl Barth: The love of God stands where there is disclosed, beyond and above and in the twofold negation, the preeminent affirmation--Jesus Christ, the .Resurrection and the Life~ Blessed discovery! God stands in light inaccessible. Blessed discovery! All flesh is as grass and all the glory of men is as the flower of the field. When, in spirit and truth, one of these discoveries is made, the other is involved in it, for both are in fact operations of the One God, whose universal majesty is the "Yes" in the"No.'"' The gift of a knowledge0of the love of God is so moving and powerful (perhaps in a very quiet way), that it is no wonder that enemies of the lgnatian Exercises have called them a brainwashing. The radical freedom of Christian conversion, as Barth so stirringly tells it above, calls us into a permanent state of tension. This tension is made up of what, to borrow from a number of spiritual writers, we might call "moments" of the Exercises--the two moments of conversion and of mission, I call them moments in the sense that they are kairoi, transcendent of any chronological order; they are experienced in an interweaving rather than in succession, and not merely in time of retreat but in the insertion into comrhunity and ministry. In the Exercises, the first truth one comes to grips with is God's sovereign-ty over one's life and destiny. One has to wrestle with and deeply assent to the fact that we are created to praise, reverence:and serve God, and thus come to salvation. I use the word "wrestle" here because the ascesis of,the Exercises contains much wrestling (though in the end we seethe folly of all this muscle!); no human being readily surrenders his or her own sovereignty andautonomy to anyone, even to God. Nor should they readily surrender. We are persons gifted with dignity, and until we realize that this dignity can be brought to final perfection in God alone, through obedience rather than abject slavery (an important reflection in ministry to the oppressed), we should not sur-render our autonomy. Yet we finally do have to surrender to God as Chris-tians, having,wrestled with him and been so wounded that we manifest in our very steps, as Jacob did, the divine-human struggle that eventuates in our ob-taining his blessing. Then the believer, too, becomes an Israel who realizes that all this effort was part of a foolish bout with God's love. I wish to return to this matter of conversion later, for it is the genuine source of crisis (under-stand "decision") in the missionary's grasp'of problems of culture and social justice. Karl Barth, The Epistle to the Romans, tr. Edwyn Hoskyas (London: Oxford University Press, 1965), p. 321. Missionary Prayer and the Problem of lnculturation / 331 Once the Christian has yielded to divine sovereignty (or arrived at a stage of acceptance, for the faith-choice that expresses this yielding occurs many times in "becoming a Christian"), he has again accepted the reality of his own sinfulness--the disobedience, the recalcitrance, the anger at God's insistence on submission. There goes with this an even more difficult acceptance of divine love, for within our sinfulness we find an inability to let ourselves be loved, and even glory in perversely thinking about God's "No" to us and fear His "Yes." With the opening to grace we rejoice in that essential Christian ex-perience of acceptance of self as loved by God. The loving power of Christ is the "tree of life" that nourishes our circle of existence at its very center--a powerful Amerindian image that indicates a wholeness of life based on devo-tion to its source. But the moment of conversion is hardly complete with repentance, or with the return of the prodigal. The once-lost younger son will discover now the meaning of mature membership in his father's household, that it is shared life and companionship, but also involvement in the labor and the suffering. Such a call to deeper filial piety may well bethe sequel to the Prodigal Son parable, in which the erring but more attractive younger son is equalized with the dour older brother who we all quietly tend to scorn. The sin in all of us resists true belonging. Thi~ is why the SpiritualExercises lead the Christian to understand what it is for Christ to be a "King" in our lives, for him to have a loving sovereignty 'rather than by an imperious and aloof barking of orders that avoids deeper ih~,olvement. David Fleming describes the Meditation on the Kingdom of Christ as the placing of oneself into a "mythical situation, or the kind of story-truth of which fairy tales are made."'~ One seeks to know Christ in whatever fashion one may need in ~order to bring home the fact of his lord-ship. The meditation on Christ's kingdom is thus thematic forall contemplation of the life, death and. resurrection of Christ. All the while meditating on the ministry of Jesus, a retreatant prays for the grace to know him more intimately, to love him with grea~er intensity and to follow him more closely. One can begin to attempt this radical Christian prayer, having first meditated on the mystery of the Incarnation, which we shall later take as the basic model for the missionary apostolate. St. Ignatius presents the Incarnation con~ templation as a mental trylStich, representing the Godhead in heaven, humani-ty struggling on earth, and the young woman of Nazareth who assents to the mysterious calling to' archtypically stand for every Christian's response to God. This meditation enters into the second moment, or moment of mission, but first of all it reminds the Christian that the essential grace to be gained from meditating on the life of Christ is "an interior knowledge of the '~ David L. Fleming, SoJo The Spiritual Exercises: A Literal Translation and a Contemporary Reading (St. Louis: Institute of Jesuit Sources, 1978), p. 65. 332 / Review for Religious, Volume 39, 1980/3 Lord, who for me has become man, that I may more love and follow him.'''6 This "for me" (so dear to St. Ignatius-- as well as to Martin Luther!) is the ex-pression of faith in a God who never remains for himself alone but perpetually gives of himself. It is the expression of the love of a missionary God. As the Christian enters more deeply into the mystery of the Incarnation, he realizes how much of the sinner hangs on, and how the moment of conversion is ever-present. As the Meditation on the Two Standards or Two Leaders-- Christ and Satan- shows us, the threat of fear and pride and exaltation of the false self is never far away. Within the gospel accounts one also contemplates types of persons who experience different degrees of submission to God, and so asks himself in what way this reflection applies personally to one's life. As the dread reality of St. Luke's journey to Jerusalem looms up, the Christian is made to realize, along with St. Matthew's newly appointed head of the Church, the still unconverted :Simon Peter, that each one of us shares in that journey. Somewhere within this period of meditation, St. Ignatius' Three Modes of Humility challenge the follower of Christ with the call not merely to avoid all sin, but to enter into his poverty and humiliation and suffering-~-to share fully in his mission. The Third Week of the Exercises is an entering into the fullest meaning of the passion of Christ, not merely with tears of empathy but with readiness for full association. The apostolic moment of the Exercises is mysteriously present here: one comes to sense the many possible challenges that could in the future demand a personal appropriation of the kenosis of the Son of God. Once again, the Christian may fear Christ and remain_ sitting outside the Garden of Olives, only to fall asleep, to avoid the grim strain of apprehension. Or, the disciple might insist with Peter that he will never betray Jesus, and almost in the same moment deny even being with him. We thus discover that it was a relatively simple matter to love God in a childish way as our understand-ing Father, in contrast to our acceptance of his Son as an intimate friend. Friendship can demand so much, and we fear the maturity that it requires, especially when we find that the Son of God, in his hour of greatest need, calls his disciples "friends." This is the opportunity to pass even more dramatically through the ever-deepening dying of "becoming a Christian," which, as Kierkegaard wrote, is all that we ever do in relation to Christ; we never fully "arrive" in this life. But if the Christian perseveres in prayer, there may come, finally, the gift of identification ~,ith Christ in which the cloak of sinfulness falls away and true companionship is accepted. If the Christian embraces the mystery of the cross (according to his or her own personal vocation), there comes that peace which pervades one's prayer at the. entrance to the sepu!chre. A true Christian is a child of the Resurrection, an heir to the joys of the Ibid., p. 70. Missionary Prayer and the Problem of Inculturation / 333 triumphant Christ, and a bearer of that joy. The Christian contemplates and absorbs the spirit of the risen life as the spirit of his own life, and, according to Ignatius, reaches holiness through sharing the joy of the Friend who has defeated death. It should be no surprise that this experience, too, is a conver-sion in the intellectual, moral and religious dimensions of life. We do not easily accept joy in our lives, or the fact that we are created for joy, as C. S. Lewis was astonished to discover. In the face of the grief in the world (and, if we are idealistic missionaries or social activists, our own tenden-cy to take too seriously our personal warfare with all this grief), we find it hard to transform our, solemn frowns into laughter of rejoicing. Perhaps we cannot but think of God as the Ruler of Olympus who becomes jealous of our hubris at thinking we might ever simply be happy. And there is that temptation to sadness in the anticipation of apostolic struggles. So conversion to Christian joy, and the mission to share that joy, are again telescoped into two moments of one experience. St. Ignatius did not leave us simply to contemplate the Resurrection with the first disciples. He has bequeathed to us the Contemplation for Obtaining Divine Love, which is summed up in God's desire to share himself with his friends. There is given here a recapitulation of all good gifts that descend from the Father of Lights in whom there is no shadow, (Jm 1:16-17). We consider all gifts received, and more, we affirm ourselv~es as gifts of God's favor. A joy-filled Christian can thus say: Take, Lord, and receive all my liberty, my memory, my intellect, and all my will--all that 1 have and possess. You gave it to me;to you, Lord, 1 return it. All is yours, dispose of it according to your will. Give me only your love and grace, for this is enough for me." This contemplation also expresses an aspect of the apostolic moment, both in the call to offer one's gifts in the divine Service, and in the vision of God dwelling in and giving life to all creatures. The consideration of the labor of God within all things helps to feel his presence as the very life of the ministry. There is here, too, a profound theodicy that enlightens the missionary about the working of the Holy Spirit in all created reality, where the Word is somehow present before his preaching even begins. It is a great blessing for an aspiring young missionary (or an older one seeking renewal) to be able to sum up his spiritual experience with the vision of all good gifts descending from above--the gifts of justice, goodness, pity and mercy--"as from the sun des-cend the rays, from the fountains the waters." This is ongoing conversion in the highest sense. The Translation of Prayer Into Mission Let us get "practical" about all of this. Where does one go missiologically Ibid., p. 140. 334 / Review for Religious, Volume 39, 1980/3 with the experience of conversion-mission? If I am a redeemed sinner, saved by God from my own self-oppression as well as from the,oppression of false spirits, l am under a mandate t~ p.roclaim that experience to all people. Fur-ther, as Barth has written, we have surrendered our old way of thinkingto the divine "No" and thus ~have been .renewed in a life of grace through His "Yes." To believe that one is saved is the ultimate experience of freedom, and if one has been gifted with a share in God's holiness, he may even sense a call to relinquish homeland and culture in order to announce that freedom to others. Such a state of soul is a great gift and a great mystery; it is also a great problem, and without ongoing intellectual conversion, can leave one open to many deceptions. There is hidden in this experience the danger that the con-verted Christian will interpret some of the chltural trappings of his conversion as essential to conversion itself. In fact, I woul,d venture the guess that much of the zeal to save "savages" has arisen from an uneducated state of mind in x, relation to what one sees as their "unhappy and primitive state." Metanoia in its most profound etymological sense must be part of any missionary prepara-tion and part of an ongoing learning process. Perhaps the most helpful spiritual approach to a missionary openness to foreign experiences is faith in the Incarnation as a continuing contemplation. So St. Ignatius' Meditation on the Incarnation might well serve as the fun-damental reflection of the apostolic moment of the Exercises.lncarnational theology has, of course, been thematic in the thought of theologians and in Church documents since Vatican Council II. Its frame of reference is the historical context of gospel proclamation, which stresses the service of Christ and his Church to .the temporal order, and the hope this service offers to humanity for a more truly di~,ine-human life. A healthy incarnationalism is also eschatoiogical, and in its optimism does not forget the reality of sin. It realizes that God's becoming human does not empty him of his transcendence but rather gifts humanity with a share in that transcendence. In simple w~ords, the Incarnation has its total fulfillment outside history and awaits the kingdom of God in faith even as it expresses its presence already. In. the con-rex: of missiology, incarnational theology proclaims the en-flesh-ment of God within cultures, and challenges all cultures to reach beyond themselves. Ignatius Loyola was a man of great sensitivity to the ways in which the Gospel is to be received humanly, as his instruction for the use of the senses in prayer attests. The Contemplation on the Incarnation is an experience of the divine entering history, of the Good News transforming human cultures and confronting the evils that threaten what is truly of God's creation in them. ln-culturation does pose a tension, if not even a dilemma, for the Christian, as I have already indicated. The zealous missionary who is filled with a desire to show Christ's love to the world iS a person who has acquired the gift of detach-ment from a familiar environment, though perhaps not to the degree he may think he has acquired it. Even the most dedicated Christian carries his or her native culture along as mental and affective baggage, and tends to extend that Missionary Prayer and the Problem of Inculturation / 335 culture, along with the Gospel, to other peoples. To offer the good things of one's own culture to others is a natural and authentic aspiration, if one is aware that these things are not coextensive with the Good News of Christ. This awareness can come only from a deep study'of the culture and from a "participation" in it to whatever degree is compatible with Christianity. Another factor of great importance is the relationship the Christian, has towards the people to whom he is missioned,. There is a danger that one will project one's own degree of commitment into these people, and thus expect of them too soon that same kind of response. Likewise, to compare one's own "surrender" or submission to God, acquired with the help of many cultural blessings and advantages, to the enslavement of oppressed peoples and its concomitant apathy or resistance, is of course a tragic confusion of entirely different experiences. Worse yet, one might even miss the signs of a people's dedication simply out of a failure to comprehend their ways of expressing it. However, meditation on the Incarnation, if we supplement it with proper cultural training, inserts us into the saving love°of the Godhead as well as into the infinite patience and empathy of Jesus Christ, who met people "where they were," living with them in their struggles and calling them to converison. Christ never destroyed or shattered a person's life, however great a shock he may have dealt, but rather uplifted and sanctified the life of every person. In the Contemplat!on on the Incarnation, St. Ignatius in. structs the retreat-ant to "see" the various persons in the eye of the imagination: "those on the surface of the earth, in such variety in dress and in actions; some white and others black; some in peace and others in war; some weeping and others laughing; some well, others ill; some being born,, and others dying . ,,,8 One is to continue by imagining how so many live in blindness, how they swear and blaspheme, how th6y kfli and go down to hell. And in the same mental exer-cise, we are shown how Father, Son and Holy Spirit conspire to work out the salvation of the suffering human race, and how the messenger Gabriel goes to speak to the Virgin of Nazareth. Whatever Ignatius had in mind as he described the misery of our race (in his own cultural terms!), and however we may have evolved in our attitudes about,how many benighted pagans are going into damnation, a sensitive response to his vision of a suffering humanity draws one deeply into a sharing of the human condition. The point here is that human beings have always injured and oppressed one another in various ways; but the much stronger aspect of this truth(See St. Paul'spollo mallon in Romans 5.) is that all types and cultures, all races and .nationalities, enter into the divine compassionate vision and its willto save and transform. Those who are to be saved will be saved as black or white or red or yellow, whether they wear three-piece-suits or loincloths or nothing at a!l, whether their music is rendered by pipe organs or jazz bands or ancient drums. We do not really know what God has in mind to Ibid., p. 72. 336 / Review for Religious, Volume 39, 1980/3 do with diversity in the kingdom of heaven; we do know that he has a total disregard for differences as far as the equal dispensation of his kindness is concerned. Thus a meditation on the Incarnation, if carried through with full involve-ment, takes a missionary into the midst of the culture he serves. It prods him to study anthropology and sociology and comparative religion, both in books and in lived exp~erience, as well as to do all that is necessary tomake him atten-tive, intelligeni, reasonable and responsible. It serves as the affective nourish-ment of all the intellectual and procedural efforts one may bring to work in a foreign culture. It would seem, therefore, that a missioner's own prayer life would change, to some degree, along cultural lines: An openness and sensi-tivity to the people will lead to a sharing of indigenous forms of prayer and worship. No matter how hard 1 may try, I will never become a Native American or South African black or campesino, especially if the culture I serve has a history of deep Wounds inflicted by the very society and church I represent. This should in fact be an initial experience of inculturation--to realize that onb is a foreigner or guest, or better, a pilgrim, and that one naturally resists becoming part of a new culture, especially in its startling and strange aspects. But still, we ~can take on many qualities of our environment, and should do so if they insert us better into the life of the people and help us to grow personally. Generally, the first experience of mission life for the outsider is one of conflict. This is emphatically true of all who enter into work among societies suffering from powerful structures and histories of persecution or cultural invasion. To become part of a wounded culture is to absorb inevitably the feel-ings of frustration, anger and despair; to experience the "diminishment" that occurs within as one responds again and again to expressions of these negative feelings. There may also be a deep dissatisfaction with oneself over the failure to remain tranquil and "understanding" in the face of such assaults. The mis-sionary must then turn, in a way perhaps never before experienced, but anticipated in earlier prayer, to the reality of a suffering and dying Savior, who himself knew pain and rejection and the feeling of being an outsider. When'the Word pitched his tent among us, he certainly had to live as an alien in our midst, with disciples who failed to understand, with authorities who re-jected him, with hangers-on who melted away in the face of conflict. The mis-sionary can be helped spiritually, through intellectual resources and the study of the history of injustice or persecution in the area of hi~ activity. For exam-ple," in studying the near genocide of a number of ti'ibal cultures at the hands of invaders who made these people aliens in their own lands, the missionary can learn to approprihte the sense of weakness often felt by Christ himself in the face of the burdens of history. However, even in a badly wounded culture, one can experience gifts in greater number. Among many of the more traditional, or "primal," societies Missionary Prayer and the Problem of Inculturation / 337 of Africa or Asia or the Americas, can be found spiritual attitudes remarkably resonant with the Christian experience: creative suffering, prayer, contempla-t! on, worship forms, acceptance of death, ascetical practices. One can learn to appreciate the reverence of the people, the sense of appreciation for nature, the deep respect for spiritual realities. It is possible to learn to enjoy the music, the dance, the language, the good times, as they occur in a natural cycle of tribal events. Perhaps the missioner will even find in the new culture (not because he hates his own but because he loves it too) a new"sacred space" in which to be at home. As this occurs, one finds oneself both proclaiming and experiencing conversion. Missionary prayer is then truly coming to birth according to the mystery of the Incarnation. To sum up, then, Christian conversion is not a narrowing experience. While it focuses our gaze upon Christ as the Father's unique expression of love, it also constantly opens our horizons and leads us to greater social and cultural understanding. But the conversion process must be a composite of in-tellectual, moral and religious growth. Prayer alone will not achieve this, but without prayer the missionary is merely another cultural invader. A strongly incarnational prayer reminds one constantly that in Christ the Father has reconciled the divine and the human, and that we can indeed preach a transcendent faith that finds roots in local cultures. "When Did We See You?" Donald Macdonald, ,S. M.M. Fr. Ma~cdonald, master 6f novices for the Montfort Fathers, is stationed at the house of Maria Bhavan; D.R. College P.O.; Bangalore 560029; India. ~ watched a group of sisters, out walking, slowly pass a row of hovels. Out-side one of them, a little girl was squatting, cutting wood. Seeing the sisters approach, she put down her knife, joined her hands in the Indian way of greeting, and gave them a lovely smile. The sisters (presumably) never saw her. Three other sisters were walking some five or six yards further back, and I thought that perhaps one of them would have seen what happened, and so stop for a moment to make a fuss over the child. They, too, walked past. I still see the quizzical look on the child's face. Clearly, mistakes are easily made. It is also unfair and invalid to draw a general conclusion from a particular instance. But from years spent in pastoral ministry, not least with religious, I suggest that there may be more in that incident than many of us would care to see. Such insensitivity may be the rule rather than the exception. Those sisters may be like that even with each other. They just do not see. This same lack of insight may be a consistent feature of their everyday world: They may never really live in the present moment, and so miss so much of what is happening about them. If the mature person is "one whose center of gravity is where he actually is," it may explain the immaturity of some religious lives." What is needed is the ability to be both part of, and apart from, the present moment, to give oneself wholly in the present as an expression of a mature Christian faith. So much of religious life, especially as one gets older, can be so unsatisfactory for so many, because they are never really "alive." Any one, for example, who has ever been in the company of the present Holy Father, might judge that he is in fact a great parish priest of the time when such men 338 "'When Did We See You?" really knew their people. He is always aware of what is happening. Though he may be unable to speak to everyone individually, yet he neglects no one, regardless of how many are about him. What steps, therefore, can the religious take to try to become fully alive to the present as an expression of a mature Christian faith? Listen Like a Disciple Once upon a time, most religious began the day with a "morning offering." I suggest that this once-common custom should be revived to help give a precise focus to our day. A line adapted from Is 50:4 makes an ideal morning prayer: O Lord, give me a disciple's tongue. So that 1 may know how to reply to the weary, provide me with speech. Each morning, wake me to hea~, to listen like a disciple. We should pray that we may speak only what we have learned of God--a disciple's tongue. We beg that we may never ignore the weary, and so have something to say ~to the child, the~neglect of whom began these reflections. Ideally, we want to be able to answer the questions people dare not ask. We want to offer not just sympathy but empathy,, the ability to feel for and with these persons of our world. We must have time for those that n'o one else has time for. So important is this approach to the present moment, that we should ask God to wake us each morning to hear. But, more than that, we should ~vant to listen like a disciple. In whatever circumstances we are placed, we want to be aware of all that is happening, to assimilate our experience. The whole world is sacrament. Thus we are eager to listen like a disciple, to try and catch every, nuance and inflection of the world in which we live. Most of us share a com-mon degree of hearing and vision. What separates us one from another is insight, or the ability to respond to the unspoken word or gesture. Our prayer, therefore, should be that God would give us the sensitivity to be fully alive in our global village. Our center of gravity is ~vhere we actually are. A day begun with ~suCh a reflective prayer to God can ~urely help give definition to our approach to the present. If our minds progressively assimilate the assumptions underlying the prayer, experience, in whatever form it comes, will be integrated into our lives in God. Through Love in His Presence The religious may further deepen that basic insight, by attempting to share the grasp of reality found in the superb opening prayer of the letter to the Ephesians. There Paul's present situation is prison. The future prospects, in his estimate, probably included death by execut~ion.The past, an apostolic life of mixed fortunes, was evidently drawing to a close. In such circumstances :340 / Review for Religious, Volume 39, 1980/3 notice the approach of a mature Christian faith, and the astonishing balance given by such a center of gravity: "Blessed be God the Fathe~ of Our Lord Jesus Christ, who has blessed us with all the spiritual blessings of heaven in Christ" (Ep 1:3). There, the first move is to God. And what a God--"the Father of Our Lord Jesus Christ," who has given us everything. This, from a man in prison, towards the end of his life; no self-pity, nor justified disappointment, nor even the pretence of whistling in the cemetery to pretend he is not scared. His perspective is anchored in "God the Father of Our Lord Jesus Christ." Whata marvelously expansive opening to a prayer from a man shut in, and about to lose his career and his life. Then his faith, grasping reality,, takes him almost beyond the limits of imagination to the point of saying: "before the world was made he chose us, chose us in Christ" (Ep 1:4). The sense of awe and wonder is evident as it dawns on him, "the very least of all the saints" (Ep 3:8), that these moments of life have been given him by God. The immediate present is received as a gift from God in Christ offered before even the world was made. How does one quantify love on a scale like that? From this perspective, the present moment is an expression of the depth of the love of God for us that is quite literally beyond computation. One just receives and adores. To the extent that I can share this outlook, I allow God to love me in the present moment. Receiving life as so charged with the love of God, 1, too, deepen my capacity to love. I do not know when I first knew God, but from "before the world was made" God knew and loved me. The present moment is the focus of such love, where I "live through love in his presence" (Ep 1:4). This, l suggest, can be the center of gravity of a mature Christian faith. His Spirit Living in You Following Saint Paul, the religious can go still deeper into the present moment. "Do you not know that you are God's temple and that God's Spirit dwells in you?" (l Co 3:16). Individually or collectively, God is present among us in the only way that is real to us--through knowledge and love. Anything else is superficial. The point is given added emphasis when we remember that the word translaied "temple" i~s no(our word for Church, b~t rather, "tabernacle." "God's love has been poured into our hearts through the Holy Spirit which has been given to us" (Rm 5:5). Religious, aware of God so present to them and in them, could only respond in wonder and awe. Their very personality would reflect adoration. "Your body, you .know, is the temple of the Holy Spirit, who is in you since you received him from God" (l Co 6:19). If the religious truly listened like a disciple to words like that, the love of God, found in the present moment, would take them to !he heights, and give them "the strength to grasp the breadth and the length, the height and the depth, until knowing the love of Christ which is beyond all knowledge, ~you are filled with the utter fullness of God" (Ep 3:19). "When Did We See You?" / 341 For the Praise of His Glory Despite possible appearances to the contrary, the above approach to reality, stemming from an understanding of baptism, is simplicity itself. It has to be if it is to center on the present moment. Here the religious is never in the position of the harassed motorist driving at night, and trying to cope with all the signals he is receiving at a busy road junction. Nor is it an artificial con-struct pieced together from a possibly outdated literary-form. Quite simply the religious is aware that he is loved by God. He has always been present to God. Life is God's gift to him, moment by moment. In responding to life so given, all that is deepest in him echoes awe, adoration and love. Thus does he begin to sound the depths of "the unfathomablk riches of Christ" (Ep 3:8). Aware of the presence of God within him, he believes that with that gift he has received everything (see Rm 8:32). As the reality of this dawns on him, the love of Christ overwhelms him, as he begins to see that "for anyone who is in Christ, there is a new creation" (2 Co 5:14,17). His center of gravity is moving gradually from self to Christ. Inescapably, and often at a level beyond words, his faith expresses itself in love, adoration, gratitude. In time, as he continues to allow God to 10ve him,his "life is hidden with Christ in God" (Col 2:3), so that, however imperfectly, he realizes, as a baptized Christian, "I live now not with my own life but with the life of Christ who lives in me" (Ga 2:20). Thus he tries to allow God full play in his life. As many religious know, such an approach to the present moment comes to be as natural as breathing. It is the normal, prosaic everyday basis of his life. It is the common coin he uses moment by moment. Living therefore in Christ in a sacramenthl world, one lives in the presence of God, not at some degree removed from him, as though he were a spectator. The smile and greeting of the child which provoked these reflections, can be seen as an expression of the love of God. Her puzzlement as she was ignored was surely an echo of the rejection of the love of God. The insensitivity of the religious presented a glimpse of Christ handicapped, unable to express his love for the child in that instance (see Ph 3:18). Attempting to listen like a disciple to what God might be saying in an incident that was over in seconds, one realizes all too well that, in addition to the above, there may be other inferences. Lord, in the child and the religious do I see you and me? Do I see your love always expressing itself in the most unlikely situations--and my response? Again, is that how I am to the people who come into my life? This reflection does not depersonalize the child, nor take from her her integrity as a human being. She is not a cipher. But viewed from the stand-point of Christian baptism, which is the basis and point of religious life, it is surely not illegitimate for us to deepen the realiz~ation that we are loved by God, that, as a result, we must "owe no one anything, except to love one another" (Rm 13:8). We are in debt, therefore, to everyone we meet, as we can never adequately repay love. There is perhaps no more exacting test of the authenticity of one's faith. The Threat and,the Thrill of Dominion Labour# Beneviile, S.C.C. Sister Labour~ teaches at Delone Catholic High School; S. Oxford Ave.; McSherrystown, PA 17344 Let us m~ike man in our image, after our likeness. Let him have dominion over the fish of the sea, the birds of the air, and the cattle, and over all the wild animals and all the creatures that crawl on the ground (Gn 1:26). In the light of the Genesis account, we know ourselves to be the hallmark of the creative power of God who transformed the darkness over the a~yss; the God who shaped the formless waste which was the earth; the God who made light to dispel the darkness; the God whose touch brought forth vegetation and seeds of every kind. Custodians of creation, we are challenged to find joy and fulf!llment in this awesome burden of nurturing the universe. To do so, however, we must discern the subtleties of our behaviorand try to strip away any repressive thought patterns which distort our presence to reality. By un-consciously excluding that which is painful, fearful, or even sublime, repres-sion is the ego's means of scaling down life-- that is, of reducing ffc~th terror and ecstasy to something within our control. From infancy on, we have been schooled to block out that which either threatens or diminishes our own stature; thus anxiety is minimized and we are able to move through life with a kind of equilibrium. 'Capstones of God's creative power, we are marked by an ambivalence which suffers from the pain of finitude as well as from the glorious burden of mirroring Infinitude. We live simultaneously on the brink of obliyion and the brink of infinity. Because the possibility of both destruction and transcendence are threatening, we too readily settle for the protection which illusion offers. But truth and ultimate fulfillment demand that we live face to face with the realization that the universe is teeming with wonder and danger 342 The Threat and Thrill of Dominion / 343 of colossal proportion; and we cannot let our consciousness of this inure us to the utter magnificence of that which has been entrusted to us. Instead of deflecting the wondrous mysteries of the world, we must so sensitize ourselves to our task and privilege that the fullness of God's glorious creation opens up before us, and thus we can revel in the inestimable joy to which we are heirs. ". mountainsand hills shall break out in song before you, and all the trees of the countryside shall clap their hands" (Is 55:12). The innate fear by which we resist the greatness to which we are called-- a Jonah complex according to psychologists--prompts us to entrench ourselves in mediocrity, security and conformity rather than bear the risk of the superlative. In the depth of our souls we glimpse our godlike possibilities, but quiver at the thought of having our potentials actualized. Intensity hurts. Pain--albeit a "nice" pain--is the counterpart of intense living. "We are only the earthenware jars which'hold this treasure to make it clear that such an overwhelming power comes from God" (2 Co 4:7). Our spiritual and.emo-tional yearning often seems to exceed our human capacity to withstand. Repression of the sublime is the defense which enables us to maintain our balance in a universe which would sweep.us off our feet if we were totally sen-sitive to it. Ecstatic moments, for instance, are too charged to be endured for long. Because we lack the strength to bear the miraculousness and force of life at its fullest, we cut back to an idle; we moderate the degree to which we will let ourselves experience the grandeur of it all. Closing ourselves off to the possibility of unlimited greatnessthus enables us to remain intact, untouched in the face of an overwhelmingness which might otherwise be devastating. In Thornton Wilder's Our Town, Emily perceives the truth of life only after she returns from the grave: "Oh, earth, you're too wonderful for anybody to realize you. Do any human beings ever realize while they live it--every, every minute?" The stage manager answers: "The saints and poets, maybe--they do some." Just as the fear of greatness keeps us walled up, so does the fear of little-ness. In contrast to the rest of creation, we are at best miniscule, and that's ter-rifying. Man, the self-aware capstone of creation, is, in fact, insignificant. Our fragile position in a mighty world began with our helpless condition at birth. Despite unconscious efforts of denial, none of us can ever quite forget the fact that we were once dirty-faced, cry-baby kids who needed another even to change our diapers. As a species we may have been given dominion, but as individuals our personal histories are at best embarrassing. Unlike animals, we are endowed with a self-awareness which makes the truth of our fragility even more terrifying. "It means to know that one is food for worms., to have emerged from nothing, to have a name, consciousness of self, deep inner feel-ings, an excruciating inner yearning for life and self-expression-- and with all this yet to die.''t Ernest Becker, The Denial of Death (New York, 1973), p. 87. :344 / Review for Religious, Volume 39, 1980/3 Paradoxically, it's this very terror of our own nothingness which has generated such self-assumed authority, such egoism. The instinct for self-worth and self-preservation has sparked the fantasies and repression which delude us about our true condition. Unable to cope with the reality of our littleness, we have let our egos construct vast networks of illusions by which we assert and argue our own value. Without these lies to feed off, life would be nightmarish. The rose-colored vision which repression insures protects us from the omnipresent bogeyman whose terrors would disarm us: if we ever dropped the mask of importance. According to Kierkegaard, the lies perpetrated by the ego are: the most natural ,defense against the anxieties of life. Dread would be overwhelming without the escape hatch which repression offers. Fantasizing about one's role or place in the cosmos is a comforting ex-ercise by which the emerging person obscures the truth which lies at the root of the human condition. The egoism which dominates us doesn't ring of pride as much asit does of escapism. It's weak man's instinctual defense against his smallness; against . total negation in an apparently capricious and topsy-turvy universe. Let's face it, over and above the natural disasters which threaten us, the evils We heap on one another are staggering: the haunting memory of six million Jews exter-minated; the wake of Three Mile Island and the threat of nuclear extinction; four hundred thousand boat people drowned; incessant wars and rebellions which decimate the hopes of nations. Rather than live vis-a-vis our fragile position, we prefer, in fact, to pull the wool over our own eyes. The crux of our failure to resonate with the challenge of dominion, then, is two-edged: a fear of greatness and a fear of littleness. Repression serves to protect us from a double apprehension about the latent power which might be unleashed in us, as well as from a sense of feebleness in the face of a vast universe. By blocking out any mystery or terror which dwarfs our stature, we live comfortably with the illusion of control. Repression makes the dark so cozy that we forget our need for the light. The price of this illusion, though, seems to be a lobotomy of the soul. We have anesthetized our spirits as a means of maintaining our balance. Undoubtedly, to have been made in the image of the Creator and subsequently entrusted with undisputed authority is a fearful heritage. If we are to attain our true stature, however, we must be persons who accept their creaturehood and are brave enough to live without the facade of power or righteousness or control. We will enjoy the thrill of dominion and minimize its threats only to the degree we can live with our own vulnerability--that is, to the degree we can shed the protective armor which has shielded us from so much of life. Thus psychology and religion merge as we relinquish the security blanket of egoism, which has so falsified our percep-tions, and posit our faith in the God who created us. The formula for such faith is basically simple: "One is a creature who can do nothing, but one exists over against a living God for whom 'everything is The Threat and Thrill of Dominion / :345 possible.' -2 The Scriptures clearly delineate the nature of this call to faith: faith in a God who has told us every hair on our head is numbered; faith in a God who knows when every sparrow falls to the ground; faith in a God who feeds the birds of the air and clothes the grass of the field with splendor; faith in a God who has said,. "No one who comes to me shall ever hunger and no one who believes in me shall ever thirst" (Jn 6:35); faith in a God who himself conquered death through resurrection. Such faith is the death knell to all the claims which the ego has so jealously guarded. Instead of making our own arrogant assertions the touchstone, our fundamental identity with Ultimate Power gives us our significance. Creaturehood is no longer a liability--rather, it's a hotline to the Creator. The very One who has called us into existence and given us authority stands behind us and before us. The secret fears which once eroded our joy and op-timism are dissipated the moment we see creatureliness as our claim to the Creator. Similarly, the inner yearning to proclaim ourselves and to experience the something more of life takes on new meaning as we accept our role as capstones of God's creative power. Our identity lies in imaging the Father and in nurturing that which his loving touch has brought forth. No longer is our personal worth determined by social and cultural norms; on the contrary, our individual worth is affirmed by our link with the transcendent God who created us and gave us dominion. Love has shared Itself. We have been made in his image. "Before you were born, 1 called you by name," The mystery at the heart of each of us makes sense and finds fulfillment only in relation to the Mystery at the heart of creation. ~ Becker, p. 90. Towards Mutuality in Ministry Sally Kenel, D. W. Sister Sally serves in the pastoral ministry of St. Mary, Gate of Heaven Parish. She resides at 85-28 Forest Parkway; Woodhaven, NY 11421. Which do you identify with more? A typewriter or a piece of paper? Santa's bag or a Christmas stocking? ~ These either/or questions attempt to indicate a basic tension that exists in identifying oneself as either a "giver" or a "receiver." We religious engaged in ministry probably tend toward the giver option. It is true that mfnistry requires service, but a forced choice between giver and receiver can set up a dualistic I-as-opposed-to-you dynamic. This dynamic, in turn, can be d block to the growth of the minister. Much of our training in religious life has reinforced the notion that "it is more blessed to give than to receive.'" Evidence of our working out of this framework can be found in such everyday responses to people as, "What can 1 do for you?" Immediately, the giver/receiver dualism is established. It is my contention that it is blessed to give and to receive; that the clear cut distinction between giver and receiver does not exist in reality; that there can be, indeed must be, mutuality in ministerial relationships. Since this belief was brought home to me in my ministry with the elderly, reflection on this concrete experience is what will give shape to much of this article. However, mutuality in ministerial relationships can exist between people of different ages, backgrounds, sexes, and so forth. In fact, all our relationships offer the possibility of blurring the lines that separate us, plunging us into that unity of all things in Christ. At first cons'ideration, the elderly may seem an. unlikely group to demonstrate that mutuality in ministry is possible. Often, our culture tends to focus only on the losses and depreciation of old age. Economically, in terms of the relationship Of expenditure to production, the aged person is viewed as Acts 20:35 346 Towards Mutuality in Ministry / 347 a liability. From the viewpoint of the dominant values of medicine, the process of human aging is considered to be totally negative. Moreover, the experiences of many people attest to the losses of aging: loss of income, loss of role, loss of status, loss of affection, loss of competency, loss of power-- to name a few.2 .Certainly, the elderly seem to be a group with serious needs, and meeting these needs can become an all encompassing task. However, to look only at the negative aspects of aging and to focus solely on the needs of the aged, starts us ministers on the road to that dualistic l-as-opposed- tozyou mentality. If mutuality is to be a possibility, we must get beyond the needs to the person. As we meet the person, it is my experience that we will find that revelation continues to take place, that we can receive. "What we like best about your visits, Sally, is that they help us to remember." This comment of one of our parishioners personalized what Becker describes as the special function of the pastoral minister, that is . to "bring up to date," so to speak, the treasury of accepting relationships in the life of the older person. The personal relationships which the pastor activates in the contem-porary history of the elderly will help them to "remember" (anamnesis) the past mercies of God, the past loving, unconditional acceptance of family, friends and members of the household of faith (hopefully)? ~ Becker goes on to indicate that this remembering is biblical in nature. It takes on the import that it has in the Scriptures especially in the Old Testament where "remembering was understood not merely in the sense of recall, but in the sense of reliving, reactualizing by recollection.'" Thus, in listening to the story of a~person's life, often we hear an individualized, unique version of salvation history; a testimony tothe action of God i'n the life of that person. ~ Nouwen says that the "great vocation of the minister is to continuously make connections between the human story and the divine story.''~ Several of the elderly people with whom I have had contact have made,these connections themselves during the course of their lives. From them 1 have learned much about their individual lives, much about the mystery of life, and much about the God who informs all our lives. From them, too, I have learned much about m~own humanity and my identity as a religious. That I would learn about the htiman condition 'from the elderly did not surprise me; in fact, 1 expected to learn from those who had experienced so much more of life~ However, 1 was unprepared for the fact that the lives of the elderly would have so much to say about religious,life, Yet, aging thrusts a person into new relationships with poverty, 10helines~ and oppression, the very conditions to which the vows speak. Thus,. 1 found that the elderly stand with us religious in witnessing to 2 Evelyn E. Whitehead, "Religious Images of Aging", in Aging and the Elderly, Spicker et al., eds., p. 37. ~ ~ Arthur H. Becker, "Judgment~and Grace in the Aging Process", Pastoral Psychology, XXVII (Spring 1979), p. 188. ' Ibid., p. 188. ~ Henri J. M. Nouwen, The Living Reminder (New York: Seabury Press, 1977), p. 24. 3411 / Review for Religious, Volume 39, 1980/3 common values. Let us explore this a little more deeply. According to Johannes Metz: Poverty as an evangelical virtue is a protest against the tyranny of having, of possessing and of pure self-assertion. It impels those practicing it into practical solidarity with those poor whose poverty is not a matter of virtue, bui is their condition of life and the situa-tion exacted of them by society.6 Actually, many middle-class people are impelled into practical solidarity with the poor by old age. Living on a fixed income in our inflation-ridden society does not allow some elderly people even modest comforts. For these, poverty is a new experience which can either be creative or devastating. It is creative for those who, during the course of their lives, have realized that the quality of a person's life is not determined by possessions or achievements. On the other hand, if a person's life has been completely caught up in amassing more money and possessions, the poverty that old age brings will be devastating. Those who deal with their new poverty in a creative way have much to say to those of us who accept poverty willingly. These people demonstrate how poverty can open the heart to surprise, wonder and delight in the simple things of life. Consider, eighty-nine-year-old Bernie whose eyes sparkled as she showed me a jar of grape jelly, the gift of her granddaughter. The jar of jelly represented much more than a welcome addition to her diet; it told her that she was loved and remembered. To Bernie, it was a confirmation of the goodness of people, and ultimately, the goodness of God. Faced with this sincere gratitude for such a little thing, I find myself becoming more'and more aware of the many gifts I have been given. Material possessions fade in mean-ing next to such gifts as good health, friends, and joy in living. It is with people such as Bernie that we religious can grow "to recognize, even celebrate, a deeper truth-- that no one ever earns his way, that life's meaning is more a gift than a reward.'" However, while appre~:iating the qualities such as gratitude which the elderly manifest, we must not lose sight of the poverty in which' they are rooted. This poverty is real. It is the kind of poverty that makes three meals a day a luxury and has the elderly counting out their last bit of change in the supermarket. It is the kind of poverty that keeps the house cold all winter long because utility costs are skyrocketing. It is the kind of poverty that isolates because traveling is impossible and a telephone is beyond their means. In short, it is the kind of poverty that invades one's very being; If we allow ourselves to see poor people like these, to meet them and to be touched by them, 1 believe that we religious will be challenged. What the outcome will be in terms of living out poverty will be up to each of us. But the elderly will have ministered to us, repeating the words of Christ: "There is one thing more you must do. Go and sell what you have and give to the poor; yow will have 6 Johannes B. Metz, Followers of Christ (New York: Paulist Press, 1978), p. 49. ' Whitehead, op. cir., p. 45. ~ Towards Mutuality in Ministry treasure in heaven. After that, come and follow me.''8 Metz goes on to define celibacy:. . celibacy as an evangelical virtue is the expression of an insatiable longing for the day of the Lord. it impels toward solidarity with those unmarried people whosecelibacy (that is to say loneliness; that is to say not having anyone) is not a virtue but their social destiny, and towards those who are shut up in lack of expectation and in resignation.9 ~' Along with poverty, old age often brings a new form of loneliness. Distance from family and friends becomes a foe too formidable for the decreasing energy of the elderly to overcome. Opportunities for making new friends are often more severely limited than before. Ultimately, death itself provides the final separation. With the realization that much more of one's life lies in the past than in the future, loneliness can assume new proportions. Only when they are older do some ~people seem to realize how lonely their lives have been. John, a single adult of seventy-six, admits that now he is fascinated by children. He loves to be with them, to talk with them, to play with them, to watch them. He claims that in his younger days I~e never reflected on what it would mean to "live on" through children. Now, he sees this as a definite lack in his life, a choice that he drifted into rather than con-sciously made. Loneliness has made him a~are of his lack of responsibility for his life and he regrets what might have been. However, his new awareness of the fact that life is meant to be lived with and for others has led him into caring for his older sister who is handicapped. Thus, loneliness for John, has led not to resignation but to service. Our loneliness which results from our celibate way of life can lead to ser-vice also. However, this is different from using ministry to neutralize one's loneliness. Just as John has moved from the experience of loneliness to that of being with and for another, so too, must we religious come in touch with our loneliness in order that we may capture its implications for service. For some people, the lonelines~ of old age is a new experience, one which can make them more vulnerable. Consider eighty-nine year old Bill who, in the nice weather, spends most of his time enjoying the warmth of the sun in front of his house. One day he was approached by a well-dressed man who claimed to be a friend of his son. After some pleasant conversation, Bill in- ViCed him into his home where the man proceeded to rob him. Bill's hurt and outr,age stemmed not so much from the loss of mbney but from the fact that "he came as a friend, but in reality was a crook." Yet, Bill was willing to risk again. He opened his door to me, another stranger, and invited me to share a part of his life. For him, loneliness helped to keep alive the hope that relation-ships are possible. This willingness to risk is an important quality for us religious to cultivate. What is the point oi" celibacy if we surround ourselves with people who protect us from meeting strangers? Our celibacy demands that we also be open to Mark 10:21. Metz, op. cir., p, 60. ~150 / Review for Religious, Volume 39, 1980/3 others in ways that manifest the hope that relationships are possible. Such openness calls for risks, and the elderly who often have been separated from their life-long companions can show us how to take such risks. The loneliness of the elderly, which is accentuated by a new awareness of death, can lead them to greater depths of faith and hope. If the, lives of the elderly tell us that relationships with people are possible, so too do they announce the reality 6f ~ relationship with God. Moreover, this relation.ship with God is not merely limited to the present, but has eternal dimensions as well. The elderly 1 have come in contact with have revealed a variety of ways of relating to the Lord in prayer. For some, recitation of formal prayers like the rosary is very comforting. Others have discovered fgrms of contemplative prayer. One woman, unable to leave her home, said tl~at at first she missed attending church, but then came to the conviction that the whole worldis a cathedral and that God is truly present everywhere. She looks forward to experiencing this presence in a new way after death. For me, her faith~an~d hope serve as a reminder of Jesus' words: "I am the resurrection. If, anyone believes in me, even though he dies he will live, and whoever lives and believes in me will never die.'''° It is in union with people such as these that our "longing for the day of the Lord" takes on corporate dimensions. It is in union with people such as these that we religious can break out of our own "lack of expectation and resigna'- tion." It is in union with people such as these that we religious can penetrate into the true meaning and value of our celibacy. Finally, Metz defines the ex~angelical virtue of obedience as: the radical and uncalculated surrender of one's life to God the Father who raises up and liberates. It impels one to stand close to those for whom obedience is not a matter of virtue, but the sign of oppression and of being placed in tutelage, and to do this in a prac-tical way.'t Growing older changes relationships, and often the elderly find themselves the victimsof oppression. A well-meaning son or daughter becomes convinced that the aged parent cannot live alone, and forces a move either to a relative's home or to a nursing home. An irate landlord, angered by the low rent an elderly person pays, refuses to make needed repairs. Doctors who refuse to make house calls make more frequent hospital stays necessary. The violent who prey uppn frail older persons can turn a routine trip to the bank in.:io a traumatic experience, and cause a person to live locked at home in fear. It is much the way Jesus put it to Peter: "When you were young you put on your own beet and walked where you liked; but when you grow old you will stretch out your hands, and somebody else will put a belt around you and take you where you would rather not go.'''2 Recently, I received a phone call from a woman whose children and grand- John I 1:25-26. Metz, op. cit., p. 67. John 21:18. Towards Mutuality in Ministry / 351 children were trying to move her to another state to be with them. "Please, please save me from their clutches." Her cry touched me deeply. Several days later I visited her. The pain of moving, the pain of leaving what had been home for forty-five years, the pain of separating from friends and neighbors, the pain of uncertainty about the future, were all still .there. However, something else was there, too. "They want me to move because they love me, and so I am going," she told me. Love was able to penetrate through her pain and make surrender a positive action. It is from this woman that 1 have learned much about "letting go," a characteristic so necessary for obedience. This attitude does not act as a sedativ~ for the pain that can result from having our desires and plans thwarted. It is not a withdrawal from life, a giving up because we cannot have what we want. Rather, it involves an active acceptance of what is, embracing the pain along with the joy. "Letting go" calls for seeing things in true perspective without the warping that our own fears and prejudices can bring to a situation. When we cannot let go of something it is usually because we wish that it were other than it is. We hold on to a relationship after its vitality is gone, wishing that it could return to its former intimacy. We insist on our way of ministering to others, wishing that their needs matched our own gifts a little more closely. We hold on to our anger and hurts, savoring them, but wishing that we were not so fragile and vulnerable. And yet, the wishing changes nothing. Our former friend moves out of our life. The ways in which we are asked to serve are often not what we would choose. We remain vulnerable people. It is in the difficulties that We experience in "letting go" that we religious are most closely united to those subject to oppression. Neither situation is easily remedied; both requi~e struggle. Yet the struggle itself is not sufficient to achieve liberation. This remains the gift of God. "If the Son makes you free you will be free indeed.'''~ And so, while we continue to struggle, we learn from others that the love which makes surrender possible is available to us. The elderly can teach us that liberation is a real possibility. In conclusion, as I have~ been ministering to the elderly, they in turn have ministered to me in a variety of ways. They have helped to bring about a new awareness and sensitivity in my ministry. I have become more conscious of the mutuality, in relationships, more apprec~ia~ive of the role of others in my life. "Giver" and "receiver" no longer seem like isolated, opposed ways of being. In fact, I understand to a greater degree how "it is in giving that we receive." This understanding helps me to approach others with more'humility and respect. No matter in what ways I minister to others, I am aware that they also are ministering to me. Mutuality in ministerial relationships offers oppor-tunities for growth that few of us, if any, can afford to pass by. John 8:36. Come and See: The "Cottage Program" M. Basil Pennington, O.C.S.O. Father Pennington's last article, "The Vocation of the 'Vocation Father,' "appeared in the May, 1979 issue. He continues to be "Vocation Father" at St. Joseph's Abbey; Spencer, MA 01562. The "Cottage Program" is an instrument of our cooperation in the mystery of the genesis of a vocation that I wanted to share with you through these pages. In our times, as it had been in the eleventh or in the fourth century, or in the time of Christ himself, serious-minded young men and women seek a teacher, a guide, a master-- someone who could give a fuller meaning to their lives. Andrew and John had traveled south, taking time off from their work. They had heard tell of a teacher, a prophetic man of God, on the banks of the Jordan, and joined the stream of seekers heading in that direction. They listened, they learned, they understood--perhaps more deeply than most, because, when the teacher pointed to another, they followed him. And he asked them: "What do you seek?" Ultimately,. that is the question the Lord addresses to each one of us. And the answer we give is the most significant decision of our lives, the decision that, consciously or unconsciously, decides all else that we do. If we listen to the deepest ye~arning of our hearts, we, too, will respond, "Master, where do you dwell?" Master!. Yes. Be our master, our teacher, our guide, and let us abide with you, wherever that may be for us. And he replies, "Come and see!" It is when we experience this presence of God, speaking to our deepest hearts, that we know we have found our Master, our Way, our Life. Some years ago I was in Rome taking part in a vocation conference sponsored by the Sacred Congregation for Religious. There were brothers and 352 Come and See: The "'Cottage Program" / 353 sisters, priests and lay religious from many nations taking part in the conference. One of the modern features of this conference was that each par-ticipant was :free to speak in his or her own language. One evening in the course of the program we had a question box. Archbishop Paul Philippe, the Secretary of the Congregation, was presiding, reading out the questions found in the box, and inviting answers from the floor. "Now, here is an interesting question," he said. "How do you get across to a young person the idea of the contemplative life?" A little priest from Brazil, a Salesian with an Irish name like McHale, jumped up. In rapid-fire Portuguese he explained that the only way one can convey to a person the nature and meaning of the contemplative life is to bring him or her into con-tact with it, and let him or her discover its meaning, l think Father was right. And I believe that is equally true of any way of religious life or anylife of a transcendent nature. "Come and see." That is the thinking behind theCottage Progr.am. There is on the property of St. Joseph's Abbey (near Spencer, Massachusetts) a small stone house with six rooms in all. It was built in the 1920's, hut the lodge-like living room boasts beams over two-hundred years old, taken from a barn that stood in the days of Ethan ~llen, the onetime owner of the property. The kitchen and dining-room have been converted into bedrooms. The garage is now a chapel, dedicated to St. John the Baptist, the 'first vocation director. In an icon over the altar he points to Christ in the tabernacle. Standing in the shadow of the recently built abbey, the cottage offers young men interested in monastic life the opportunity to "come and see." It is usually full, and at times more than full ("full" means five men, but the rooms can accommodate two, and there is also the attic. There is always room for one more!). Those staying at the cottage follow very much the same schedule as the monks. They' form a little community of their own, so they won't feel strange or lost in the large monastic community, but they do join the monks for the Office, the Eucharist and work. The men are welcome to come for a day, a weekend, a week, or sometimes even 'longer-- whatever seems good for them. They are encouraged to think of the cottage as their home--a sort of spiritual home base. They may come whenever they wish. To date, no one has abused this open hospitality. The first visit is usually preceded by some reading about life .in the monastery. Each evening the candidates (or "cottagers," as they are sometimes called) gather around the great stone hearth for a colloquium or a conference with the Vocation Father, where they can learn of the wisdom and ways of the monks and have their questions answered. In the course of his visit, each young man is given practical instructions on how to do spiritual or faith reading and how to meditate. If he already has a method of meditation which has proved fruitful for him, he is encouraged to continue in it. If it is one learned from an Eastern master, he is helped to see how to place it in a Christian framework so as to open it to the Spirit, to faith, 354 / Review for Religious, Volume 39, 1980/3 and to love, so that it can truly be prayer. Before he leaves, the candidate is asked to formulate his own rule of life and to go over it with the Vocation Father. Our method for this is simple: After reflecting prayerfully on l Corin-thians 2, the candidate takes four sheets of paper. On the first; he tries to ex-press as succintly as he can the present goals of his life as he sees them. On the second, he lists as fully as possible the things he has to do to attain these goals. On the third, he lists the things he sees have been preventing him from moving toward his objectives. And, finally, on the fourth, he formulates a daily pro-gram for himself, and also a weekly and monthly schedt~ie of particulai: events.* This gives the candidate a concrete, practical support for bringing into his everyday life something of what he has learned and experienced as he shared the monks' life accordin.g to their Rule. Such an experience helps the young man to recognize and foster' the grace of vocation he is receiving. In some chses, it may be a long time before an individual can enter the monastic community. The qottage, though, already gives him a sense that in some way he already belongs, that he has his place in the monastery and a'spiritual father who cares for him. In some cases, the cottage experience puts the young man in touch with the contemplative dimen-sion of his life and shows him how to develop it, even as he moves on to some other vocation. It is not as easy for active religious communities to provide a Cottage Program as it is for monastic communities whose life is centered in a stable fashion in one place. But it is not impossible, and I think it can be, in some way or form, very useful. Let me suggest what I think could be an ideal form for an active religious institute. Obviously, the ideal always has to be adapted as it finds its ieal incarnations. It has been my experience over the years that there are a significant number of active religious who feel the call to a more contemplative form of life, either on a temporary or a permanent basis. It seems sad that they must, in most cases, think of going outside their own communities to realize this. :Far better would it be I think, if, ea~:h province or congregation had its own contem-plative house or house of prayer. Here a core group of members, committed for varying periods of time, could live the spiritual dimension of the particular charism of the community in a fuller way, and devote time.to a deeper study of the institute's proper ~:harism. It would be a place where the other members of the community could come, for days of recollection or longer retreats, to get more deeply in touch with their shared charism, their own deepest spirit. Such a house of prayer or contemplative center would, of cours~e, form a very precious and enriching adjunct for the novitiate and house of formation. It could also greatly encourage and inspire the retirement community as the seni6r members live out their life commitment in a more c0nte.mplative way. Here, though, I am thinking of such a house as a context within which the o *For a fuller treatment of this method, see°the Epilogue of my book, Daily We Touch Hhn. Come and See: The "'Cottage Program'" / 355 vocation father or mother could offer the ministry of hospitality. The aspirants would be able to perceive in the core group,a good expression of the spiritual and communal aspects of the life of that community. It is precisely an attraction to these aspects that often leads ~ oung men and women to explore the possibility of living out their commitment to Christ and his Body in a religious community. There would always be a group of professed religiou~ there with whom the candidates could pray and work. These would normally be members more reflectively conscious of the charism of their community, of their own participation in the grace of the founder. And so they would be able to help the aspirants to identify the grace stirring in their own hearts. Such an arrangement-- a vocation program within the context of a house of prayer or contemplative center--will not always be possible, or even desirable in some cases. Another alternative for a Cottage Program would be the house of formation or novitiate, if the vocation father or mother could find a bit of space there; a few rooms, for the candidates and themselves, and a common room are enough. The formation team could be the "stable com-munity" providing the lived experience for the aspirants. And these young men or women could readily identify with the young people in the formation or novitiate program. Whatever the arrangements, the ingredients that seem to contribute to the makimal success of such a program are:" 1. The presence of a professed community which obviously lives the spiritual aspects of the vocation., though thi~ does not exclude involvement in active .apostolates. 2. Access to the younger members of the community who have recently embarked on this life and with whom the candidates can easily identify. 3. A vocation father/mother willing and able to function as a spiritual father/mother, to instruct in the spiritual arts, to pray with the candidates, and to pray for them. 4. Practical instruction in spiritual reading, meditation (we usually use Centering Prayer), and the art of receiving spiritual guidance. Merton's little book, Spiritual Direction and MeditatiOn, published by Liturgical Press, Collegeville, Minnesota, is good for this. 5. A rule of life. 6. An open and welcoming hospitality. We have found that frequently candidates tell others of their experience at the cottage and are eager to have them share ira this program. This has added to the almost geometric increase of caffdidates we have experienced since we have inauguratedthe Cottage Program. There are many other programs underway~in different religious orders and congregations, which include~ one or othi~r of the aspects of the Cottage Program. I do not propose this program as the only way or the best way, but simply share it as one way, a way that has worked very well for us. I believe it 356 / Review for Religious, Volume 39, 1980/3 has been not only successful in fostering vocations for our own community (we have seventeen in the novitiate at the moment), butin making a contribu-tion to other religious communities, and to the Church at large. This year more than three hundred fifty have stayed at the cottage. All have found it a beneficial experience. Each learned at least a little more~ about prayer; about community, about Christ our Lord and his great love for each one of us. Such fruit makes a Cottage Program more than worthwhile. Now Available As A Reprint Celibate Genitality by William F. Kra[t Price: $.50 per copy, plus postage. " Address: Review for Religious Am 428 3601 Llndell Blvd. St. Louis, Missouri 63108 Vocations: Identity and Commitment M. Marceiline Falk, C.PP.S. Sister Marcelline teaches at Bishop DuBourg High School; 5850 Eichelberger; St. Louis, MO 63109. Clearly we are living in times of crises. There are financial and political crises that make the front pages of our daily papers and evening newscasts. But there is another crisis, one that is becoming, or should be, of great interest and concern to those who love the Church of.Christ: that is the crisis of voca-tions to women's religious communities. " For centuries women religious, by their consecrated lives and devoted labors have fulfilled an important mission in the Church. Will they be able to continue that mission? Only if they are able to maintain their membership in sufficient numbers to continue in existence and so perform the apostolic ser-vices that the Church has entrusted to them. The severe drop in the number of vocations to women's religious com-munities is well-known. It is interesting to observe that both the sudden drop in religious vocations and the massive exodus of religious women engaged in active apostolates occurred at the same time that many communities were discarding religious habits, leaving earlier apostolates for other forms of ser-vice, and adopting life-styles more nearly !ike those of their secular counter-parts. Is there a causal relationship or at least a significant correlation between these concurrent phenomena? Are commitment to a specific apostolate and a readily perceived identity important factors in the viability of religious com-munities, as they are in other groups and organizations? Does a distin-guishable garb help to build an identity, promote a visibility which encourages vocations, make known that a religious woman is somehow different? Does a specific apostolic commitment attract the generosity of young women? Are 357 358 / Review for Religious, Volume 39, 1980/3 external life-style practices related to the number of vocations that a religious community can expect? If the answer to these questions is "Yes" then perhaps this will be instructive in our efforts to reverse the trend of too few vocations. In an attempt to find answers to the above questions, to ascertain the percentage of youthful members' in communities, and to establish a possible correlation between youthful membership and some readily observable life-style characteristics, 1 conducted a survey during the spring and summer of 1978. The results of this survey indicate that, indeed, the answer to these ques-tions is in the affirmative~ The results clearly show that religious communities which have kept a readily identifiable religious habit, however modified, and which engage in well-defined community apostolates do have more vocations. Many have adopted modified habits, but they are still readily identifiable as religious women~ Further, the term, "a definite community apostolate," need not preclude other works of charity being undertaken by the community in response to real need, when the work is not contrary to the spirit of the com-munity, and does not detract from the primary apostolate. The following questionnaire was sent only to major superiors of 300 active religious communities.2 The names were selected in a random manner from approximately 800 listed in the 1975 Catholic Directory. Responses were received from 223 or 74°70 of the sample. Of these, two were incomplete. The questionnaire used follows: Survey on Religious Life-style Practices A. 1. Nameofcongregation (or province) 2. Number of final professed sisters " 3. N~mber of sisters in temporary commitment 4. Number of novices of postulants 5. Number of other types of formation (pleasespecify) B. Policy of Congregation in regard to the following: 1. Is there a (superior, coordinator, Yes.____, No___. 2. 3. 4. .) in charge in each local house? Is this person elected , appointed ., other Other types of local government Are personnel appointments made a) __ by direct appointment.'?, ~. b) __ by choice of individual? c) __ by assignmer~t after consultation with the sister d) __ other (specify) Does your congregation have a definite commitment to a specific apostolate in the Church? Yes , No ? What is/are the principal apostolate(s) your sisters serve? Does your congregation have an official, d~stmctive habit? Yes " , No~__. ' Youthful membership includes sisters in temporary profession or promises and novices. Total membership includes final professed, temporary professed and novices. 2 Very small communities and contemplative communities were not included. Vocations: Identity and Commitment / 359 8. Does your congregation permit the use of secular dress? Yes~, No__. a) At the sister's own discretion? b) With thepermission of the major superior? c) Other (please specify) 9: Do the sisters have the use of a personal bridget? Yes~, No~. a) Is there a fixed amount? b) For what purpose may this budget be used? The questions in Part A we~:e used to provide information about the number of religious, and to determine the percentage of youthful membership in the congregations surveyed. The percentage of youthful membership can be used as an indicator of viability or numerical stability. Data from questions in l~art A were analyzed, and results are given in the following table. Com-munities were divided into nine groups, according to the percent of youthful members: Table I Group 07o Youthful Members No. of Communities % of Total Sample I Over 10% 18 8.1 o10 11 9.9-6.00/o 19 8.6°1o 111 5.9-4.507o ' 23 10.4070 IV 4.4-3.5070. " 28 12.6070 V 3.4,2.0070 29 13.1 070 VI 2.4-2.0% 29 13.107o VII 1.9-1.5°/0 23 10.40/o VIII 1.4-1.00/o 27 12.2% IX Less than 1 070 25 I 1.3% Let us assume that an average of about 10%0 of young members will allow a religious institute to maintain its membership,3 and that about five years elapse between entrance into the novitiate and final profession. This would mean that an average yearly entrance rate of about 2% would be required to maintain a numerically stable community.' If we accept this percentage of new members as necessary for the maintenance of numerical stability in the community, it takes into account an expected loss of 2% due to death or departures. Communities, then, which can categorize 10% of their population as "young," and which also have an influx of new members at the rate of 2% per year, would have a numerically stable, or even increasing membership. If a community can only describe 5% of its membership as young, this would indicate that it has been receiving new members at a rate of about 1%. A youthful population of 2% would suggest admissions at the rate of 0.4% annually. In each of these instances, given the typical 2% proportion of change due to death and departure, losses to the total membership would be statistically predictable: 1% and 1.6% respectively. The same predictability ' "Religious in the World (Statistics up to Dec. 31, 1974)," Consecrated Life I, No. 1 (1977). ' For example, a community of 500 would need an average of ten new members per year to main-tain a stable membership. 360 / Review for Religious, l/olume 39, 1980/3 would pertain to each of the nine categories of communities in our sampling. On the basis of these calculations, Group I would be expe.cted to maintain or increase its total membership. Communities in Groups II find IlI could be expected to have progressively slightly reduced membership. If the present trend continues for groups IV, V, and VI, their membership would probably be halved in three to five decades, while those in Groups VII, VII1 and IX might well cease to exist in about three decades. Obviously these calculations are premised on present trends. Factors, however, coulffchange in the future, and this could retard the fulfillment of these predictions-- or accelerate them. Part B of the questionnaire is concerned with som~ external, behavioral characteristics. The characteristics chosen are different from those usually associated with ~ecular life-styles, and traditionally have been common characteristics among active communities of religious women. Numbers one and two have to do with community governance. Numbers three through six are concerned with apostolate and personnel assignment. Numbers seven and eight deal with the matter of religious habit, and nine, with the question of personal budget. In each of thes~ areas, change became evident after the Second Vatican Council. One of the purposes of the survey was to explore the possibility that these changes had an influence on the incidence of vocations to the respective communities. To this end, the number and percentages of communities which evidenced a particular characteristic were tabulated, and compared against the percent-age of young members each community enjoyed. My fullest hopes in pursuing this investigation were not realized. Nothing could be concluded about postulants, or persons in other types of formation. Responses to questions 2 and 3B, concerning local governance, proved ambiguous, and indications concerning amounts and usages in the matter of personal budgets were too varied to admit of interpretation. Therefore, for purposes of our study, only Part A and questions 1, 4, 7, 8 and 9 of Part B proved useful for our analysis. In the tables which follow, the responses to the various items are grouped on the basis of .the proportion of youthful me.rnbers, i.e., on the basis of how those communities have succeeded in draw-ing new members to join them. Table 2 Percent of Communities With a Person in Charge at the Local Level Number in Group % of Group 10070 15 out of 18 83.3%0 9.9-6.007° 16 out of 19 84:2°/0 5.9-4.5070 18 out of 23 78.3070 4.4-3.5070 20 out of 28 71.4%0 3.4-2.5% 17 out of 29 58.4% 2.4-2.0% 18 out of 29 62.1% 1.9-1.5o/0 17 out of 23 73.9°70 1.4-1.0% 15 out of 27 55.6% Less than I% 21 out of 25 84.0% :Vocation~: Identity and Commitment / 361 Table 3 Percent of Communities with Personnel Placement After Consultation Number in Group °/o of Group 10% 16 out of 18 88.9% 9.9-&0%o 16 out of 19 84.2070 5.9-4.5°7o 17 out of 23 73.9°/o 4.4-3.5¢/0 24 out of 28 85.7%0 3:4-2.5%0 18 out of 29 62.1°/0 2.4-2.0%o 24 out of 29 82.8% 1.9-1.5%0 14 out of 23 60.9% 1.4-1.0% 20 outof 27 70.1% Less than 1% 20 out of 25 80.0% Table 4 Percent of Communities With Specific Community Apostolic Service Number in Group a/o of Group 10% 15 out of 18 83.3% 9.9-6.0% 16 out of 19 84.2% 5.9-4.5% 19 out of 23 82.6% 4.4-3.5% 23 out of 28 82. 1% 3.4-2.5% i4 out of 29 48.3% 2.4-2.0% 15 out of 29 51.7% 1.9-1.5% 14 out of 23 60.9% 1.4-1.0% 12 out of 27 44.4% Less than 1% 12 out of 25 48.0% Table 5 Percent of Communities with a Distinctive Habit Number in Group °/o of Group 10% 16 out of 18 88.9% 9.9-6.0% 15 out of 19 80~0% 5.9-4.5% 13 OUt of 23 56.5% 4.4-3.5% 23 out of 28 82.1% 3.4-2.5% 14 out of 29 48.3% 2.4-2.0% 14 out of 29 48.3% 1.9-1.5% 11 out of 23 47.8% 1.4-1.0% 8 out of 27 29.6% 1.0% 13 out of 25 52.0% Table 6 Percent of Communities Permitting Secular Dress at Sister's own Discretion Number in Group ~o of Group 10% 2 out of 18 I1.1% 9.9-6.0% 4 out of 19 21.0% 5.9-4.5%0 6 out of 23 26.1% 4.4-3.5% 9 out of 28 32.1% 3.4-2.5% 15 out of 29 51.7% 2.4-2.0% 17 out of 29 58.6% 1.9-1.5% 15 out of 23 65.2% 1.4-1.0% 19 out of 27 70.4% 1.0% 17 out of 25 68.0% 362 / Review for Religious, 'Volume 39, 1980/3 Table 7 Percent of Communities Using a Personal Budget Number in Group % of Group 10% 5 out of 18 27.8%0 9.9-6.0% 10 out of 19 52.6%o 5.9-4.5% 16 out of 23 69.6%0 4.4-3.5%o 22 out of 28 78.6%0 3.4-2.5% 27 outof 29 93.1% 2.4-2.0% 28 out of 29 96.6% 1.9-1.5% 20out of 23 ¯ 87.0% 1.4-1.0% 26 out of 27 96.3% 1.0% 25 out of 25 100.0% These tables indicate that the characteristics of a specific community apostolate and a distinctive habit do have a strong influence on the number of youthful members, and therefore, on the number of vocations to a com-munity. To test the degree of relationship between the given characteristic and the percent of youthful membership, a statistical analysis of the data given in the previous tables was made. The usual instruments of the Spearmann cor-relation coefficients and significance tests were used to demonstrate statistical correlation between the percentage of youthful members and .the various characteristics with the following results,~ The correlation between youthful membership and the characteristic of having "a person in charge at the local level" did not show any 'appreciable significance. The correlation was 38.33.07o with a corresponding significance of ¯ 154. This is evident from the data, which do not show much variation. Most communities reported a person in charge. Answers to the questionnaire on this point were frequently qualified by such statements as: "Yes, but not in smaller houses," or: "No, except in the larger houses." The correlation between youthful membership and the use of a personal budget is even less, at -31.67070, having a significance of .203. The negative correlation indicates that there is some slight decrease in the use of the budget as the percentage of youthful members increases. Again, although most com-munities indicated the use of a personal budget, the amount and kinds of restrictions on its use varied from very small amounts for the purchase of small, personal items to large amounts with practically unrestricted use. It was interesting to note that the use of th.e personal budget was least evident among communities which did not permit secular dress. Personnel placement after consultation with sisters shows a somewhat higher correlation, of 60.0°70, and a significance of .044. Possibly there is a ~ Spearmann correlation percentages, based on O- 100%, measure the tendency of two variable~ to vary ~together, that is to show a relationship to each other. Significance tests decide whether dif-ferences between values obtained from the samples and theoretical expeclations could be due to chance. A low significance factor indicates that the relationship studied could not be due to chance. Vocations: Identity and Commitment / 363 relationship between community apostolate and the placement of personnel in areas of community commitment. Of significance is the very high correlation between the number of young members and the existence of a specific community apostolate (90.0°7o and a significance of .001). This strongly suggests that a community commitment to a specific service in the Church has a strong influence on vocations. Such apostolic services were not necessarily limited to only one area of the apostolate. Many communities, in fact, indicated a wide range of apostolic services. But they were community apostolates, and not left to individual choice. A distinctive religious habit is also a significant factor in the number of youthful religious in a community. In this case, the correlation percent is 77.8070, with a significance factor of .007. The most highly significant correlation was the inverse ratio between the number of youthful members and the use of secular clothes at the sister's own discretion. Here a-98.33070 correlation coefficient, and a significance of .001 clearly indicate the negative influence of this characteristic on vocations.6 Ap-parently commun~ities having an open option for secular clothes fail to attract many young women. The characteristics analyzed in this study cannot be the only ones which in-fluence the number of vocations, and so affect the numerical stability of a religious community. Neither are they necessarily a measure of the internal fervor, or of the importance of a particular community's contribution to the Church and the People of God. Other aspects, such as the quality ofcom-munity prayer life, the kind of apostolate, the geographic location,ethnic origin, time of founding--as well as many other intangibles, such as com-munity spirit, understanding of the vows, and other internal characteris-tics- will certainly also have an effect on the overall picture. However, the statistical analysis of the data obtained in the questionnaire does clearly indicate that, generally, communities with a specific and well-defined apostolate, and those which retain the visible sign of the habit do have a significantly greater number of young members. Apparently these two fac- . tors do, in large measure, provide the initial visibility, the instant recognition of "Who We Are," and "What We Do" that are capable of drawing new members to the communities that possess them. 6 The negative percent means that the use of secular dress has a strong adverse effect on religious vocations. 364 / Review for Religious, Volume 39, 1980/3 Since these characteristics, a reasonably specific apostolic service and a distinctive habit (or nonuse of secular clothes) does seem to show such a high significance, it might be interesting to apply the conclusions to a real community. I made an analysis of membership trends for one particular community. This community changed its apostolic thrust from education to an open-ended .apostolate, according to which its present policy is to permit new members to choose their own apostolic field of service. The use of secular dress was also left to the discretion of each sister. A comparison of the membership of this community between the years 1961 and 1978 shows the following:' Table 8 1961 1978 Nurfiber of Final Professed 513 458 Number in Temporary Vows 47 1 I Novices 48 3 Total Membership 608 472 In 1961, the youthful membership (novices and "juniors") was 95, or 15.6% of the total. In 1978, these numbered only 14, or 3% of the total membership. This represents a net los's of 136 sisters during this seventeen year period, a 22% loss. During this same period, 94 sisters died, and there were 80 new admissions. There were also over 100 departures. The major loss due to departures and a decline in admissions began in 1968, when the policies of individual choice of apostolic service and the use of secular dress became effective. At this time, a new formation program was introduced, placing a strong emphasis on self-fulfillment and promoting individual choice of apostolic service and of the mode of dressing. The median age in 1961 was about forty-eight years. In 1978, it had risen to about 63 years. In 1961, about half the community was professed less than twenty-five years. By 1978, half the community was professed for forty or more years. During the last ten years, since the new policies of self-choice in apostolic service and the use of secular dress went into effect, only fourteen sisters made first profession. Surely this would indicate that the rise in median age is rather due to a lack of new vocations, and of departures, than to a ¯ general rise in the median age of the population at large. Further, it is clear that the median age of this particular community is much too high for com-placency about the future. The following table shows the shift which took place in the median age of this community: ' The year 1961 was chosen as starting date because it was the last year before Vatican ll; 1978 is the latest date for which statistics were available. Vocations." Identity and Commitment / 365 Table 9 1961 1978 Number of Years Number of % Number of % of Professed Sisters Total Sisters Total More than 53 18 3.0 61 13.0 48-52 22 3.6 44 9.3 43-47 30 4.9 65 13.8 38-42 40 6.6 79 16.7 33-37 55 9.0 42 8.9 28-32 65 10.7 32 6.7 23-27 78 12.8 37 7.8 18-22 65 10.7 32 6.7 13-17 39 6.4 40 8.5 8-12 48 7.9 15 3.1 4- 7 54 8.9 8 1.7 3 or less (Including Novices) 95 15.0 14 3.0'- Prognostications from this table make it clear that if the trends continue, and are not somehow reversed, it will become increasingly difficult for this particular community to continue its service to the Church, that, indeed, it faces a struggle for survival in the not too distant future. The. decrease in religious vocations is a grave concern for the whole Church, as the following statement of Paul VI in an address to religious women indicates: ~ In truth, here again we have to" make a double observation that is not a happy one. Religious vocations, for women, too, are falling off; yet both the Church and secular society have a gro.wing need for these vocations. This is one of th~ problems of our time, for whose solution we must work and pray? The importance of identity and apostolic commitment in fostering voca-tions is stressed by Cardinal Pironio, Prefect of the Sacred Congregation for' Religious and Secular Institutes: In a serious study of consecrated life--particularly in evaluating certain attitudes and concrete activities--there is no doubt that many things would change if we responded with loyalty to this question: "What do Christ, the ecclesial community, and the world in which we live expect of us?" At any rate, there are three aspects in consecrated life which it would be well to emphasize: The Church expects religious to be faithful to their identi-ty, to their essential values, and to their evangelical relevance . Religious are, before all else, Christians, but they are religious in a way that is unmistakably distinct . Religious identity d0es not segregate religious from the rest of the members of the People of God, nor does it remove them from the world; on the contrary, it identifies them and involves them in the world with their own, unmistakable specificity . The loss of identity is one ~ Pope Paul VI, "New Horizons for Women Religious," address given to women religious on the feast of the Nativity of our Lady, 1964, Documents on Renewal for Religious, Daughters of St. Paul, 1974, p. 57. 366 / Review for Religious, Volume 39, 1980/3 of the causes today of the drop in vocations to consecrated life. When an institute's iden-tity disappears, or is jeopardized, it is only logical for young people to lose their en-thusiasm and become disoriented. Being faithful to one's self is therefore to take on a strong commitment with God and with men. it is the essence of our vocation, and of our consecration, and of our mission.~ I The words of our Holy Father, John Paul II, spoken to mothers general on November 16, 1978, just one month after his election, are particularly significant: And if your consecration to God is really such a deep reality, it is not unimportant to bear permanently its exterior sign which a simple and suitable habit constitutes; it is the means to remind yourse!ves constantly of your commitment which contrasts strongly with the spirit of the world; it is a silent, but eloquent testimony that our secularized world needs to find on its way, as many Christians, moreover, desire. 1 ask you to turh this over carefully in your minds. '° This study of external behavioral characteristics as related to vocations is an attempt to contribute to a serious study of possible causes for the evident decline in the number of religious vocations to active communities of women in the United States. While it is true that this is only part of the total picture, it is hoped that a spirit of openness would encourage communities to consider seriously the impact of these external behavior patterns on the perception of what religious life is all about. The interior spirit of a community is of the ut-most importance, but the external manifestation of that spirit of dedication, the willingness to be recognized by a religious habit and the having of a specific apostolic commitment to the service of Christ in the Church and the world is also important. These externals advertise for all to see: "We are religious! We do believe that our.being and our service are essential to our specifically religious witness." 9 Eduardo Cardinal Pironio, "Th~ Joy of Fidelity," Consecrated Life Ill No. ~, 1979. ,o Pope John Paul 11, "Be True Daughters~ of the Church, Not Orily in Words But in Deeds," Strain Forward, Vol. 12, No. 1, January 1979. How About a Semi-Sermon Sometime? M. Eucharista Ward, O.S.F. Sister Eucharista teaches at St. Ladislaus Higl~ School; 2697 Caniff Ave.; Hamtramck, M 148212. It was hard to imagine how God could add to a spiritual nurturing that for ten years had seemed almost the equivalent of hothouse conditi

Issue 20.6 of the Review for Religious, 1961. ; Carl ]. P]ei]er, S.]. REVIEW FOR RELIGIOUS 398 plan of all liturgical worship: 1) the service is begun with a reading; 2) after the reading follows singing; 3) and the service is ended with a prayer. Among the early Christians all prayer services and devotions were carried out accord-ing to this basic plan, and since the third 6r fourth cen-tury this has been the ruling principle of all liturgical services.-" Such a plan is not merely arbitrary, nor is an accidental or aesthetic arrangement of elements. Ac-cording to Father Jungmann: ¯. it is in character with the essential nature of the Christian plan of redemption. Our salvation, typified by the divine word which we receive in the reading, comes from God. It descends from heaven to earth and stirs within the hearts of the faithful the echo of song. Thereupon the prayers and petitions of the Christian community are gathered up and brought back to God on high by the priest. There is something dramatic about this arrangement; through it we actually come to realize what is meant in saying that the liturgy is the public worship of the Church? This structure--reading, song, prayer--is filled out ac-cording to basic themes central to Christian revelation. In the Christian message of salvation and the prayer of the Church, certain themes appear as focal, around which all other truths are centered and from which they receive their meaning.' One of these themes centers on the love and kindness God shows His people. Freely, out of love, He created man; freely and out of even greater love He has worked out man's salvation. Such generous and unmerited good-ness demands a response of love and thanksgiving. Grati-tude is thus ~een as a fundamental attitude of man, and more so of a Catholic: "O give thanks to the Lord, for He is good" (Ps 135:1). It is this scriptural theme of God's love calling forth our grateful response that runs through the proposed Thanksgiving Day "bible vigil." Perhaps a fuller explanation will be helpful. Reading God's plan of salvation is effected and manifested to us by His Word, and according to Scripture this redemptive plan is realized gradually. Somehow man's redemption was to be achieved through Israel, the Lord's chosen peo- -"J. A. Jungmann, s.J., Liturgical Worship (New York: Pustet, 1941), p. 67. Father Jungmann devotes most of this book to a dis-qussion of the basic liturgical groundplan. See also Louis Bouyer, Liturgical Piety (Notre Dame: University of Notre Dame' Press, 1955). ~ Jungmann, op. cit., p. 80. * For a fuller treatment of the structure and themes of Christian revelation see Johannes Hofinger, S.J., The Art o] Teaching Chris-tian Doctrine (Notre Dalne: University of Notre Dame Press, 1957) and Mary Perkins Ryan, Key to the Psalms (Chicago: Fides, 1957). Most useful for constructing "bible vigils" is Reading the Word ol God by Lawrence Dannemiller, S.S. (Baltimore: Helicon, 1960). pie. After centuries of intimate relations with Yahweh, this nation brought forth a:Savior; from this race the Word Himself took flesh. And when in the fulness of time God became man, He suffered, died and rose from the dead that men might die with Him to sin and .rise with Him to forgiveness and grace. His redemptive activity continues on through the centuries in His new people, the Mystical Body of Christ, the Church. Finally, He is to come again bringing the divine plan to its fulfillment in the new and eternal Jerusalem. The .plan itself is one; likewise the revelation of the plan is unified in the unique Word of God. The Old Testament, then, is not just a collection of interesting and sometimes edifying stories, but the gradual manifestation of God's plan for our sal-vation. The God of Abraham, Isaac, and Jacob is also our Father in heaven. He is the one Lord of History, as the Church teaches us in the. liturgy of the Easter Vigil: "O God, we behold your ancient wonders shining even to our own time. For that which the power of your right hand did for one people in freeing them from Egyptian bondage you accomplish now for the salvation of all men by the waters of rebirth." Throughout the Old Testa-ment run basic themes "about God and man's relationship to Him. Although the stories vary,~ the basic relationships do not. Central to the religion o-f the Israelites was the belief that their God, Yahweh, moved by love alone, not-by any merit on their part, had called them, chosen .them out from among the nations, to be .His people_. "You shall be My people, and I will be your~ God" (Ez 36:26). The initiative was wholly on His~part. This call, given initially to Abraham, found its highest expression through Moses in the Exodus, the focal point of Jewish religious history. Their God saved them from slavery, destroyed their pur-suers, and leading them through the desert, formed and purified them into a nation, His chosen people, and fi-nally brought them to the promised.land. The initiative was all His. He perpetuated His call in a covenant with His people, a promise.eternally binding, freely offered out of love. This covenant was prepared for and initiated in the first act of creative love. It became more definitive in the Garden, then with Noah, later with Abraham, and finally with Moses. From then on, it was renewed ritually each yegr by the Hebrew people. Such a covenant renewal ceremony is found, in the book of Nehemiah, 9: 1-55. This then will be the first selection to be read. It is a prayerful remembrance of God's initia-tive in. forming and saving His people, a remembrance of His covenant, His love. After a short period for silent, prayerful reflection on the first reading, a selection from the New Testament is ÷ ÷ ÷ Thanksgiving Da~ Service VOLUME 20, 1961 399 Carl ]. P~ei]er, S.]. REVIEW FOR RELIGIOUS read. It indicates the continuation of God!s plan and its culmination in Christ. In Nehemiah the ritual renewal of the covenant-between Yahweh and His people is re-corded in which' the fundamental beliefs of Israel's reli-gion were proclaimed to the assembled nation. These same ideas are fundamental to our belief, for, as we saw, God's salvific plan continues into our era and culminates in Christ. What went before Christ was not accidental to God's plan, and hence, not accidental to our own reli-gious education and worship. Rather it was a preliminary stage, preparatory to the coming of the great High Priest and His priestly people. In Him all history finds its mean-ing. This is the substance of what is expressed in the second selection, taken from Paul's letter to the Ephe-sians. For what God did for His chosen people through Abra-ham, Moses, and the prophets, He continues now in a more perfect manner for us, the new Israel, through Christ. The Jews wer6 set apart by Yahweh, a chosen nation; we are adopted as His sons, made members of His eternal Son, temples of His Spirit. The Jews He led out of Egyptian slavery; He frees us from the power of Satan. The manna of old is replaced by "bread from heaven," and the vague prophecies of the Old Law have given away to the full revelation of the Word. And in-stead of a promised land "flowing with milk and honey," we look forward to-the eternal banquet, where "eye has not seen, nor ear heard . " Such is the great love of our Father in heaven for us His new people. "He would have all future ages see, in that clemency which he shewed us in Christ Jesus, the surpassing richness of his grace" (Eph 2:8). Song Filled with the realization of the goodness of our Father, of His love for us sinful creatures, we sing out in gratitude, making use of Hig own revealed words, Psalm 135. Joined together in a worshipping community we re-spond to His word, which has just taken vital form through 'its proclamation in our midst. We sing now, the new Israel, an ancient Jewish hymn of thanks. And as it recalls Yahweh'S great deeds for His ~oeople, we make the words our own, singing our thanks for His even more wonderful deeds toward us. Our song of gratitude is rooted in faith, faith in the Word we have just heard. This faith is our response to God's call and covenant; it, is our total, personal commitment to our Father, a total giving of self to God in return for His gifts. As with Abraham and the Israelites, this faith is the fundamental virtue of our Christian life. God calls, elects, chooses. To him whom He chooses, He freely offers His graces, eve~ ! Himself. Our response is faith, belief in what He says, but also belief in Him, personal dedication to Him, flow-ing over into gratitude, confidence and joy? Prayer Our gratitude now takes the form of prayer. We exer-cise our priestly role, proper to us who share the priest-hood of Christ by our baptism and confirmation. And we enumerate with gratitude the gifts of the new covenant. God's plan of salvation, begun in the Jewish nation, cli-maxing in the Incarnation and Redemption of Jesus Christ, continues on to us through the Mystical Christ, the Church. It is only by pertaining to this Body of Christ that the saving action of God reaches us through Christ our Lord. Through membership in the new people of God we are in personal contact with our Redeemer. His word is proclaimed in our midst, His grace is shared with us in our personal encounters with Him in His sacra-ments. Through our union with Him we are enabled to offer our Father a suitable thank-offering, the Mass. And through our ever increasing share in His life we have al-ready a ~beginning of that glory which awaits us with Him in heaven. And all of this, prefigured in Yahweh's rela-tionships with His chosen people, is a completely free gift of our Father. United, then, in one worshipping commu-nity, we offer our thanks to our Father in our united prayer. Finally, after a moment of silent prayer following our vocal prayer, the priest gathers up our grateful expres-sions and offers them to God for us. Christ's mediatorship is continued through His ordained priests. They stand between us and God, not as barriers, but as the normal means by which God comes to us and we reach up to God. Through the priest His Word is proclaimed and finds living reality; through the priest Christ allows us to come directly in contact with Him in the sacraments--a per-sonal encounter between us and our Savior. And through the priest Christ offers our prayers to the Father. Hence the service ends with the priest's prayer as our representa-tive. The particular prayer chosen dates from the year 215 A.D. and was composed by Hippolytus of Rome as a sample that migh~ be used in the first Mass of a newly consecrated bishop. It is one of the earliest extant formu-laries for the Prayer of Thanksgiving, or Eucharistic Prayer, now more commonly called the Canon of the Mass. The text has been somewhat adapted for use in this "bible vigil"; the words of consecration, for example have been omitted, as have other references to sacrifice. What remains is a beautiful prayer of thanksgiving for God's ~ For,a further treatment of faith as a personal response to God, see Jean Mouroux, I Believe (New York: Sheed and Ward, 1959). + 4- 4- Thanksgiving Day Se~vi~e VOLUME 20, 1961 401 Cad 1. Pleiler, SJ. REVIEW FOR RELIGIOUS 402 redemptive work through the llfe, death, and resurrection of His Son, Christ Jesus, our Lord. Such, then, is the suggested biblical-liturgical service. Its structure leads to an appreciation of the meaning and purpose of public worship, while its content manifests an essential theme of Christian life an.d revelation. In 'this case, the theme is suited to Thanksgiving Day, Similar "bible vigils" can be worked out for almost any occasion and allow for much variety within the basic group plan of reading, song, prayer. For example, a homily may be preached after the reading(s). And although the Psalms~. are admirably suited to such services, any hymn that fits the theme may be substituted. The priestly prayers of the Mass (Collect, Secret, Preface, Postcommunion) are a rich source of acceptable prayers, as is the Raccolta. And the service may be concluded with Benediction or some other suitable rite. For example, a service constructed on the theme of Baptism might fittingly be concluded with blessing and sprinkling with holy water. So much for the explanation of the ser.vice. The text follows in full, with hymns added at the beginning: and end to round out the basic structure. If used in full, it should take about twenty minutes; verses of the Psalms may be omitted to reduce the time. ENTRANCE HYMN: [stand] Psalm 22" (All sing the antiphon after the cantor and after each verse): HIS GOODNESS SHALL FOLLOW ME ALWAYS, TO THE END OF MY DAYS. My shepherd is the Lord; there is nothing I shall want. FreSh and green are the pastures where he gives me repose. Near restful waters he leads me, to revive my drooping spirit. [Antiphon] He guides me along the right path; he is true to his name. If I should walk in the valley of darkness no evil would I fear. You are there with your Crook and your staff; with these you give me Comfort. [Antiphon] You have prepared a banquet for me in the sight of my foes. My head you have anointed" with oil; my cup is overflowing. [AntiPhon] OThe text of the three psalms used in the service is taken from Joseph Gelincau, S.J., Twenty-Four Psalms and a Canticle (Toledo: Gregorian Institute of America, 1955) with permission of the pub-lishers~ Surely goodness and kindness shall follow me all the, days of my life. In the Lord's own house shall' I dwell for ever and ever. [An[iphon] To the Father and Son give glory, give glory to the Spirit. To God who is, who was, ,:and who will be forever and ever. [Antiphon] ' ¯ GOD'S GIFTS IN PREPARATION: [sit] Nehemiah 9: 1-15, 32.' ~ '~ ¯ Then, ~n the twenty-fourth day of this same month~ the men of Israel met together, fasting, and with sack-cloth about them, and sprinkled with dust, ~nd the whole breed of Israel severed itself from all contact with alien, folk. :. This was the prayer offered by the Levi.tes . Up, friends, .and bless the Lord, your God, as blessed he musE be from the beginning to the end of timel.,Blessed be thy. glorious name, O Lords that is beyond all blessing, and all praise! Heaven is of thy fashioning, and the heaven o~ heavens, and all the hosts t.hat dw~ell there, earth and sea~, and all that earth and sea hold; to all these thou givest the life they have; none so high in heayen but must pay thee worship. It was thou,-Lord God, that didst make' choice of Abram, and beckon ~him away from Chaldea, from the City of Fire. And now~ thou. wouldst call~ him Abraham; a loyal servant thou. did~st find him, and didst make a covenant with him, promising that his race should inherit the lands of .Chanaanite and Hethite, Amorrhite and Pherezite, Jebusite, and Gergesite. That promise, in thy faithfulness, thou didst make good, Thou hadst an eye for the affliction our fathers suffered in Egypt, an ear for their cry of distress at the Red Sea; the pride~of Pharao and Pharao's court and all his people, had not passed unregarded; there were porte.nts, an£ cnarvels, and thy name won renown, as it has w~on renown this day: Thou didst part ~the,w~ters.at their coming, so that' they crossed the sea dry-shod, didst hurl their pursuers into the depths of it, so that they sank like a stone be-neath the rushing waves. Thou thyself didst lead thy people on their journey, hidden by day in a pillar of cloud, by night in a pillar of fire, to light the path they must tread. There, on mount Sinai, thou didst keep tryst with them; thy voice came from heaven to teach them thy just decrees, thy abiding law with all its observance.s, all its wholesome bidding. There thou didst reveal to them ~ From the Old Testament, volume i, in the translation of Mo~: ~ignor Ronald Knox, Copyright 1948, Sheed and Ward, Inc, New York. , ,, + Thanksgiving Day Service VOLUME'20, 1961 ÷ ÷ ÷" Carl 1. Ptei~er, $.], REVIEW FOR RELIGIOUS 404 how thy sabbath should be kept holy; law and observance and award thou, through Moses, didst hand down to them. When they were hungry, thou didst give them bread from heaven; when they were thirsty, thou didst bring water out of the rock; and for the goal of their journey didst beckon them on to take possession of this same land, which thou hadst sworn .to give them . To thee, then, we turn, who art our God, to thee, the great, the strong, the terrible God, who didst not forget thy covenant, or the mercy thou hast promised. A MOMENT OF SILENT PRAYER [kneel] GOD'S GIFTS IN FULFILLMENT: [sit] Ephesians 1:3-14; 2:4-10.8 Blessed be that God, that Father of our Lord Jesus Christ, who has blessed us, in Christ, with every spiritual blessing, higher than heaven itself. He has chosen us out, in Christ, before the foundation of the wbrld, to be saints, to be blameless in his sight, for love of him; mark-ing us out beforehand (so his will decreed) to be his adopted children through Jes~us Christ. Thus he would manifest the splendor of that ggace by which he has taken us into his favor in the person of his beloved Son. It is in him and through his blood' that we enjoy redemption, the forgiveness of our sins. So rich is God's grace, that has overflowed upon' us in a full stream of wisdom and~ discernment, to make known to us the hidden purpose of his will. It was his loving design, centered in Christ, to give history its fulfillment by resuming everything in him, all that is in heaven, all that is on earth, summed up in him. In him it was our 10t to be called, singleff out before-hand to suit his purpose, (for it is he who is at work every-where, carrying out the designs of his will); we were to manifest his glory, we who were the first to set our hope in Christ; in. him you too were called, when you listened to the preaching of the truth, that gospel which is your salvation. In him you too learned to believe, and had the seal set on your faith by the promised gift of the Holy Spirit; a pledge of the inheritance which is ours, tO re-deem it for us and to bring us into possession of it, and so manifest God's glory . How rich Godis in mercy, with what an excess of love he lok, ed usI Our sins had made dead men of us, and he, in'giving life to Christ, gave life to us too; it is his grace that has saved you; raised us up too, enthroned us too above the heavens, in Christ Jesus. He would have all future ages see, in that clemency which he shewed us in~ Chri'st Jesus, the surpassing richhess of his grace. Yes, it was grace that saved you, with faith for its instrumen.t; it s From the New Testament in the translation of Monsignor Ron-aid Knox, Copyright 1944, Sheed and Ward, Inc., New York. '/ did not come from yourselves, it wa~ God's gift, not from any action of yours, or there would be room for pride. No, we are his design; God has created us'-in Christ Jesus, pledged to 'such good actions as he has prepared befor~- hand, to be the employment of ~3ur lives. OUR GRATEFUL RESPONSE IN SONG: [stand] Psahn 135 (All sing the following refrain after each phrase of the cantor): FOR HIS' GREAT LOVE IS WITHOUT END O give thanks to the, Lord for he is go~d, FOR HIS GREAT LOVE IS WITHOUT END. Give thanks to the God of gods . Give thanks to the Lord ,of lords . Who alone has wrought marveilous works . whose wisdom it was made the skies,. who, spread the earth on :the seas, . It was he that made ~the great lights,. the sun to rule in the day . the moon and the stars in the night,. The first-born of the Egyptians he smote . brought Israel out from their midst . arm outstretched, with power in his hand . He divided the Red Sea in two . made Israel pass through the midst,. flung Pharaoh and his ~orce in the sea,. Through the desert his people he led . Nations in their greatness he struck . Kings in their splendour he slew . He let Israel inherit their land . On his servants their land he bestowed,. He remembered us in our distress . And he snatched us away from our foes,. He gives food to all living things . To the God of heaven give thanks . OUR GRATEFUL RESPONSE IN PRAYER: [kneel] ~lifford Howell, s.J.~ Priest: O Lord God, we thank you. People: ~O LORD GOD, WE THANK YOU. Pr: We thank you *°that our Lord Jesus Christ still lives on in His Church. ~ The text of the people's prayer is qubt¢d with pei'mission of the publisher from the leaflet by Clifford H6well, S.J., You are Christ's Body (St. Louis: Pio Decimo Press, 1949), p. 3. ÷ Thanksgiving DWy Service VOLUME 20, 1961 4o~. 4, 4, + Carl 1. P]eif~r," $.]. REVIEW FOR RELIGIOUS 406 Pe:,.WE THANK YOU * .,THAT THROUGH HIS CHURCH *' HE CONTINUES HIS ACTIV-ITIES AMONG MEN. Pr: We thank You * that when the C[aurch teaches * it is Christ who teaches. Pe: WE THANK YOU * THAT WHEN THE CHURCH SACRIFICES * IT IS CHRIST WHO SACRIFICES. Pri We thank You Christ ~vho doe~ all these things * through the Church, His Mystical Body. Pe: WE THANK YOU * THAT~WE HAVE BEEN MADE MEMBERS * OF THIS MYSTICAL BODY OF CHRIST. Pr: We thank You * that as members of this Body * we can worship You through Christ our Head * in the Holy Sacrifice of the Mass. Pe: WE THANK YOU * THAT WE MAY OBTAIN ALL GRACES * FROM YOUR HOLY SACRA-MENTS. Pr: We thank You * that through Your Church we may attain to Eternal Life. Pe: O LORD GOD, WE THA.NK YOU~ * TO YOU BE PRAISE IN YOUR CHURCH * AND IN JESUS CHRIST * FOR EVER AND EVER. * AMEN. A MOMENT OF SILEN~ T PRAYER. OUR PRAYERFUL RESPONSE OFFERED TO GOD THROUGH THE PRIEST: [stand] Hippolytus oI Rome?° Priest: The Lord be with you. P~eople: AND WITH YOU ALSO. Priest: Lift up your':h~arts. People: WE HAVE. LIFTEI~ THEM UP TO THE LORD. Priest: Let us give thanks to the Lord. People: IT IS RIGHT AND JUST. Priest: We give thanks to You, O God, "through Your be-loved servant, Jesus Christ, whom You have sent dtoe eums eirn a tnhde smee lsassetn tgimere° so fto Y boeu or ucro usanvsieol.r Haned i sre- Your Word, inseparable from You; thrqugh Him You have made all things and in Him You are well pleased. You did send Him from heaven into, the womb of the Virgin; carried in her womb He was made flesh and was manifested as Your Son; being born of the Holy Ghost and,. of the Virgin. FulfilIing,your Will and acquiring for You a holyl people He stretched out His hands in suffering in~ lo The full text of this thanksgiving prayer can be found in J. A Jungmann, s.J., Public Worship (Collegeville: Liturgical Press, 1957j~] pp. 92-3.if' order that He might free from suffering those who believed in Him . He was handed over to volun-tary suffering to rob death of its power, to break the bonds of the devil, to tread hell underfoot, to give light to the just, to set up a boundary stone and an-nounce the resurrection . Remembering there-fore His death and resurrection., we thank You that You have considered us worthy to stand before You and to serve You. And we pray that You will send down the Holy Spirit on Your Church. Be-cause You gather all together in unity, we pray that You will grant the fulness of the Holy Spirit to all the saints., that their faith may be strengthened in truth, and that we may praise and glorify You through Your servant Jesus Christ, through whom honor and glory be unto You, O Father, with Your Son and the Holy Spirit in Your Holy Church both now and for ever and ever. People: AMEN. CONCLUDING HYMN: [stand] Psalm 99 (All sing the antiphon after the cantor and after each verse.): ALLELUIA, ALLELUIA, ALLELUIA Cry out with joy to the Lord, all the earth. Serve the Lord with gladness. Come before him, singing for joy. [Antiphon] Know that he, the Lord, is God. He made us, we belong to him, we are his people, the sheep Of his flock. [Antiphon] Go within his gates, giving thanks. Enter his courts with songs of praise. Give thanks to him and bless his name. [Antiphon] Indeed, how good is the Lord, eternal his merciful love; he is faithful from age to age. [Antiphon] Give glory to the Father AJmighty, to 'his Son, Jesus Christ, the Lord, to the Spirit who dwells in our heartsY [Antiphon] n For further information on "bible vigils" see "Organizing a Bible Vigil," by Kilian McDonnell, O.S.B., in Worship, February, 4. 1960, pp. 144-48 and the article by the present writer, "Popular 4. Devotions--a New Look!" to be published soon in Homiletic and Pastoral Review. Examples of such vigils can also be found in Wor-ship, January and March, 1959; March, 1960; January, 1961. Tiuml~giving Day Serv~e VOLUME 20, 1961~ 407 RICHARD M. MCKEON, S.J. ' Human Relations in Religion ÷ ÷ ÷ Richard M. McKeon, $.J., is the director of the Institute for In-dustrial Relations at Le Moyne College, Syracuse $, New York. REVIEW FOR RELIGIOUS 408 The title of this article may seem strange to many. Cer-tainly a great deal has been written about the human factor as applied to the religious and the priestly life. But we wonder if there has ever been a systematic study of human relations in religion similar to the hundreds which are being made in the field of industry. Before me .is book, Human Relations in Management, numbering over 750 pages. Subject to correction, I doubt if there is a similar book concerning human relations in religious management. The following are some of the topics treated in the book: the human factor in industry, the philosophy management, conditions of effective leadership, motiva-tion and increased productivity, work group behavior, basic psychological factors in communication, the psy-chology of participation, dealing with resistance to change, empathy--management's greatest need. If great accent is being placed on human relations "as a systematic, develop-ing body of knowledge devoted to explaining the behavior of industrial man," should there not be a similar body knowledge based on the best findings of the behavioral sciences to explain the human relations factor.in religious and priests? The history of industrial relations shows how the human element was sorely neglected up to the start of the twenti-eth century. That was why in 1891 Leo XIII issued his famous encyclical letter On the Condition of the Working Class. Up to World War II there were some noted ad-vances in this field, as the Hawthorne Studies and the im-petus prompted by the passage of the National Labor Relations Act show. But from 1945 to the present the study and application of human relations in industry has been phenomenal. With these thoughts in mind I shall make comment on an article, "The Human Relations of a Foreman," pub-lished in the Monthly Letter of the Royal Bank of Canada for May, 1961. By applying some of the topics to the re-ligious and priestly life, the need for further exploration will be evident. "Why is the supply of men of supervisory capacity so thin?" Why have so many superiors in religion been lacking in the qualities which make for good administra-tion? Many answers will be given and I have listened to them for over forty years. Some will point out men who have been advanced with no worthwhile achievement behind them--merely because they were sources of no trouble. Is there also a chance that,administrative pro-motion in religion is connected with nepotism and cliques? It is true, of course, that the principles and rules of re-ligious life will sustain su~cient order in a community even under a poor administrator; the vow of obedience is the great foundation here. But in this article let us set aside the supernatural side and try to view human re-lations in the light of modern industry. Let us begin by remarking that just as a foreman in a factory needs "poise, wisdom, suppleness of mind, courage, and energy, besides the know-how of his technical special-ity," so also are these qualities to be hoped for in a su-perior. A superior is called upon to be an executive. Do the current methods of selecting a superior prove that he possesses executive talent for this or that particular position? Take, for instance, the priest who has charge of the ma-terial things in a seminary or a religious house where the teachers and students number one hundred or more, As far as shelter, food, and material services are concerned, such an institution is like a hotel. While custom, tradition, and discipline will keep things going, it is evident that such a priest would do a far better job if he had a course in hotel management. We all know the grand rush for our priests and religious to go on for higher studies in order that Catholic intellectual life be improved. This is to be commended. But is it not logical also to send those in charge of the ordinary living conditions of religious and priests to special studies to improve such conditions? Such training should result in better economical operation as well as in better living conditions. Have you ever tried to dry yourself with the moisture-proof towels found in certain communities? "Good human relations is people getting along well to-gether." It is not enough to rely on the religious or the priestly garb to command proper respect. Respect should b'e won by "intelligence, administrative competence, and the power to make men follow him~ because of personal attributes." All evidence of playing a policeman's role mnst be avoided. + + + Human Relations VO~-UME 20, 1961 409 4. o÷ R. M~ McKeon, S.]. REVIEW FOR RELIGIOUS 410 Every religious and priest is a person; the superior must show a. sincere interest in each one; he must give him a sense of really belonging to the team--the institution under the superior's charge. The superior's chair must not be turned into a throne; around it there should be an atmosphere empty of fear but rich with sympathetic un-derstanding. "The best company to work for, and the company that gets the best work done, is the company with a strong company-group feeling." There are and will be divided religious communities; they are not pleasant places to live in.,How can such a situation be remedied? One answer is by superiors "who obtain the collaboration of people in their work-groups through loyalty and liking and coopera-tion." A superior will assign a subject a task; the subject will obey. But it is certain that the job will be better clone if the superior has excited enthusiasm, initiative, loyalty. "However.tall a man may stand in the hierarchy of management, he is not a successful executive unless he un-derstands the points of view and the problems of the rank and file of his workers." This statement is equally true of the religious superior. Unless his interest is sincere and sympathetic, subjects may do their work; but human na, ture being what it is, we wonder how good the work will be. ~A superior must prove himself superior; otherwise his authority is bound to suffer. It is necessary to strengthen that authority by personal performance and demonstrated ability, Good managers ask their workers for counsel and help. They know, that fine ideas are often buried in the mind waiting for the right tapping. The post-war growth of suggestion systems is proof that industry values the min'd of subordinates. It gives courteous hearing to such ideaS; it allows workers to take part in decisions. By such action workers feel that their jobs are important and that they share in responsibility. A few words abou~ discipline. In his own development, a manager should learn to obey. "But discipline is more than blind obedience. The word itself comes from ,the same root as the word 'disciple,' and a disciple is one who follows the teachings and the example of a respected leader." A good manager will have discipline because he is fair in the allotment of work and in the handling of grievances and because he inspires. He is not worried about "losing face" by appearing too human. In a crisis he will be forceful but friendly. The same things will be true of a good superior in reli-gion. Moreover, in his case there is the supreme examplel of Christ in His handling of His disciples to drive home many a lesson applicable to religious life. Christ con7 demned, sin; He had love and mercy for the sinner. "Probably foremost among the techniques of handling men is .the building of morale through praise and en-couragement. Commendation by a superior is of great consequence. It breeds loyalty and it inspires the worker to follow "through." Religious and priests are human and will remain so till their dying breath. Human nature likes encouragement especially when skies are dark. Religious and priests are also humble; when just praise from su-periors is lacking, they will console themselves by remem-bering the words of our Lord: ~'Even so you also, when you have done everything that was commanded you; say 'We are unprofitable,servants; we have done what it _was our du_ty to do.' " But praise justly won for doing one's duty weli means a. great deal in religious life. It does boost morale and it .strengthens self-confidence. It makes~a man willing to as-sume more difficult work. Moreover, when a superior gives credit to his community on the occasion of his in-stitution receiving public praise, he will build up initia-tive and a mutual sense of responsibility. I believe that the words of Peter F. Drucker, an. expert in management matters, should be applied to a religious superior. He writes: "Who is a manager can be defined only by a man's function and by the contribution he is expected to make. And the function which distinguishes the manager above all others is his educational one. The one contribution he is ~uniquely expected to make is'to give others vision and ability to perform:It is vision and moral responsibility that, in the last analysis, define the manager." In the previously mentioned textbook, Human R~la-tions in Management, over one hundred pages are de-voted to communication. I am willing to wager that no treatise on the religious life has a quarter amount of'this topic developed as it should be. If successful communica-tion is necessary for the functioning of industry, it should be equally, true for the religious life. Effective communication can build up a stronger com-munity spirit. How embarrassing it has been for religious and priests to be among lay people and hear, for ex-ample; that a new building will be built on the campus about which they have heard nothing. XVhen special work is assigned, it is,well for superiors to give the subject all information possible or refer him to one. who can help him. When information is passed through several superiors, measures should be'.taken to keep the original information intact. If the lower superiors are not able to explain clearly the.orders and policies of the "top brass," confusion will be more confounded among the rank and file. Communication is a two-way street. A good superior will listen to his subjects. Many have excellent brains + ÷ + Human Relations VOLUM.E 20, 196,1 ÷ ÷ 4. R. M. McKe~n~ $.]. REVIEW FOR RELIGIOUS 412 and are trained in special fields. To pose as all-knowing and not to recognize the interest and contribution of such subjects for the common good is a fatal error. As.I was writing this article, the new president of the college called a special meeting of the community to in-form them about plans for three proposed buildings and for the future development of the entire campus. Three members of the architect's firm spent over two hours ex-plaining intimate aspects of the plans and answering ques-tions. Then followed an informal discussion for another h6ur. As a result, the entire community has a greater in-terest. The president said very little outside of thanking the architects; but he was responsible for this excellent,job of communication. "Sound administration is the sum total of mature imagination, mature perception, mature judgment, and mature humanism." It is well to remember that maturity is not a matter of years of service but of mental develop-ment. It calls for self-discipline manifested by regularity in work habits, exactness in execution, and alertness; More-over "healthy self-criticism and continued willingness to learn are among the important attributes of the foreman" --and likewise for the religious superior. One purpose of this article is to call attention to the great number of books and magazines dealing with the human aspects of industry. In them will be found a wealth of material which can be applied to the religious and priestly life. It is also true that we of the Church, if prop-erly trained, can give to industry the constructive princi-ples of our Christian heritage: the Sermon on the Mount, for example; can be developed into a powerful treatise in industrial relations. What holds for leadership in industry is also true in religion. "Leadership means to initiate, to instruct, to guide, to take responsibility, to be out in front . The joy of leadership and the thrill of being in charge of a group of people does not consist in doing a terrific iob yourself, but in spending your last ounce of energy and encouragement to see the group crack through to success." There have been magnificent leaders in the priesthood and religious life as history testifies. But certainly the Church would make better progress in these critical times if our leaders were well vbrsed in human relations within their respective groups. If the development of human nature studies in industry can be of help to the Church, let us be humble and sincere in translating the best things into the priestly and religious life. SISTER MARTHA MARY, c.s.J. The, Wisdom of Praise Why is p?aise such a welcome sound in our ears? Is it be- Cause we are so egotistic or is it rather that we, as social beings, have such a deep need for the approval of others? St. Thomas remarks that dependence on others is typical of the rational creature. Security in the companionship of our family and associates is our first and most enduring need as a human being. No amount of food, entertain-ment, or suhshine will take th~ place of this ingredient of life. Every li¢ing person needs to know that he is loved and appreciated; and if such recognition is not forthcoming, life loses much of its meaning. He feels that he is'maimed in some interior and frightening way, for deep in his heart everyone agrees with the poet's words: "No man is an is-land." It is interesting to note that our Lord praised people without any hesitation. He praised the widow for her in-significant contribution in the, temple, Mary Magdalene for loving much, the centurion for his faith. What glow-ing words He had for St. John the Baptist, a supposed rivalI1 Sometimes He made these remarks in the presence of the person praised; sometimes not. What is important is that we know our Lord did communicate to others who were with Him the conviction that He appreciated them. He did it by words of praise in many recorded instances. True, He warned against flattery, but that was something quite different, the antithesis of praise--false praise. Jesus Christ was always the enemy of hyp.ocrisy; He was always on the side of truth because He is truth. The qnly true praise is truth. Thus flattery is ruled out from the start. How could it have any meaning when it has no basis in truth? Praise is based on real accomplishment or at least the capacity for ~ Lk 21 : 2-4; 7 : 44--~0; 7 : 9; 7 : 26-28. Sister Martha Mary, C.S.J., teaches religion and English at St. Jos-eph Academy, 1015 South Monroe Avenue, Green Bay; ,Wisconsin. VOLUME 20, 1961 41.~ 4. 4. Sister Martha Mar~ REVIEW ~:OR RELIGIOUS 414 this achievement; flattery is an appeal to another's vanity. Praise flows from principle; flattery comes from policy. Praise is genuine; flattery, is counterfeit. Yet, just as no one rejects all currency because he knows that counterfeit money is in circulation,, so no one would wisely reject all praise simply because flattery does exist. Praise is a great goo~ because it is the straightforward recognition of the cooperation of another with the grace of God. Every worthwhile deed a person accomplishes is brought to fruition under the grace of God without whom no one can do the ~lightest thing. This awareness of the good in others is made tangible by words of praise and by the pleasant relationship which these words set up. Praise be-comes the externalization of the empathy within the heart. It is a combination of joy, gladness, and great-heartedness. It is the visible expression of love and admiration. It is the positive keeping of the eighth commandment which is so closely connected with the great commandment. The Christian is so busy bearing true, glowing, enthusiastic witness to the neighbor that he chnnot bear false witness. To praise, then, is to be virtuous. But is praise not t~o be considered_ dangerous to hu-mility? Will it not be aft inducement to pride? Will it not draw us away from God and focus our attention on self? St. Thomas allays our fears on this point. He says that praise can be a very good thing, and this for several rea-sons. Rightfulpraise is iri reality the praise of God through whose power the good ~eeds have been performed. Sec-ondly, the praise of good may stimulate others to emulate these good acts. Finally, prhise is a means by which one can come to recognize good qualities in himself, the talents which God has entrusted to him. Once recognized, these talents can be developed and the person possessing them can thank God in all humility for the many gifts he has received. How could he be grateful if he did not know what God had given? Awareness brings gratitude. In these words, St. Thomas points out that praise is a means to an end; it i's not to be sought as an end in itself.2 God is the end, but praise is a very powerful stimulant to approach Him more quickly. The theological viewpoint receives strong support from psychologists who agree that vanity, conceit and other un-desirable qu.aliti~s flourish widely where recognitiofi is not given, for they serve as modes of self-defense when a per-son's sense of personal worth is or is thought .to be under attack. Humility flourishes best in an atmosphere of loving approval, and the normal means for making known this approval is praise. Regarding this, Sister Annette spoke at some length to religious superiors at the 1959 Institute of Spirituality: ¯ Summa theologiae, 1-2, q. 132, a. 2. All that you have to do to demonstrate that there really is no incompatibility between humility and a sense of personal' worth is to work very hard and consistently for a while at giv-ing your Sisters a sense of personal worth. Show your appreci-ation, of ~hat they are. doifig. Give. them praise whenever, p.os-s~ ble . And you will see more evidences of genuine humility than you did before this principle of psychology was applied so assiduously in your hguse. You see, it is the secure S~ster, the Sister who feels that she counts for something with her superior and with her community, who can afford to be humble. She is not continually being called upon to defend herself . A sense of p.ersonal worth is not only ~ao detriment to the virtue of hu-mility but it is also a natural help to. the .acquisition of humility.8 Father Nuttin notes that individual, actions tend to be repeated in .proportion to the success achieved: ~Experimental data about the way human personality de-velops from past experience show that normal forms of be-havi'our and the dyndmic forces which lie behind them, tend,to develop according to the success achieved; that is to say, forms of behaviour which lead to a satisfactory result are maintained by theoorganism, whilst the kinds of behaviour~ that end in fail-ure or a comparatively unsatisfactory result are increasingly eliminated.' If such is the case, ignoring good actiom, or worse yet, condemning them, may be a p6sitive deterrent to the praiseworthy development of another; Whether we wish to be or not, we constitute someone else's env~ironment. Now the question can be asked: Who should praise? Theologians and psychologists agr~ee that"~ tO produce its most desirable effects, praise must be given'by those who matter to us. Father Lord, in perhaps his greatest pamph-let, In Praise of Praise, comments thus: I should be quick to praise and eager to approve those who are connected with me by blood and kinship. The nearer the re-lati. onship, the more spontaneous and generous should-be my praise. I should gladly praise those who in the slightest .way depend on me. Their dependence extends to a real need for a state-ment that I like them and their work. I should be quick to notice and point out the good work of associates. Assoctation can easily turn out to be less the'occasion for friendship than for rivalry. That is tragic. Men and women thrive under the approval of those who work at their side. I am wise if I.praise those who are or could be my rivals. I may be sure the praise given to them is not stolen from me. Indeed, if I were to play a calculating and selfish game, I can remember that when I praise a rival and speak well of work that parallels my own, I am displaying my own generosity of soul.8 ~ Sister Mary Annette, C.S.J., "Environmental Factors Conditioning Personal Development," in Proceedings oI the 1959 Sisters' Institute o] Spirituality, edited by Joseph E. Haley, C.S.C. (Notre Dame: Uni-versity of Notre Dame Press, 1960); pp. 105-06. ¯ ' Joseph Nuttin, Psychoanalysis and Personality (New.York: Sheed and Ward, 1953), p. 185. ~ Daniel A Lord, S.J., In Praise o[ Praise (St.Louis: Queen's Work, 1953), pp. 47-8. + ÷ + VOLUME "20, 1961 415 $ist~ Ma~tha Ma~y REVIEW FOR RELIGIOUS 416 It is a known fact that many persons in the United States, even religious, go to 'a psychiatrist to have selbconfidence restored. How has it been lost? Might not a steady diet of apreciation have helped to prevent such personality starv-ation? The duty to praise is far'reaching indeed. It includes family, superiors, associates, everyone--in varying degrees. But for those in a pgsition of authority, the duty is more pressing because the results are more telling. What about religious superiors? Where praise exists, there is a smooth-running, happy community. Where recognition is never given, the virtue of the subjects is tested to the extremes; duty is made very difficult. A much-lo~ed superior general used to say to her subjects: "Do this, Sister dear, with the grace of God and your own smartness." She made her subjects feel that the cooperation they gave to God was tremendous and that they were great persons. They left her presence feeling that they could conquer the world for Christ. Deep in their hearts they felt, too, that perhaps their cooperation had been somewhat defective in the past, but that such a thing would never happen again. Such attitude of mind is healthy. Just the opposite is the de-flation felt when one has been told how inconsequential" one,s achievements and capabilities are. There is no to de better, just a dead feeling that one's clay feet match the rest of one's anatomy. There is always', the danger too, that since religious regard superiors the special representatives of God in their lives, unguarded and thoughtless remarks may be taken very seriously. The commitment of a religious demands excellence performance because what is done for Christ should be' perfection itself. However, a superior who takes the ex-cellent performance of her subjects for granted, does not establish a happy community feeling. The mere fact she provides a well-balanced diet for them, comfortable sleeping quarters, and the proper medicine for them when~ they are sick, does not compensate for a lack of confidence' and trust. Sisters value such comments as: "You did that well, Sister"; "I heard Dr~ Jones comment on your "The talk you gave at assembly was splendid"; "That apple pie tasted just like my mother's." When~ such remarks are made, the small talk of religious becomes, big talk because it makes each member feel that she is necessary person in her religious family, Does this mean that the praise must be all on the side the superior? Should the subject praise the superior? Ob-viously, since praise which is true praise is merely aspect of 19ve, the subject ought to show her appreciationl! for her superior. Too often this manifestation of regard classified as "polishing the apple" or "getting a stand-Yet, in religious communities no one ever aoes anyt alone. Subjects must back their superiors, not just from a sense of duty but in a happy manifestation of esprit de corps. This is best done when appreciation is shown on both sides; therefore, subjects ought not to fear to tell their superiors that a job has beefi well done, that they ap-preciate kindnesses. On the whole, superiors receive less praise than they should. They need kind words to counter-balance the worry and responsibility they have to shoulder. Superiors do a better job when they feel the warmth of subjects' love and admiration. When is the best time to praise a person? Obviously there is no pat answer for this; still it seems that praise should be given as soon as possible after achievement as it is a powerful tonic for relieving the fatigue concomitant with difficult work. It should be given, also in the tedium of steady progress toward distant goals, and it should be given at the moment of failure when discouragement may overwhelm one. In fact, there is no time unsuitable for praise; yet, it is of least value when it is prefaced by un-kind remarks simply because there is little likelihood that it will be believed. Praise, then, we may conclude, is a powerful incentive to virtue when it comes from one who matters to us, when it concerns a good action in an aspect of life which is im-portant to us, and when it is rightly timed. Praise is pre-cious and abundantly at hand. Then why is there so little of it in circulation? Observation will furnish the answer. Praise cannot thrive where there is selfishness, thoughtless-ness, and jealousy, It does not spring from misinterpreted moral principles. Praise is choked in the worldliness of our product-conscious age. All our superlatives have been cheapened in advertisements of such things as cars, beer, patent medicine, soap, and toothpaste. The people who invented these things have usually never been heard of. It seems that only diseases are named for their discoverers. Since the product has taken precedence over the person, we praise the product and ignore the person who devised it. This subtle and damaging form of worldliness can not only creep into religious communities but even thrive un-der the protection of ill-applied moral principles. The extent of the damage which results is almost impossible to gauge. This is true because very few people in the world have enough self-confidence to compensate for not receiving it from others. In our age, most people, rather than tending to pride, seem to be on the opposite side. They tend to be too afraid, infantile, immature, or in a Thomistic sense, pusillanimous. We are more like the man in the parable of the talents who buried his one talent. It is an odd, Jansenistic notion, I suppose, that makes many of us afraid to encourage others for fear we will make them ÷ ÷ Prate VOLUME 201 1961 proud. This is least likely to happen in our age. Rather we seem to need true encouragement to help us along the way.~ The need that is most basic,to our spirit is the need to be loved. We cannot live normally without it, It is being loved by others that gives us our sense of personal worth. Why should we hesitate to let this love shine through our words? Granted that praise does good to others. Does it help the one who bestows it? Yes. Praise dilates the heart. It fills us with love. It makes us outgoing. It makes us want to live life, not just to undergo it. Hearts that sing with praise are far removed from the dry rot of egotism. St. Thomas in explaining why God demands our praise and worship for Himself, underlines the fact that we are the ones who are benefited~ not God. Praise opens us up to God so that we can make contact with the divine. An analogous thing happens when we praise our neighbor. We praise God when we praise what He has made. Thus true praise finds its beginning in the worship of God. °Charles A. Curran, "Some Basic Factors in the Formation of Feminine Character and Spirituality," in Proceedings o! the 1959 Sisters" Institute o[ Spirituality, edited by Joseph E. Haley, C.S.C. (Notre Dame: University of Notre Dame Press, 1960), pp. 59-60. 4- Sister Martha Mary REVIEW FOR RELIGIOUS 418 FATHER AIDAN, C.P. The Examination of Conscience Cemeteries are not, I suppose, places to which we would willingly go to 'pass our time. It is true that the grave-zligger in Hamlet sang at his grave-making, but theh 'custom hath made it in hima property of easiness"; less frequent visitors find light-heartedness the least of their emotions. If the churchyard is well=kept, colorful, and dive with flowers; the contrast between what it looks like ~nd what it serves' as is themore marked; if on the other ,Land it is neglected and untended, theatmosphere of g'en;., eral mournfulness and melancholy befitting the place is dl the more enhanced. No doubt Gray's "Elegy" has done .nuch to contribute to this association of ideas, but the ,~ensive sadness he found in his churchyard is a feeling =ommon to nearly all. I wonder whether a religious about to make his examen ¯ f conscience ever finds himself oppressed by much the ame sensation. Here we are---daily invited to 'attend and :arefully inspect the tombs of our buried ~hopes, our luickly perished good resolutions, our infant virtues; to emember carefully all the ills and diseases that did them o swiftly to death, and thereby to guard more effectively ,gainst the future attacks which we know to be inevitable. 1~o return again and again to the scede of so many defeats, o behold repeatedly evidences of such .feeble efforts--it an be a depressing pilgrimage, so depressing that th6 de- ,otion essential to any pilgrimage quickly evaporates,and ve fall into a routine performance of a task which ought o be, must be, fulfilled: And: tlien, perhaps, our resolutions, like everything me-hanical, begin to wear down. We become less convinced ,f the utility of the practice;, after all, we know ourselves ~retty welt by flow, so wliavis the point of this cons'~ant elf-analysis? Our duties keep us busy, our day is a full ohm, ,nlooked-for circumstances rob us of our precioffs~ mo-aenis; they surely can not be squandered on so profitless ÷ ÷ ÷ Father Aidan, C.P., teaches English at. St. Gabriel's College, Blythe Hall, Orraskirk, Lancs., England. VOLUME 20, 1961 419 Father Aidan, C.P. REVIEW FOR RELIGIOUS 420 and dispiriting an employment. It can well be treated more cursorily, shortened, even omitted altogether. We are amazed to read what great store has been set on the examen by spiritual writers-~quite reputable ones, too~ and we can only feel that they are given to pious exaggera-tion. Yet for all our specious reasoning, the examen is an es-sential feature in our spiritual life, Perhaps it is not merely our practice of it, but our attitude towards it that stands in need of re-orientation. Perhaps we should remember more firmly that it represents not a solo effort with our-selves as judge and jury, plaintiff and defendant, but a joint partnership between ourselves and Christ. After all, the dead we mourn in our own little cemetery were also once His. He is concerned about all those abortive efforts, those frustrated failures, those sadly neglected promises. The sorry wreckage we contemplate so ruefully is not merely the ruin of our own hopes; it is also the thwarting of His loving desires for us. If we remember His presence,~ His concern in what we do, then perhaps we shall not find it too heart-breaking or too strength-sapping a task. When we look out of a window at a view beyond, we, are really lo~king at two things. We see the window itself,I and through it we see the landscape. Our gaze, it is true,,, is focused on the view, and we are aware of the windowl only secondarily, in a vague sort of way. Further, the more magnificent and appealing the view, the less conscious we are ot~ the intervening glass. There is a certain analogy here with our examen. Our souls should be like clear glass, through Which can be seen the magnificent spectacle of God. Too often, however, that unclouded pane becomes speckled and spotted with dust and dirt, so that it steadily grows opaque. It is to removing the source of that dirt that our examen is directed, so that~ we may look beyond to the splendor of divine brightness, Obviously, to clean merely for the sake of cleaning, like a fussy house-proud housewife, is a soulless occupation. The window is cleaned so that it may be seen through-~ that the beholder may gaze in full enjoyment at the beauty beyond. And when we are once convinced that the view is really worth looking at, surely we labor more eagerly at the window cleaning. In other words, when we attend to keeping clean the window of our soul, we must have our gaze steadily focused on the sight of our Divine Lord beyond. We should not rest in a sterile contemplation of our own limitations-- that way lies discouragement--but should compare them, at once with the unlimited virtues in the Sacred Heart Of Christ. He can, and He will, help us to remove those limitations, if we sincerely will to allow Him to do it. The sincere will to let Him have His way--perhaps i.t, ~as been the lack of this that has made our examens in the past so tedious, so disheartening, so~ fruitless. So easy to allow a gush of self-pity to drown the good resolution; so easy to stand idle, paralyzed with dismay, at the revela-tion of our utter weakness; so e~igy to forget our Divine Partner in the examen, that "combined. operation" that is nothing less than the accomplishment, together with Him, af the redemption He has died to bring, us. This should be remembered even if our examen ,has lacked more than sincere good will, and has been only a perfunctory formality--a mere lip-service without any ,eart-searching.: A few pet imperfections hurriedly re-clewed, their number estimated vaguely if at all, some nechanical acts~of sorrbw and petition, and we rise hastily _o get on with the real business of the dayRsomething for which we can see some positiveresult and tangibl~.fruit Of :ffort. Never a substitute for sincerity; formality has, llere ~. fossilizing effect; every subsequent examen only serves _o add a further stratum in the soul and renders future ~clamation more and more remote. Yet if with us works Dne for whom no obstacle exists, save only in our own tardened wills, we can not doubt the outcome. ~ There can be no excuse of "parvity of matter"~in our .elf-analysis. We are never likely to run short of raw ma, erial.'Our vows, our duties, the virtues we should practice, ,ur attitude to and our contacts with our neighbor--all ,r0vide us with food enough for reflection, and after re, iection, action. If it seems otherwise, then we know with ertainty that we are deceiving ourselves. Five loaves and wo fishes seemed at first a scanty meal for a few men; yet, _~lessed by our Divine Lord, they provided ample nourish- ,-tent for five thousand--and still there were left twelve ~askets of fragments. If we complacently survey our soul :nd can see little therein to engage our attention for long, ;'e need the blessing of Christ upon our efforts to detect ,ur infidelities; then we shall be kept busy indeed. Our poverty, for instance--what can we check on there? .~o great breach, perhaps, but are there no ,lesser infideli-ies? A practical distrust of Providence, for example; else ;,hy do we so often hoard up so much for such~remote ontingencies? How about our spirit of detachment? Why 11 those knick-knacks and bric-a-brac that so drearily ollect the dust in our rooms? They would be at home no loubt in a drawing room, but in a religious cell?. "But, ,f course, I should willingly give them up if the superior sked me for them." And how likely is that? Superiors rave surely more sense than to ask their subjects for lbums-of photographs, tawdry little souvenirs, showy ittle gewgaws, or even that battered copy of the New I'estament, guarded so jealously since profession day-- or its sentimental value only. VOLUME 20, 1961 ÷ ÷ REVIEW FOR RELIGIOUS ~ Or, as superiors, have we put purposes before persons; The purpose we have in mind, that is, before the .persons we should have in mind, those under us whom we are responsible to bring closer to Christ. Have we neglected to give them what we might have done well to give them, with the excuse that necessary retrenchments must be made in order to meet the expenses of some pet project of ours? Has there been an over-cautious pruning of certain preliminary expenses, which in the long run will impair the success of the complete scheme as a whole? We must be poor after the manner of Christ. The key: note of His way of living was simplicity. He did not create artificial needs; He did not hanker after what conduced' merely to comfort. He 'accepted what was given, when it was .given, and did not repine; He slept how, when, and Where He could, and was content; born in another man',, stable, He was buried in another man's tomb. All through His life, His indifference about means shines out: "Do no~ fret~ over your life"; "Be not solicitous, therefore.,' He showed practically His self-aband0nment to the provi: dential.care of His heavenly Father. Analysis of our practice of obedience is another useful mine of self-information. Perhaps our faith here has bei come imperceptibly weaker over the years; we are more conscious of the ,human limitations of the superior ~than we are of the fact that he represents Christ for us. (Yet suppose our Lord had seen the cross merely as a painful instrument of an ignominious death?) Would we not go freely and willingly to Christ to discuss our ideas, plans, suggestions-not trying to catch Him at an off-moment of distraction or when we know He is in a "good mood;!' or when we have paved the way for a successful issue b careless hints? Would we not abide by His decision, after discussion, He gave judgment against our petition~ so obviously to us the best for all concerned? If He were to order us tosome employment which we felt would only expose us to almost certain failure, with all its consequem mortification, we would surely not ~'twist and turn frenzied efforts at evasion. He needs our efforts to do Hi., work about as much :as the sun needs a candle to light thb world; but He does look 'for our good will. Or as superiors, remembering that the sole purpose ot the authority we hold from Christ is to bring those ~ndel us nearer to Him, have we really tried to understand sym pathetically the capabilities and limitations of those dis ciples of His? "Splendid isolation, may be all very well a~ a political slogan; it should be far from the mind of superior. The crown of thorns round the brow is probab!: inevitable; but no prickly thickets round the heart shouR render access difficult and even impossible. Man is, cording to Shakespeare, "dressed in a little brief autho~l ity," and should not play "such fantastic :tricks before high heaven As make the angels weep:" The donkey that bore our Lord into Jerusalem had his moment of triumph, felt the garments under his feet, saw the palm branches being waved as he passed, heard the hosannas and shouts of joy; but he would have been an ass indeed to assume that it was for him that the people were rejoicing. The manner in which we obey provides a wide field for examination. "Prompt, blind, and cheerful" is cer-tainly a high enough ideal. We need to ~be on our guard against any "delaying tactics" ("He may think better of it in a day or so") and against any disinclination to carry out what our own intelligence does not dommend. And if the Lord loves a cheerful giver, how much more is He pleased by. a hearty, willing obedience? Yet~how much disobedi-ence may be dignified by the name of manly self-assertion; and how often may pusillanimity usurp, the title of obedi-ence? We must obey as Christ obeyed. Had He not been obedient "unto death, even the death of the cross," we should not have been redeemed at all. He saw the will of His Father in everything that" befell Him, and "the things that are pleasing to Him.I' do always." Authority, even when vested in unworthy holders of office, whether malicious like Caiphas or weak like Pilate, always re-ceived from Him its due recognition, without servility or consideration of human motives. He knew that even such as these "would have no authority, unless it were given from above"; and since from above it.had been given, He submitted to itowith obedience and dignity. Yet even He, Son of God as He was, had to "learn obedience by the things He suffered." ¯ Our third vow, chastity, is perl~aps, best considered under its~ aspect of love, since serious failure here will not require examination, being self-evident. It is possible to allow our very pursuit of purity to blind us to its wider implications. If we. do not find in ourselves anything con-trary to our vow, we should thank God: "I could not other-wise be continent, except God gave. it." Yet are we in-tolerant and censorious of the peccadilloes of others? The "heart of iron for chastity" must not preclude the "heart of flesh for charity"; for "chastity-without charity shall be chained in hell." A mortal sin again~st charity.will kill the soul no less effectively than a mortal sin against chas-tity. Purity means that we long to love only God and for His sake all others. If self-complacent purity should lead to bitter, wounding remarks and unkind lack of considera-tion, we are completely missing the end of the sacrifice entailed by the vow; we might well ask: "To what purpose was this waste?" Again, it is surely only an incomplete view to confine ÷ ÷, ÷ Ex~mi~tlon o Comci~nce VOLUME 20, 1961 423 ÷ ÷ ÷ our warfare against "the flesh" to sexual temptations alone, Perhaps we may not indeed have offended here; but if faith wanes dim, and love waxes cold, there is the danger of the law of compensation creeping upon us unawares. We may tend to grow self-indulgent in smaller matters: to prolong our sleep unnecessarily, to be fussy over what we have to eat and drink, to be fastidious and finical about what we are given to wear, to show a marked disinclina-tion for work that is boring, disturbs our ease, or does not suit us. Purity should not preoccupy us so much that freedom from its grosser infringements blinds us,to the necessity of mortifying our senses--also "the flesh"--our taste, touch, ease, vanity. Nor should our natural propensity for friendship lead us to exclusiveness or to the loss of the spirit of prayer. Our human affections must not be put down, but put straight; they must not be kept under, but kept under con-trol. Controlled affection can be made to serve Christ's purposes; uncontrolled, our inclinations court disaster. What of Christ? His love was not jealous, mean, or petty; but magnanimous, and universal in its sweep. He did not shrink from self-denial in showing His love; He did not fear running the risk of others failing Him, as others did, like Judas,, Pilate, and the unknown "rich young man." All-embracing in its scope (although He too had His "special friends": John, Martha, Mary), His love went out to beggar and well-to-do, Pharisee and publican, virtuous and vicious. He showed no antipathy, no con-tempt towards any one of His creatures; there was nothing forced or spurious about His love, which was the perfect flowering of the all-holy purity of the Man-God. Our examen is, after all, the mirror we hold up to na-ture; a poor weak human nature,.no doubt, but one that all the more on that.account needs the mirror to reflect faithfully all its deficiencies. If we undertake this work more sincerely, more generously, in partnership with Christ, perhaps we shall find what we thought to be stumbling-blocks transformed by Him into ~stepping stones. Our examen will no longer have the dismal charac-ter of a solitary.visit to a desolate cemetery, but the hopeful quality of a pilgrimage with a Friend eager to help us. We may still discover dry bones aplenty on the face of the plain, but if faithfully we do our part, even of them also it may be said "I will give you spirit and you shall live." ~ Father A/dan, REVIEW FOR RELIGIOUS MARTIN A. STILLMOCK; C.SS.R. Two Century Masterpiece "Of all my spiritual works, I should call this' one the best." These are the words spoken by St. Alphdnsus Maria de Ligouri on July 24, 1760, about his book, The True S~ouse ol Jesus Christ. When we consider that of the ope hundred eleven books and pamphlets written by the saint sixty-four ar6 ascetical works, this statement commands attention. The book in question could hardly be given higher praise. To understand why St. Alphonstis made this' remarl~- able utterance, it will' be well to consider the background of this book. As a founder of a religi6us congregation of missionary priests, as a popular and skilled retreat ~aster, and later as a bishop, St. Alpho. nsus was deeply concerned that llis priests and all priests should be learned and holy. To help priests in the field of learning he wrote his famous Mm:al Theology. To help prie,sts in their spiritual life he wrote his well known Selva which treats of the dignity and duties of the priest. All Christians know that there is no salvation for the world except through Jesus Christ. Now the ordinary channel of the world's salvation is the priesthood whic.h Christ instituted. Hence it was that Alphonsus loved so much to preach to priests and seminarians. And hence also it was that he wrote for them. He knew that the sanctification of one priest could mean the saving of thousands of souls that perhaps otherwise would not be saved. Alphonsus know he could put weapons into the hands of priests: weapons of theological learning, sermon material, ~naterial for retreats, missions, novenas. He could give them food for spiritual thought by combing spiritual writers, especially the fathers of the Church, and presenting their writings and ideas in a popular and interesting way. He could point out to priests the road to sanctity and the ways and means to attain holiness. All these weapons as well as many more St. Alphonsus, following Catholic tra-dition, put into the hands of pastors and missionaries for converting the world to Jesus Christ. But to insure success, he thought it necessary to supplement these weapons by Martin A. Stillmock, C.Ss:R., is engaged in parish work at St. A1- phonsus Church, 1118 North Grand Boule-vard, St. Louis 6, Mis-souri. ~OLUME 20, 1961 425 ÷ M. A. Stillmock, C.$s.R. REVIEW FOR RELIGIOUS the prayers of all those who are consecrated to God by religious profession: In every day and age it has been difficult for people to understand the n~cessity and value of the contem-plative life. To mauy it seems a pious waste of time. The problem is that many of these people understand little or nothing of the communion of saints, even though they may believe in it as they profess in the Apostles' Creed. Consequently, they do not understand or even -begin to realize the value of intercessory prayer or suppli-cation. Why God created such an institution as the cloister and why He calls religious to lead lives of penance and pr.ayer is beyond them. But the saints understand the value of these" things; and Alphonsus, from long experience in working for the most. abandoned souls, realized fully how much priests and missionaries need the help of prayers for success in their priestly and missionary work. Whenever Alphonsus had a difficult mission before him, or when he knew strong resistance would be forthcoming from the great enemy of souls, he recommended himself to the prayers of ~:eligious who spend their lives in the presence of God. Alphonsus himself had founded an order of contem-pla'tive nuns, the Redemptoristines. For him they were the second branch of his apostolic congregation, the Redemptorists, While the missionaries were on the front battling [or souls whd were often deep in the clutches of the devil, these nuns raised their minds to "heave/i, like Moses on the mountain, and by 'their prayers and pen-ances obtained the victory. . It was thoughts such as these which impelled A1- phonsus to write The True'Spouse of Jesus Christ. In the volume he says to the religious souls for whom he is writing: You should be :useful to all, especially by yqur prayers. A!l the spouses of our Lord should be zealous for His honor. He Himself said to St. Teresa: "Now that you are My spouse, you must work with zeal for My glory." Indeed, if the souls so ~logely united to Jesus do not take His interests to heart, who will do so? Our Lord has promised to hear anyone who prays to Him. In your prayers, then, at your communions, during the visit to the Blessed Sacrament, recommend to God all poor sinners, infidels, heretics~ and those Who live without God. And Alphonsus goes.on to say: Our Lord Himself asks this of His. special servants. He said to a venerable nun one day: "Help me by your prayers to save souls"; and to St. Mary Magdalene of Pazzi: "See, My daughter, how Christians are in the hands of the evil onel If My elect did not deliver them by their prayers, they would become the prey of that monster." This prompted the counsel which she gave to her religious: "My dear sisters, God has withdrawn, us from the world to save our own' souls, of course, but also that we may satisfy His mercy by interceding for sinners. We shall have to account for the loss of many souls if we neglect to recommend them to God." For this reason she never let an hour of the day go by without prayir[g /0r sinners. Another servant of our Lord did penance for forty years and applied it all to the salvation of souls in need of divine grace. Oh, how many sinners there are who owe their conversion not so much to the sermon of the preacher as to the prayers of some holy re-ligiousl It was revealed to a celebrated orator that the conversions apparently worked by him were not attributable to his elo-quence but to the prayers of the lay brother who sat at th~ foot of the pulpit. Pray then for sinners, and pray also for priests that they may work with true zeal for the salvation of souls. But if religious are to be powerful intercessors with our Lord, it can be only on condition that they be His true spouses. Therefore, just as he did for priests, A1- phonsus treats at length of the duties of religious women. While reading this book, weshould keep in mind that in the eighteenth century many abuses had crept into the cloister. The spirit-of the times breathed laxity, tepidity, and worldliness. A1phonsus was not one to use half meas-ures, and in many instances his language is strong. But his one big purpose is to preach holiness. He does this by pointing out what virtues should be specially practiced, and he prescribes, the means for wiping qut abuses. It may be thought that St. Alphonsus wrote Thk True Spouse solely for cloistered or contemplative nuns. He certainly had° thegn in :mind, but not exclusively. In his preface the saint himself tells us: This work, as appe.ars from the title, is intended particularly for nuns. However, only a small part of it is directed exclusively to them; the remainder, but especially what regards the ob-servance of the vows of religion, regular discipline, and the per-fection of the religious state, is equally suitedto religious of all congregations; and what regards the Christian virtues will be found highly useful even for seculars. What is to be found in The True Spouse? Practically every facet of the spiritual life is treated, The saint starts off his work by treating of the merits of virgins who have consecrated themselves to God. He goes on to state the advantages of the religious state and how religious should belong wholly to God. He speaks of the desire religious should have for perfection and then warns that imper-fect religious are exposed tb danger. The necessity of combating self love is treated. After treating of interior mortifications, the saint goes on to speak of exterior mortification of the appetite, of the senses of hearing and touch, and of the eyes. The book also contains a long treatise on poverty, its perfection, its degrees and practice, the detachment it involves from relatives and other persons. Closely allied to poverty is humility; the saint here discusses its ad-wmtages, the nature of humility of the intellect, heart, and will, and patience in bearifig contempt. ÷ ÷ ÷ Two Century Masterpiece VOLUME 20, 1961 4. M. d. Stillmo¢l¢, C.Ss.R. There is a beautiful chapter on fraternal charity, fol-lowed by one on patience, a virtue that leads to resig-nation to the will of God. Then follows a treatment of mental prayer, its necessity as well as its practice. From there the saint points out the importance and necessity of silence, solitude, and the presence of God. The topic of spiritual reading forms a chapter in itself. The True Spouse contains a long treatment on the frequentation of the sacraments of confession and com-munion. Under confession the saint has a consoling and practical treatise on scruples: what they are, how they are hurtful, their remedy and a practical application. Prayer and purity of intention form two more chapters. A work of this type would not be complete for St~ Alphonsus unless he devoted some space, to the Holy Mother of God. First, Alphonsus contends that no true servant of Mary can be lost; then he goes on to show who are to be considered true servants of Mary. Following the chapter on devotion to Mary is one on the love of Christ, the obligation of a religious to iove Him, and the means of acquiring this love. The saint concludes his work with particular admoni-tions for superiors, novice mistresses, and so on. In the last chapter he gives a rule of life for the religious who desires to become a saint. This includes the treatment of such things as the Divine Office, hearing of Mass, exami-nation of conscience, necessity of banishing melancholy, recreation. The True Spouse even has an appendix con-taining such considerations as a summary of the virtues which the religious who wishes to become a saint should practice, spiritual maxims for religious, and aspirations of love for Christ. Very few books written almost exclusively for religious women handle such a wide and practical range of treat-ment. As one German translator of The True Spouse observes: This book, written as it is with great fo~'ce and piety, contains the.q.uintessence of ascetic theology and is a practical ex-posmon of the virtues of the religious life. I have no hesitation in saying that the reader will find in it all that has been written by ancient and modern writers on the subject of spirituality. It sums up a multitude of books and gives all that the holy author has developed at greater length in other writings on the same matters. REVIEW FOR RELIGIOUS 428 MARCEL MARCOTTE; S.J. Health and Holiness Father, it seems that for the majority of priests, a person suffering from neurosis is condemmed to stand in one spot marking time with no chance of advancing in the spiritual life. I take it that you are not of that opinion, and 1 am so glad. Your opinion confirms my own per-sonal experience and that ol others who have confided in me. When a person is unbalanced in some way, one at once thinks that there has been some frustration in the past of his emotional needs. In most cases this is true. But do not certain neuroses grow worse because of a conflict be-tween the profound need of God which we experience on the one hand and, on the other, the behavior we are led to persist in, sometimes, under the influence o[ the guidance we receive? It seems to me that the more aspir-ing and straightforward a soul is, the more woeful can be certain mistakes in spiritual direction. I think that there is a tendency among religious and priests to make too little of the needs of the soul. Spiritual writers teach clearly that in order to reach God, the soul must proceed by a series of purifications suited to its spiritual progress. But how many spiritual advisors grasp that when the time comes? They seem to think that this was written more for initiates in the spiritual life. But I think that such ideas could be carried over with great profit into many ordinary .lives. Don't you agree? IfI we sidestep debating certain merely incidental ele-ments in this letter so as to throw into relief its main point, the question it asks can be put thus: Does our sanctification depend on our psychological balance as well as, in some degree, on our bodily health and the sound condition of our nerves? Pascal, who was all his life a _very sick and anxiety-haunted man, declared that "ill, ness impairs the judgement and the senses . " "If great 1:This article is translated with permission from Relations, March, . 1961, pp. 64-66. The translation is by George Courtright. 4. 4. 4. Marcel Marcotte, S.J., teaches at the ColI~ge Sainte Marie, 1180 rue Bleury, Montreal 2, Canada. VOLUME 20, 1961 Mar~e! Mav¢otte, S.]. REVIEW FOR RELIGIOUS 430 illness," he says plainly, "visibly alters them, I have no doubt at all that minor illnesses have a proportionate fect." This opinion, dictated by the personal experience of a man of genius who was, also, in his own way, a kind of saint, ought doubtless to be kept in mind. How-ever, recent discoverie~ in psychology together with the teaching of experience and certain data of theology lead us to qualify it. Does our relationship with God really depend upon our physical and psychological formation, which, while in us, is, for all that, not us? Are we to be marked in ad-vance for sanctity or for spiritual mediocrity by reason of our temperament, i the condition of our endocrine glands, certain accidents of education, or traumas ex-perienced in the course of life which definitively open or close to us the approaches"to Christian perfect~ion? "The will of God," says St.Paul, "is ,that' you become saints." But is this divine will concerned only with people who have perfectly healthy and well-balanced bodies and minds? Does sanctity reser~b!e some sort of royal feast to which only a small number of chosen guests--great lords and noble ladies with impressive names--are to be in-vited, while the great mass of the faithful must be satis-fied with the crumbs of the banquet? This would be .a surprising and rather scandalous thing. God, in His giving, remains free, but when once He has granted, in baptism, the first, essential gift ("if you knew the gift of Godl" Jesus said to the Samaritan woman), then that spring of living water, which has just penetrated by grac~ into the Christian soul, must inexhaustibly "gush from his breast into eternal life." For the gift of God is nothing else but God Himself, from whom life pours out, diffuses itself, and irresistibly increases in the Christian so as to make him achieve his full height, his complete stature in Christ. S~ill, we must yield to the evidence: Not all Christians are saints--far from it--for indeed if God's gift is to produce its fruit of sanctity in the soul, the Christian must cooperate freely with the ~ace that is offered him. But the usual effects of original sin make this free co-operation very difficult for the normal Christian. Besides this, in many instances, the exercise of freedom is en-cumbered by" special difficulties which render infinitely more unpredictable the conformity of our acts in life to moral standards and the higher dem~inds of sanctity. "It is hard to practice Christian virtue," Alexis Carrel says, "when one suffers from a glandular deficiency." Edu-cators, judges,-moralists, and spiritual directors realize today how important a role the body plays in the origin and development of certain 'kinds of moral, social, and spiritual weaknesses. Chrtesian dualism no longer has currency; we have learned to, recognize ;and admit the. reciprocal influence of the body and the soul~ on .the physical and mental health of human beings. Psycho-somatic medicine, for its 'part, is ready to take into ac-count complications on the physical and bodily level arising from the psychic; why should not .Catholic moral-ity and spiritual teaching,, in turn, take into account the, repercussion of sick organs and nerves upon the interior, psychic life? "Man," says Pascal again, '~is neither angel nor beast, and ill luck would have it that he who would play the angel plays the beast."-" Furthermore, physical health: is not alohe concerned here. Depth psychology has shown (doubtless to the. point;, of sa.t.iety) that the evolution of a religious and moral personality, is linked to the dynhmic'drives of ifiapulses and tendencies of instinct, and emotion which we carry along with us from earliest infancy to adult life. Ac-cording as the liquidation of ce.rtain psychi~ conflicts has been more or less successful, habit~ and moral or spirit-ual attitudes assume very different characters. In certain instances, repression and sublimation will facilitate ,the practice of virtue and thai.pursuit'of sanctity; in others, they will make virtue and holiness, at least in appearance, very difficult or even altogether impossible. Therefore, in the quest for God, the-Christian must not only adapt himself to his nature as he finds it, but, in ad-dition, undergo to a degree very difficult to estimate the inbuilt necessities springing from the past. Why seek to deny it? There are ill-favored creatures who, so far from being naturally equipped to live a truly spiritual life, are not even fit to live a life in accordance with common morality. They will never be so thoroughly good as they might otherwise be simply for lack of discipline and con-tr61 aiid will drag along through weakness after weakness t6'~the end of their lives. Their sense of judgement is warped, their wills debilitated: how can they aspire to personal holiness? Yet, is sanctification to be made de-pendent on the chance that on~ has or has not a healthy hormone balance, or that one is blest in one's psycho-logical makeup or has been guccessfully educated? Some-times, it takes so little (a thyroid'deficiency, the awkward or rough meddling of a teacher) to change the course of one's life. "If Cleopatra's nose had been shorter . " Is the longing of a Christian for sanctity to be similarly sub-ject to accident, to that "grain of sand in the ureter" which, according to Pascal, upset the, Whole map of Europe? To avoid so scandalous a notion, we must first take care to have a right idea of the meaning of sanctification. We must not'confuse it with the attainment of purely human perfection or even~ with the moral perfection Health and Holiness VOLUME 201 1961 43! ÷ ÷ ÷ Marcel Marcotte, REVIEW FOR RELIGIOUS 432 which makes saints so attractive. In essence, sanctification is the act by which God divinizes man. This action occurs in the spiritual order, an order the harmonies of which are not necessarily echoed in the outward behavior and visible appearance of the man God has sanctified. In re-lation to this action, one's psychological makeup is of no importance. Whether a man be endowed with a nature favorable to the acquiring of virtue or is a neurotic ob-sessed by the flesh or by guilt or scruples, it is enough for him to say "Yes" to God, to cling to Him in his soul of souls, beyond all temptation, all childish fear, in order to be swathed in divine grace and himself made divine. On this point, Saint Francis de Sales says: It is beyond question true that our souls ordinarily take on something of the traits and tone of our bodily lower nature . A body weakened and distracted by much pain cannot but in-hibit the vigor and spontaneity of the soul in its performances. But nothing of this is in anyway prejudicial to the spiritual actions of the soul. As pleasing to God as such actions can be when done among all tlie pleasures of the world, they are even more so when done with greater trouble and pain . We must not be unjust to ourselves and demand more of our-selves than we can do. When our bodies and our health give us trouble, we must, at such a time, expect of the soul only acts of submission and resignation and that holy union of ou~' wills with the good pleasure of God, which is formed in the highest reaches of the soul. As for our outward actions, we must direct and perform them as best we can and be conr tent therewith, though our hearts mislike it and the going be slow and heavy. Nevertheless, the fac( remains that sanctity, in the usual sense of the word, requires certain conditions, which are not given to everyone. For example, an idiot finds himself, as such, incapable of that renunciation of sin and of that assent to grace which are essential ,in the spiritual life. Just as a certain healthiness of the nervous system is needed before the moral consciousness can un-fold, So, too, in the order of sanctity, a certain psychologi-cal healthiness is necessary before that love, thanks to which one renounces sin in order to give oneself utterly to God, can unfold. In what does this healthiness consist, without which sanctity becomes impossible~not that sanctity which exists in the hidden mystery, of the sou! but the sanctity we find in the faces, in the words and the actions of those whom we call saints? There are certain characteristics, certain somatic and psychological qualifications which are necessary so that the fruit Of divine grace .may grow and show itself in the form of Christian virtues: for ex-ample, mildness, temperance, purity, brotherly love. If there are serious deficiencies in one's makeup, the soul will struggle vainly to remain faithful; all its efforts, at least in appearance, will remain useless. True, in the eyes of God, "who searches the reins and the heart," all these struggles, endlessly abandoned and endlessly lost, will have contributed to the sanctification of the soul. But for the bystander, and often for the soul itself, hypnotized by its own weakness, this mystei~ious but real sanctifica-tion will never be verified. It will not even be verifiable. It may even happen that priests and experienced spiritual directors will fail to recognize the value and the merit of these hard-fought spiritual battles which always end in a checkmate. But such a lack of understanding--wit-ness the lives of the saints---often forms a part of the means God uses for the spiritual progress of souls. It is a kind of night added to that night in which souls struggle only to make the darkness darker and faith more meri-torious. Yet, the darker the night, the nearer, the more lovely the stars. "Close your eyes, and you will seel ." God has a way all His own of dealing with the emptiness surrounding the soul. It is at the moment when He ap-pears to be forevermore far away that He is often closest. "If you had already found Me," God says to Pascal, "you would not look for Me." The important thing, then, is the search for God, the effort, as the accepted phrase is, toward sanctity while trying evermore in one's life to accept the divine will, even when that will rules that we make our way toward God stumblingly, foundering in the earth like plough-oxen, we who were made to fly high in the heavens like eagles. There are two kinds of saints, says Father Beirnaert. There are the saints with ill-favored and difficult personalities, that mass of people ridden with anxiety, aggressiveness, and love of the body, all those who bear the intolerable weight of having been born as they were, those whose blighted hearts will al-ways be nothing but a knot of snakes, unlucky because they were born with repulsive faces, or because they have never been able to identify themselves with a father. They are those who, unlike St. Francis, will never in their lives charm a bird or pet a wolf of Gubbio; those who sin and will sin again; who will grieve till the day they die, not because they lost their temper a little but because they keep on committing the same filthy, unmentionable action. They are that vast crowd whose sanctity will never shine out in this world through their personalities, who will rise up only on the last day to glitter, finally, in eternity. They are saints without the honor of the name. At their side are the saints blest with attractive personalities, the pure, strong, sweet saints, the model saints, the canonized saints and the saints fit to be canonized, saints with hearts as free and wide as the seasho~'e; saints whose being, like a per-fectly tuned harp, forever sings out the glory of God; wonderful saints, who encourage the advances of grace and in whom we touch a grace-transfigured nature--the recognized, the cele-brated, the great saints, who trail a shining splendor through history. Both kinds of saints are brothers. Those saints whose per- 4- 4- 4- l;ealth and Holiness VOLUME 20, 1961 sonalities are haunted by m'onsters and those in whom angels dwell have the same basic experience, and they speak Of God and of themselves in the same words. They are of the same bourn, the same world; a world where the only grief is to find oneseff so unworthy of God, and the only happinesg is to be loved by Him and to try to give Him love for love. For us, here below, they are different. Before God, they are alike. And we shall see this in the day of the Lord Jesus (Etudes, t. 266, pp. 63-64). Once more, pure holiness can and sometimes must adapt itself to certain bodily and psychological states which will give their stamp to the outward aspect and ac, tions of a Christian, without, for all that, compromising his inner adherence to the divine will and, therefore, without hurting the life of charity in him. "In the evening of'life," says St. John of the Cross, "we shall be judged~on our love." For each and all of us, it is simply a question of love and, therefore, of choosing, according to the meas-ure of freedom that has been given us, between good and bad, between the perfect and the imperfect. In propor-tion to this, God Himself comes to meet us so as to share His life more intimately with us, before finally, bringing us into His beatitude. ÷ ÷ .÷ Marcel Marcotte, S.]. REVIEW FOR RELIGIOUS 434 THOMAS DUBAY, S.M., ' ' The ,Superior's Predept and God S Will One of the first pro~ositions a.tyro meets in a religious novitiate ,is one to the~effect that a '~superior's directive is "an expression of God's wilV' for .him': If'a religious wishes to know what God' desires of him,~ he need only listen to;accept, and execute the~precepts of his superior. Unfortunately, this early lesson'-'is subject to ambiguity and confusion. And more unfortunately, it can happen that the novice may embrace for life an incorrect interpre-tation of the~,ambiguity or he may simply, practice reli-gious obedience in a pekdffring cloud ofmisunderstand-ing. Does a superior "manifest,God's will" to a subject? If. he does, what does the expression mean? If he does not, ought we to modify our instruction°on this facet of obe-dience? Before attempting an immediate answer to" these, ques-tions, I should like to ask the reader to consider'a philo-sophical and theological antecedent; namely, the problem of how a man can conform his will to the divine will. A conference or retreat master ,can easily advise his listeners to conform their wills to the will of God, but to what ex-tent this conformity is possible and how itls to be achieved is not at all so simple as might appear on the surface. And-, yet a mature and accurate understanding of religious obe-dience would seem to require that we delve beneath the surface and discover~ what-precisely~ we are doing when we obey. For the attainment of this understanding we can follow no better guide than St. Thomas Aquinas. To tinderstand the Angelic Doctbr's doctrine on the precise °fiaanner in which a man is bound to conform his will to the divine will, we must, as Thomas does, dis-tinguish betweeh what may be called a material and a formal conformity.1 In an act of willifig we notice that there are two elements involved: the thing willed and the 1 Summa theologiae, 1-2, q. 19, a. 10~, c. ÷ ÷ ÷ Thomas Dubay, S.M., is spiritual director at Notre Dame Seminary, 2901 South Carrollton Avenue, New Orleans 18, Louisiana. VOLUME 20, 1961 ÷ ÷ Thomas Dubay,. S.M. REVIEW FOR RELIGIOUS 436 motive for willing it. Willing an act of kindness, for ex-ample, implies first of all, the sundry components of the benign deed, and, secondly, the motive or reason for willing that deed. The activity willed (here, the kind deed) is called the material element, while the motive or the reason~why (for example, love for God) is the formal element. It can happen that even when they will opposite real-ities two created wills can be good provided their- motives are good. St. Thomas uses the example of ttie execution of a thief. The judge wills his death, whereas the thief's wife does not will it. The wills are opposed as regards the material element, the fact of the executiori; but they can both be good provided the judge wills the death for a good reason (thecommon welfare) and the wife opposes that death for some evil consequent on it (for example, harm to her family). Because the judge has care for a more universal good, the community, and the wife for a less universal one, her family, both can will opposites and yet be good as long as their reasons are worthy. The° reader will understand that we .are not suggesting that any action at all may become morally good merely by the presence of a good motive. A man may not stem five dollars in order to buy his wife an anniversary gift. We are simply stating that two wills can at times be opposed regarding one action and yet both be willing rightly. We are now in a position to apply this principle to our problem of conformity to God's will. As St. Thomas points out, God as the Maker and Governor of the whole universe knows and wills .whatever He wills under the aspect of the universal good, which is His very goodness. A created will, on the other hand, knows some particular good and sometimes wills it for some reason that is good on a particular scale but not good from the point of view of, the more universal. For example, the avoidance of a spanking is a good from the particular or limited aspect of a child's physical well being, but itsoadministration may be better from the universal and wider aspect of his whole welfare and that of the family. In orde~ for a man to Will well some particular good he must refer it somehow, to the universal good; that is, to God. This referral, this motivation to the last end is the formal element in willing and must be present in a volitional act in order for that act to be rightly ordered. A man, therefore, conforms0his will to the divine will when he refers all that he does to God, since God Himself refers all to His own glory. This is a formal conformity and must always be present in a human act. A man, how-ever, need not and cannot always materially conform his will to the divine will as regards particular acts. It is sufficient that those particular acts be good in themselves and be referred to God, for in so acting man is operating as God wants him to operate~ even though God may not actually will this or that particular act. Hence, a material conformity to the divine will is ,not always required or even possible. Why do we say that a material Conformity to God's will is not always required or even possible? The reason is simple~ We often do not know what God wills as re-gards particular acts. We surely know that He wills us to do all for His sake, but that is a formal conformity, the ordering of all to Him. On.the other hand,.we~frequently do not know whether He .prefers.us to do on~ thing rather than another. I know He wants me'to tell-the truth when I am rightly questioned, but I do not know with certitude whether in ten minutes I should still be writing or visit-ing the BlesSed Sacrament. I know He wants me to obey canon law and my religious rule/but I may not know whe!her He really desires that I make~ tfii.s or that ex-cepaon to them. What ought I to do in these cases? I shbuld use my reason, follow the principles~of.sound ~asceticai theolggy, and exercise the virtue of supernatural prudence. God undoubtedly wiils that I do these latter, but the fact re-mains that once I have made my decision there may or may~ not be a material confOrmity between my will and His. Such,' however, is quite a Satisfactory situation pro-vided that what I do is good and is ordered to Him. In other words, material .conformity may' be lacking, but formal conformity may not. , ~pp!ication to Religious Obediencei: Can we, then, say that a religious Superior manifests tile will of God when he gives' a directive to his subjects? Surely, if the superior merely reiterates a precept of the natural or divine laws, he is indicating the divine will, but he is hardly manifesting it. ,That will is usually al-ready manifested to the subject, 'remotely by human tea, son or supernatural revelation, and proximately by in-struction he has received. As regards other matters (and they are commonly practical on~s) the superior cannot be said tO manifest the divine intention for the obvious rea-son that he does not know what the divine intention' is. If Father Superior tells Father Jones to suspend convert instruction classes during the summer, he is not neces, sarily manifesting God's will to Father Jones. Short of a private revelation Father Superior cannot know with certitude whether God really desires that suspension or not. All he can °do is.Use his experience, reason, and supernatural prudence in coming to a,decision and then hope he is doing what God wants. When Mother Pro-vincial assigns Sister Alice to teaching rather than to ÷ ÷ ÷ The Superior's Precept VOLUME 20, 1961 437 ÷ ÷ ÷ Thomas Dubay, REVIEW FOR RELIGIOUS nursing, Mother is not necessarily declaring the divine mind, because God may actually know that Sister Alice is better fitted to be a'nurse. I would say, then, that, simply speakin.g, a religious superior does not manifest God's will when he issues a command. In an improper sense, however, the superior may be said to manifest God's willAn his precept insofar as God wishes the subject to carry~ out what His representative has commanded. While it is true-that the fulfillment of this command is willed by God, yet the command itself does not properly manifest'anything but the superior's intention. I think it would be re.ore correct to say that by his precept a superior gives his subject the opportunity to do God's will, that is, to obey. It would seem wise, therefore, not to use this.expr~ession in an improper sense because it is misleading and confusi.ng. There-is no mani-festation of what we may call the content of God's will. By his obedience, then,, a religious conforms his will formally to the divine will when he orders his obedience to the divine glory through the virtue of charity. There is, secondly, a material conformity insofar as God wills this precept to, be carried out. There may or may not be, thirdly, a material conformity as regards the content of the precept. The reader will notice that our whole position on the superior's inability to manifest with certitude the con-tent of the ~livine will rests on his ignorance of that will. Hgw can~we establish that ignorance? Really, it needs no establishing because it is obvious on a moment's" reflec-tion. St. Thomas himself saw no difficulty about the matter. "Although we cai~not know a proper end, we can know the ultimate end from whom issues all the goodness found in proximate ends, so t.hat we may direct all we do to God, who made all things for Himself."z "The just on earth, whose will clings to the divine goodness, and yet do not so perfectly contemplate it (as the blessed do) that they clearly see the ordering ofoevery actiop to it, are conformed to the divine will as regards thos_e things whose character th~ey perceive . ,,s The Saint's last remark is most clear: "In particulars we do not know what God wills, and a~s regards.these we are not bound to conform our will to the divine will.''4 ~ St. Thomas readily admits our ignorance of the divine will in many details of human life, the proximate ends as he calls them. We need. only apply his thought to reli-gious obedience and _we have the basis on which our above explanation rests. But can a superior because of his sharing in the divine 1 Sententiae, d. 48, q. l, a. 3, ad 6; see also article 4. De veritate, q. 23, a. 8, c. Summa thkologiae, 1-2, q. 19, a. 10, ad I. ruling authority somehow claim to set forth what we have called the content of the divine will? I think not. No man, be he superior, equal, or inferior, can rightly claim to manifest the mind of God unless God in some way re-veals His mind and ratifies, the claim. God's mind is God and~He is unsearchable. Hence, if a mere man may be said to make known God's mind or His will, that man must have some divine-assurance that such is the case. Does the religious superior have this assurance when he directs his subordinates in the observance of their vows and constitutions? The teaching Church, the Roman~ Pontiff and the bishops in union with him, certainly enjoy this assurance when they intend tobind in their authentic teaching (See Mt 16: 16"19; 18: 18; Lk 10: 16; Jn 20:21).~But does a re-ligious superior as such share in these divine commissions in any way that would permit him to claim that he, too, reflects the .divine will in 'his decisions? We ~may note, first of all, that on the one hand a religious superior, qua : talis, does not possess any special teaching authority in : the Church. On the other, Plus XII made it clear that the i ruling power of ~'eligious superiors is,;a participation in the divinely received ruling power of the Supreme Pontiff ~ himself. Speaking to.the superiors general of orders and .~ to other religious superiors, the Holy Father remarked -" thgt "you have been appointed tO a certain participation " in Our apostolic office," and then enlarged his thought: "Thus in this,.part of Our office, most beloved sons, delegating to you some of Our supreme jurisdiction, either directly by the code of canon law or by your insti-tutes and their rules approved by Us, and setting the foundations of your power which is called 'dominative,' We have assumed you as sharers in Our supreme office. Hence, it is that We are .very much concerned that you exercise your authority according to Our mind and that of the Church.'5 Does this participation in the apostolic governing power give a religious superior some capability to manifest God's will? To answer this last question we must distinguish be tween a mere ruling power and a teaching pbwer. Even the Church herself~, does not claim infallibility in as, pects of her universal laws unconnected with doctrine, and therefore, she does not claim in them to bg represent-ing what we have been terming the content of the divine mind. In setting twenty-four years as the minimum age for the reception of the priesthood even the Holy See would not'claim that it knows the content of the divine mind on that question. While God may conceivably prefer some other age limitation, yet it is His will that 6 Translated from L'osservatore romano, February 12, 1958, p. I. ÷ ÷ ÷ The Superior'$ Precepg VOLUME 20, 1961 439 ÷ Thomas Dubay, $.M. REVIEW FOR RELIGIOUS 440 bishops obey the Church's actual determination of twenty-four years. If the hierarchy itself, divinely endowed with a right to govern men to eternal life, cannot at times be sure that its laws express exactly the divine preference, it can come as a surprise to no one that we deny any such certainly to a religious superior who merely participates in the Church's ruling authority on a delegated basis. When a provincial superior of religious men appoints a priest to the mission band or when a local superior of religious women directs a sister to wax the floors on Saturday morning, it is not objectively sure that the priest is best suited for mission work or that the sister ought not rather be doing background reading in her teaching field. Yet it remains true that both the priest and the sister may be sure that God wills them to give missions and wax the floors respectively. While the two superiors may not6 have manifested the content'of the divine will, both of them have issued directives that God, as a matter of fact, wants implemented by two religious who have received two specific precepts. Even though the religious superior does rule through a participation in a divinely-given governing authority, he has nonetheless received no divine assurance that his commands are always going to conform to the objective truth of things. The subject, then, sees God in his supe-rior not in the sense that the superior's word must be taken as God's own word, but only in the sense that the superior's command is .given by one who has God's authority to give it. The distinction is important. On the one hand it obviates the untenable conclusion that a re-ligious superior is immune from error in his decisions as superior, and on the other it preserves the necessary postulate that a superior's precept is given on no mere human basis. In view of what we have said one could hardly miss the conclusion that a religious superior ought to weigh carefully the directives he gives. Even though it would be unreasonable to expect him to be objectively right in each of his decisions, yet he should make every effort consonant with the gravity of the matter.to be objectively right. Because he rules with a divinely authorized delega-tion, he should take care that his directives be as closely in accord with the divine intentions as possible. Reli-gious government by whim, directives issued by worldly prudence, commands based on favoritism, prejudice, or misinformation are wholly unbecoming in men and women who rule in such wise that their precepts some-e Our use of the word "may" indicates naturally enough that the two superiors may, as a matter of fact, be indicating the content of the divine will. "May not" suggests also "may." how flow from a divine authorizati+n. Traits of the good superior, then, most assuredly include supernatural pru-dence, a personal selflessness, and a willingness to take and follow counsel. We must note correlatively~that what we have said in this article does not absolve a subject from a perfect obedience to his superior. The fact that God may not "agree" that the decision contained in a particular com-mand is the wisest of all choices does not mean that the subject does well in refusing an obedience of execution, will, and intellect (the last, insofar as it is possible). In other words, our discussion is meant to clarify, not to damage the perfection of our obedience. ÷ ÷ ÷ The Superior's Precept VOLUME 20, 1961 44! R. F. SMITH, S.J. Survey of Roman Documents ÷ ÷ R. F. Smith, S.], REVIEW FOR REI.IGIOUS In this article those documents will be summarized wliich appeared in Acta Apostolicae Sedis during June and July, 1961. All page references in the article will be to the 1961 Acta (v. 53). A New Encyclical On May 15, 1961 (pp. 401-64), Pope John XXIII is-sued a new encyclical, Mater et Magistra (Mother and Teacher), to commemorate the seventieth anniversary of Pope Leo XIII's encyclical on social matters, Rerum Novarum. In the introduction to his encyclical, the Pope observed that just as Christ, though primarily interested in the spiritual welfare of men, was also concerned with their material welfare, so also the Church takes care of the spiritual good of men without neglecting their ma-terial, economic, and cultural needs. Passing to the first of the four parts into which the encyclical is divided, His Holiness sketched the evils of the economic and social situation of the nineteenth cen-tury, evils which occasioned Rerum Novarum. The Holy Father then listed the chief principles of Catholic social doctrine as laid down by Leo XIII and as afterwards en-larged and amplified by Pius XI and Pius XII. In the second part of Mater et Magistra, the Vicar of Christ took up and developed certain points of the teach-ing found in Leo XIII's document. While the economic order/ he pointed out, is the. creation of the personal initiative of private citizens, still the State must see to it that economic development benefits all the citizens. This, however, must be done in accordance with the principle of subsidiarity enunciated by Pius XI in Quadragesimo Anno, a principle which protects the personal initiative of individual persons. In this connection the Pontiff con-sidered the matter of modern economic and social plan-ning which involves public authorities in matters as crucial as the care of health or the controlling of pro-fessional careers: Such planning, he remarked, brings many advantages and satisfies many personal rights;, how-ever, it also makes juridical control of hurfian relations more detailed and creates an atmosphere which makes initiative and responsibility difficult. Hence, such plan-ning should be realized in such a way as to draw from it all its advantages and to remove or restrain its disadvan-tages. ¯ .," Pope John then turned to consider the question of "the remuneration to be given to workers. ~AI1 workers, he af-firmed, should be given a wage that:allows them to live a truly human, life and to face with dignity their family responsibilities. Other factors;~.however; must alsb be considered: the worker's effective contribution to produc-tion, the economic state of the enterprise, ~he require-ments of the common good,both of the country and of the entire world~ " The economic'wealth of a people,., the Pontiff went on to say, must not be judged merely.by, its total aggregate wealth, bht also by its efficacious distributidn~throughout the entire populace. One of the most desirable ways of achieving this distribution~ is to permit th~ w6~kers to participate in the ownership of the enterprise. One last necessity for a just economic system was,underscored by the P6pe'when he obseiwe6that~if the structure of an economic system is suEh~that it compromises human dig-nity by systeinatically removing a" sense of-responsibility and of initiative in the 'worker, then .the system is un-just, even though through it riches are accumulated and distributed according to the rules of justice and equity. Hence the continuing importance today of artisan and co-operative enterprises. And in large enterprises, workers should have an active part, the enterprise becoming a real community with relations between employer and employee marked by mutual appreciation, understand-ing, and co-operation and by a mutual,grasp, of,:th~ en-terprise not,merely as a source of income but,,as the ful-fillment of a duty and°the rendering of a service.:~Workers, he.said, should not be reduced to being merely execu'tors of work, entirely passive in regard to decisions that regu-late their activity. Here the Pope stressed the desirability of associations of workers and the need that the influence of workers'should be extended beyond the limits of~their individual productive units. The Holy Father turned next to the matter of. private property, observing that the modern growth of the dis-~- tinction between the ownership of capital and the man: agement of the larger economic entities, the increase of social insurance and security, and the greater confidence in income and rights from, labor,rather'than from capital ÷ ÷ ÷ Roman, Documen~ VOLUME ;'0, ÷ ÷ ÷ R. F. Smith, $.]. REVIEW FOR RELIGIOUS 444 do not diminish the natural right of private ownership. This right, he said, is fouflded on the priority of individ-ual human beings as compared with society,,is necessary for free and personal initiative in the economic field, and prevents the stifling of freedom. Not only must the right to private property be recognized; equally neces-sary is the recognition of the natural right of its effective distribution among all social classes; added to this must be the acknowledgement that a social function is intrinsi-call~ linked with the right, of private property, for the goods of the earth have been destined by God for the worthy support of. all human beings. In the third part of the encyclical, Pope John took up a consideration of new socio-economic problems that face the modern world. First among these is the extensive exo-dus of farm populations to urban centers. While many reasons lie behind this exodus, the Pope pointed out that among these reasons is the fact that the farm sector lags behind other sectors, in productivity of labor and in living standards. Hence public authorities should see that essential services (education, roads, utilities, and so forth) in the country are suitably developed. Improved produc-tion methods and selective agriculture should be encour-aged. In the assessment of taxes, it should be remembered that in ,farming returns come slowly and are exposed to greater risks; the same considerations should lead to a special credit policy for farmers. Social security and in-surance systems should not give farmers allowances sub-stantially lower than those granted to industrial and other' sectors; there should be an effective system to protect farm prices. At the same time, rural workers should keep in mind the rights and interests of other types of workers as well as those of the common good. They should con-ceive their work both as a vocation and as a mission, as a call ~from God and as a contribution to human civili-zation, The Holy Father next took up the matter of relations between developed and underdeveloped countries. Hu-man solidarity as. well as the doctrine of the Mystical Body forbids that political communities with abundant resources remain indifferent tO the misery and hunger of underdeveloped-areas. Countries with an excess of consumer goods, especially farm products,, should give emergency, aid to the indigent and needy of other coun-tries. This, however, should be ,accompanied by scientific, technical, and financial help to remove the causes of *underde~elopment. In the execution of this aid, social progress should grow simultaneously With economic progress, the native characteristics of the country should be respected, and political interestedness--another name [or colonialism--should be avoided. In giving such aid, it should always be remembered that technology, economic development, and material well-being are and must re-main secondary to spii~itual values. At this point the Pontiff showed how the entrance of the Church into a country has always restilted in social and econbfiaic better-ment. With regard to the problem of the increase in popula-tion and the sufficiency of mea'ns of sustenance, the Vicar of Chi'ist remarked that in a view of the world as a whole there does°not seem tobe at least for the moment and the near future a great difficulty. In any.case ~here is no need for solutions such as birth control which offend the moral order established by God. Even in individual countries and regions where there is an actual dispib'- portion between population arid means of sustenance, such means can not be used. The true solution is to be found only in economic development and in social prog-ress brought about in a moral atmosphere. "A provident God," he stated, "grants sufficient means to the human race to solve in dignified fashion even .the many and del-icate problems attendant upon the transmission of life." The last of the problems to be considered by the Pope was that of world co-operation. All problems of any importance, he began, present today supranational and often world dimensions. Hence the different political -communities can not solve such problems on their own and by themselves; accordingly there is a need for mutual °understanding; such understanding, however, is pre-vented today because of the mistrust and fear among nations. This mistrust exists because some political leaders do not recognize the existence of a moral order that is based or/ God. And without God, c6ncluded the Pontiff, science and technology are powerless to con-struct a civilization. In the fourth and last part of the encyclical, the Pope insisted that whatever technical and economic progress there may be, there will be neither justice nor peace in the world until men return to a sense of their dignity as creatures and sons-of God. This is why the Church is a herald of a way of life that is ever modern. From .her doctrine of the sacred dignity of the individual, she has drawn a social teaching that takes into consideration the realities of human nature, the various dimensions of the temporal order, and the characteristics of contem-porary society. This social teaching, he said, is an integral part of the Christian conception of li~[e and should be known, spread, and put into observance by all Catholics. The executibn of this doctrine will be the work especially of the laity whom, in the concluding sections of the en-cyclical, the Pontiff urges to remain close to. the doctrine of Christ and His Church. ÷ 4- 4- Roman Documents VOLUME 20, 1961 445 R. F. Smith~ S,]. REVIEW FOR RELIGIOU, S 446 Miscellaneous° Documents O~a July 22, 1960 (pp. 3~1-43)~ Pope John" issued an apostoli~ constitution dstablishing an exarchate foi: Ukranians of the Byzantine Ri~e living in .France. The see of the exarch will be in Pari~ and~he will be a ~uffr~igan of the archbishop of Paris; the power of the exarch will be exercised cumulatively with that of the loc'al ordinaries of France. On the sameday (pp. 343-44) a similar exarch-ate was estabhshed for those of the Armeman Rxte hwng in France. On April 23, 1961 (pp. 314-18), Hi~ Holines~ spoke to members of various Oriental rites, exl~ressing his admiration for the grandeu~ of Eastern Christianity and the hope that it will find'in the Pope "the sweetness of David and the wisdom of Solomon." On Pentecost, May 21, 1961 (pp. 358-62), His Holiness delivered an al-locution after he had consecrated fourteen mi.ssionary bishops from Africa, America, and Asia. He told his listeners tha t the. riew bishops w.ere the flowers of the new churches of Africa and Asia,~urged the new bishops to study the cultures and histories of their peoples and to work and firay that these be~b'enefited by the redemotion, and re'~all'ed the centenary of the dea'th of Bish~)p de Mazenod, founder of the Oblates 9f Mar~ Immaculate, one o~ the gre.at nanies in the modern renaissance of mission.activity. On November 24, 1960 (pp. 346-'50), the Holy Father'issued an apostolic c6nstitution establishing the hi.erarchy in Vietnam- with a division into three ecclesiastical provinces. On May 27, 1961 (p. 388.),. the Sacred .Cong~egation'bf Rites issued a declaration according to _which a ferial of the fourth class i~ never to be commemorated in a festive or votive Mass,. even though it be a conventual,, one. Accordingly~the f611owing numbers of the new code of rubrics are to ~be modified to read: N.-26. All ferials not mentioned in Nos. 23-25 are ferials of the fourth class; these ar~never commemorated. N.-289_. [At the beginning] On all'ferials of the fourth clasS . there may be said without a commemoration of the ferial. N. 299. [Second part] On bther ferials the Mass of the pre-cedin~ Sunday is said unless the rubrics provide otherwise. On May q l, 1961, the Feast of the Ascension (pp. 289- 95), Pope John XXIII solemnly canonized Blessed Mary Bertilla Boscardin'(1888-1922), virgin, of the School Sisters of St. Dorothy, Daughters of the Sacred Hearts. Her feast day is to be kept on October-22. In the hom.ily after the canonization, the Holy Father pointed out that the new saint is a l~sson to the~great and wise of this world, for she achieved greatness through humility and ,heroism through hidden sacrifice. He also stated that her sanctity was founded on her family where she learned the secret of constancy, on her catechism which taught her true wisdom, and on her religious vocation which allowed her to give herself entirely to God and to her neighbor. On April 26, 1961 (pp. 381-85), the Sacred Congregation of Rites affirmed the heroic virtue ol~ the venerable Servant of God, Leonard Murialdo (1828-1900), professed priest and founder of the Pious Society of St. Joseph. On'the same day (pp. 385-88), the congregation also affirmed the heroic virtue o1: the venerable Servant of God, Gertrude Comensoli (1847-1903), ~oundress of the Sacramentine Sisters. ~ On April 21, 1961 (pp. 308-14), the Holy Father ad-dressed the First National Italian Congress for Ecclesiasti-cal Vocations. He laid great stress on the influence of priests on vocations, the importance of seminaries for the developing of the human and Christian virtues of future priests, and the need to labor with discretion and zeal for the increase of vocations. On M~rch 25, 1,961 (pp. 371-80), the Sacred Congregation of Religious issued an instruction and statutes to govern extern sisters of monasteries of nun

Issue 50.5 of the Review for Religious, September/October 1991. ; Review Religious Volume 50 Number 5 September / October 1991 50 TM ANNIVERSARY VOLUME REVIEW FOR RI:.LIGIOUS (ISSN 0034-639X) is published bi-monthly at St. Louis University by the Missouri Province Educational Institute of the Society of Jesus: Editorial Office: 3601 Lindell Boulevard, Room 428; St. Louis, MO 63108-3393. Telcphonc: 314-535-3048. Second-class postage paid at St. Louis MO and additional offices. POSTMASTER: Send address changes to R~:\'~EW Foa R~:I,I(;IOUS; P.O. Box 6070; Duluth, MN 55806. Subscription rates: Single copy $3.50 plus mailing costs. One-year subscription $15.00 plus mailing costs; two-year subscription $28.00 plus mailing costs¯ See inside back cover for subscription informa-tion and mailing costs. © 1991 REVIEW I.'Oa R~:t,tc, IOUS. David L. Fleming, S.J. Philip C. Fischer, S.J. Michael G. Harter, S.J. Elizabeth McDonough, O.P. Jean Read Mary Ann Foppe Editor Associate Editors Canonical Counsel Editor Assistant Editors David J. Hassel, S.J. Iris Ann Ledden, S.S.N.D. Wendy Wright, Ph.D. Advisory Board° Mary Margaret Johanning, S.S.N.D. Sean Sammon, F.M.S. Suzanne Zuercher, O.S.R September/October 1991 Volume 50 Number 5 Manuscripts, books for review, and correspondence with the editor should be sent to R~:vlt:W FOR R~IGIOUS; 3601 Lindell Boulevard; St. Louis, MO 63108-3393. Correspondence about the department "Canonical Counsel" should be addressed to Elizabeth McDonough, O.P.; 5001 Eastern Avenue; P.O. Box 29260; Washington, D.C. 20017. Back issues should be ordered from R~:\qt:w yon R~lC,~ous; 3601 Lindell Boulevard; St. Louis, MO 63108-3393. "Out of Print" issues are available from University Microfilms International; 300 N. Zeeb Road; Ann Arbor, MI 48106. A major portion of each issue is available on cassette recordings as a service for the visually impaired. Write to: Xavier S6ciety for the Blind; 154 East 23rd Street; New York, NY 10010. Are you reading someone else's copy? If you are, it is time to order a subscription for yourself or your community. Review for Religious is a valuable resource at a reasonable price. Each 160-page issue is filled with articles on Practical approaches to community living Traditional and contemporary methods of prayer Reviews and notices about current spiritual literature Mail in the coupon on the back of this page today and don't miss a single issue. Yes! Send Me a Subscription. ONE SUBSCRIPTION PRICE FOR ALL COUNTRIES US $15 for one-year subscription US$28 for two-year subscription plus mailing costs listed below / MAILING COSTS TO BE ADDED TO ALL SUBSCRIPTIONS FOR THE UNITED STATES AND ITS TERRITORIES Add US$3 for one year Total: US$18 Add US$ 6 for two years Total: US$34 FOR ALL OTHER COUNTRIES (SURFACE MAIL) Add US$ 9 for one year Total: US$24 Add US$18 for two years Total: US$46 FOR ALL OTHER COUNTRIES (AIRMAIL/BOOKRATE) Add US$ 28 for one year Total: US$43 Add US$56 for two years Total: US$84 d/~ ¯ Please enter a subscription to REVIEW FOR RELIGIO f : NAME ADDRESS CITY STATE/PROVINCE POSTALCODE COUNTRY [] [] 1-year subscription us$15 + Postage __ = Amount Enclosed __ 2-year subscription uS$ 28 + Postage ~ = Amount Enclosed __ Please note that all subscribers must add postage. Payment in US funds must be included with all orders. Prices are good through 1991. This order is for [] a new subscription [] a renewal [] a restart of a lapsed subscription MAIL TO: REVIEW FOR RELIGIOUS ¯ 3601 LINDELL BOULEVARD ° ST.LouIs, MO 63108 IIII III IIII II IIII III I PRISMS. What did you go out to the desert to see? A prophet? The question which Jesus asked his own people takes on a special poignancy for us toda~y in the Church. Our biblical tradition indicates that God raises up prophetic people in dark and difficult days. Because many see the time of renewal called for by Vatican II as a period of continuing strug-gle and tension--sometimes sadly with positions defended or fixed rather than with dialogue explored--affecting people and priests in parishes, bish-ops in national hierarchies, and religious in the same congregation, there is a greater tendency today to go running out, searching for a prophet. As usual there is also the temptation for some to play the prophet. But the prophetic tradition strongly emphasizes that tree prophets do not identify the role for themselves. God plucks people out of ordinary circum-stances, evokes some kind of personal conversion, and then speaks and works through them, even in their own reluctance for the role, and in their fear and trembling. Although we tend to apply the word prophet glibly to some modem-day leaders, educators, and writers, we perhaps are not far off the mark when we search for those movements and calls of God that come in incremental ways through ordinary-looking people and events. It is to acknowledge that prophets, like saints, have a range from "capital P" prophets (like our canonized "capital S" saints) with a major message of modeling and influence ~o the almost hidden (because of everydayness) small-letter prophets who in limited and confined ways raise questions, sug-gest new directions, make us uncomfortable, and at the same time give us hope. Prophets of lasting influence are s~arce at any time in our world's his-tory. Yet we may find it all too easy, even now, to mute the "smail p" prophet either ir~ our fixated search for major prophetic voices or in our disdain for less-than-radical calls. The even greater loss, however, happens when we may intentionally or unintentionally downplay our own lived (small p) prophetic witness to Christ's values--an integral part of our own chosen way of life. Review for Religious has been p~rivileged through the years to present voices of personal witness and articles of challenge and critique which repre-sent this common spectrum of our e ~eryday prophets. In this issue, "Inner Africa: A Journey of Conversion" by Susan Rakoczy is a personal witness to 641 642 / Review for Religious, September-October 1991 God's continuing call to go beyond a familiar homeland and to pay its enlivening costs---costs borne more within oneself than without. Jean Steffes considers directly in her article the theme of the prophetic-witness aspect of contemporary religious life. The articles by Giallanza, Levey, Arbuckle, and Mueller give further reflections on various aspects of religious life that affect its present and future witness. From the area of contemplation, the ground of all prophetic activity, Joseph Tetlow uses a very simple image from the changing seasons of the year to present an understanding of God's calls and our responses for a com-monplace continuity of spiritual growth. In a similar way Gerard Luttenberger sees through the contemplative Fourth Mansion of St. Ter6sa a way of praying apostolically. A prophetic relationship of faith with our United States culture grounds Hoffman's treatment of creative leisure and, in a very different fashion, Hinojosa's suggestions for formation, as he espe-cially has the Hispanic candidate in mind. Rywalt shares his experience of the sometimes dark journeying required of religious trying to follow God's lead in the transfer process in this consecrated lifeform. The prophetic and priestly people which we are will find fresh insight into the manna-food for our joumeying in Billy's "The Bread Kernel," clari-ty in Meyer's restating of the ministerial priesthood foundation through a deeper appreciation of an ambassador's role, and consolation in the gentle wisdom of living reflected in McDonald's "Faithful Servant." Perhaps, in our effort to identify prophets, McDonald's theme goes right to the heart of the matter. No truer discernment or greater tribute can be given to any prophet, spelled with large or small p, than to be identified, like Moses, as a faithful servant of God. David L. Fleming, S.J. Four Seasons of the Soul Joseph .4. Tetlow, SJ Father Tetlow wrote "The Mirror in the Field" for our November/December 1988 issue. His current address is Jesuit Hall; 3601 Lindell Boulevard; St. Louis, Missouri 63108. I~uring the experience of the Ignatian Spiritual Exercises, you have a sense of movement and of progress. Particularly during a nineteenth-annotation experience of them, you have the sense of getting along with things and of genuine growth in God. When you have finished the Exercises, if you are like many exercitants, you miss that sense of movement and progress. Even though you continue to pray as long and as seriously as you did during the Exercises, you may well come to wonder where "growth" has gone, and a sense of your life in Christ unfolding for you. You know how times of consolation and times of desola-tion mark spiritual growth or its absence, but this is the microeconomy of the spirit, a topological map of a mountain that does not tell you which range it is in or even which hemisphere. You might find some sense of getting along by applying the traditional phases or stages of spiritual growth. You would recognize, to start with, the stages of the purgative, illuminative, and unitive ways. You have heard of the Dark Nights, of the Senses and of the Soul. But reading these stages requires great expertness and an intense concentration on the interior life. You may find them of limited help in reading your growth in the Lord while you live an ordinary life in the world. Furthermore, these traditional stages of spiritual growth have focused tightly on the individual spirit. They do not comprehend a lot of the "your life world." They do not illuminate the interplay of others' needs and inter-ests with your own, or the tension between remaining faithful to your self and growing more faithful to those whom God gives you to love and be 643 644 / Review for Religious, September-October 1991 loved by. Each of these traditional ways of gauging where you are in your interior life instructs you how to pray at a given time and what to pray about. They do not much tell you what to pray for. Now that you know the Spiritual Exercises, you might find it useful to think of phases or stages of the interior life in terms of the Four Weeks. You can take the Weeks as seasons distinct from one another. They really do match the phases or stages of growth that we go through as we live contem-platives in the active world. If you interpret your experience in these terms, you will not find a lot of instruction on what to pray about (that instruction will rise out of your current experience), but you will find sound instruction on what to pray for. The Seasons of the Four Weeks Think of the seasons not as four parts of one whole life, but as a cycle that we all go through in our life world. Consider life as a whole at this given moment, and picture how it is colored seasonally. The first season would be like this: You go along working hard and praying easily. You feel like springtime, and your whole self sprouts new life. Your life world seems filled with promise. Life is given to you, rising up from within your self and teeming all around you. In such a time, you are in the season of the Fourth Week. The truth is that Jesus came to "give you joy, and to the full," and he was transcendently powerful to achieve what he set out to achieve. As you know, we are created to live in consolation, which means that we share the sureness of the risen Christ that the reign of God comes, for each one of us and for all of humankind together. So we live in the joy of Christ, as we have a fight to do, and this is the Fourth Week. You enter Christ's joy, in work and in prayer. Ask yourself: During this springtime, what do you ask for? You go through times, as all of us do, of confusion and darkness, your inner world and life world matching. Your life world itself may be in tur-moil, and perhaps threatens your family, career, or health. All of us have experienced these times as wars succeed one another and one national crisis after another: toxic waste, the Savings and Loans debacle, the awesome national deficit. In a very real sense, when we suffer these times we are bear-ing the sins of all peoples--the sins of unjust rulers, of greedy people with economic power, of self-centered people who feed on us. In these times you feel powerless and perhaps even helpless. You live in depression or doubt or perhaps even jeopardy. In such a time you are walk-ing with Jesus Christ in his Passion. This is not merely metaphor: our Master warned us that we would feel persecuted and hunted, for if his life world Four Seasons of the Soul / 645 treated him as it did, then we are to anticipate faring no better. St. Paul said that we are to fill up the sufferings that Christ Jesus has still to undergo for the sake of his body, the Church. Sometimes we live in the Passion of Jesus, feeling the terrible weight of taking up our cross daily. In this wintry time of the Third Week, what grace gives you a sense of growth and movement? Again, at times you seem merely to be working along from day to day. You do not feel any great consolation or any notable desolation. You trust God by enacting your own desires and conscience and by doing the next good thing. You do not feel any great pressure to have life all figured out, or the vexing pressure of strong temptation to this or that sin you are prone to. You pray to the Father and listen to the Spirit. You live out your discipleship faithfully and enduringly. This is the Second Week, as you walk with Jesus of Nazareth, either in the long decades of his hidden life or in the brief exertions of his public life. It is full summertime, and you are growing in God. You take summertime concerns to prayer and stay with Jesus proclaiming his Good News. But summertime can seem lazy and unmoving. What grace will help you sense progress? Finally, there come times when you feel the weight of your own sin. You do again something that you thought you had truly put behind you. You fail to do something that you had set yourself most resolutely to do. You are in the First Week again. You find out that your ideal has little of the noble in it, or that your self-image includes falsehood, or that you have been acting as though you loathe your self and despise your life. Then you feel the deep burning of shame. Or you realize that you have been violating your own conscience, deliberately deceiving your own self and spreading your poison around you. Then you feel the icy sting of guilt. Yet all of this time you already know how God loves you, even how God keeps on being your Creator and Lord. This is the season of fall, when you join the cycle of life and death that belongs to this earth of ours. You flirt with spiritual death, but you know that you will not die, but live. You cannot doubt that God forgives again and again, and you take into your prayer that utter confidence in God's forgiving love. This is the season of the First Week. Once you have asked God's forgiveness, what else are we to ask for in order to have the experience of movement and growth? It is to find the answer to this question that you think in terms of the sea-sons of the Four Weeks. Other stages and phases instruct us in the kind of prayer we might give ourselves to. The "unitive way," for instance, suggests a prayer of deep quiet. Other stages help us hold onto the kind of faith and 646 / Review for Religious, September-October 1991 hope we need to exercise. The Dark Night of the Senses helps us know that it is, indeed, faith we are exercising, and not doubt. Other stages or phases name kinds of temptation and grades of consolation and desolation. A pray-ing person who has been drawn to apophatic prayer will readily recognize daydreams of food as a desolation. But the stages and phases give little instruction on the very humble question of what, specifically, we are to ask for. Or perhaps more accurately, what instruction they do give is not readily accessible to the majority of praying Christians. "I Ask for What I Want" Matching the Four Weeks with the seasons of discipleship suggests immediately and accurately what you ought to ask God for. Each of the Weeks has a specific grace. These specific graces are precisely what we need in each of the four seasons of discipleship. When we feel the burning of shame or the icy sting of guilt, obviously, we ask forgiveness. Equally obviously, we receive this forgiveness even before we ask it. Then what? You would immediately reject dwelling on the shame or the guilt. You would repudiate self-lacerating examination. What you need is a sense of your complicity in humankind's sin, and a sense of how the disorder manifest in your life world lies waiting to manifest itself in yourself. You can ask for that plainly, and you will have a sense of getting on with God's project. You can also ask another gift of the First Week: the answer to the three questions in the colloquy of the first exercise. The deepest grace of the First Week is to be given eyes to see Jesus Christ. While you stand under the cross of Jesus Christ, you ask yourself, "What have I done for Christ? What am I doing for Christ? What might I do for Christ?" The growth and movement in answer to this prayer have to do with understanding the past and looking to the future. If you have been sinning, then start with how God succeeded in you, with what you have done for Christ. If you are acting sinfully, you need to attend to what else you are now doing: What are you doing for Christ? And as you repent yet again, you stand with Christ and ask what you might do for him and for his body the Church. This is the growth in the season of fall. A second season: of busyness. Your attention runs in a hundred direc-tions. You face concrete decisions hour by hour. You have to deal with oth-ers day after day. You have to remain authentic to your own self and grow more and more fully a member. Here, in this heated season of summer, you might ask most appropriately for the gift of the Second Week: to know Jesus Four Seasons of the Soul / 647 better, to love him more, and to go the way he goes. He has been through this summer and through the desert of busyness. For some the life of the Lord will be an inspiration (as Carl Gustav Jung said it ought to be). They will learn from Jesus of Nazareth how to relate in the dusty marketplace to the God who chooses to be father and mother to us. For others the life of the Lord will be an example for imitation (as the Church has taught since Jesus proclaimed himself Way, Truth, and Life). For all of us, growth in God means growth in loving Jesus of Nazareth who is the Christ. That is the grace you ask for in the summer, the Second Week. When winter comes upon your self and your life world, you cannot escape suffering. Well, in the Third Week, you have watched with Jesus through his Passion. Remember this accompaniment and what you asked for then. Perhaps you will ask to accept your suffering in compassion with Jesus suffering and to know shame "because the Lord is going to his suffering for my sins," while you have acted in complicity with all humankind in sinning. This is the grace of the first contemplation at midnight. In any pain or suffer-ing, growth will lie in and through compassion. You might be drawn, again, to ask that your own suffering somehow be "with Christ in sorrow, [your] anguish with Christ in anguish, [your] tears and deep grief because of the great affliction" Christ endured for you. This is a great gift, and those who embrace their own suffering in the world know what Jesus knew. This pain will end nothing, but will end; ifI can discern no movement toward life, I know my growth is where I am; God is faithful. This prayer to God transmutes a wintry time from merely a depression or recession or grave aggravation to a time of growth in Christ. Finally, when you live in happiness and your life world hums along in springtime, you can most reasonably beg God that you enter into the joy of Jesus Christ. There lies the way of movement and growth, first of all because you will not be immobilized by anxiety. We hold the happiness of earth tightly because it is given and taken away, apparently randomly. Unlike the joy of the earth, Jesus' joy is not given and taken away; it is given and to the full. Growth does not mean having things permanently or living secure or figuring everything out. All of these are illusory, and depending on any of them is writing on water. Growth for Christ's disciples entails precisely shaking off dependence on possessions and all defense against risks of personal encounter. You grow a more complete self with every deeper realization that God's is the initia-tive, the victory, which is Jesus' joy and glory. You grow more secure as you accept more and more fully that you did not earn life or joy and that, if you can make no demands, the One who gives constantly turns out more willing 648 / Review for Religious, September-October 1991 to lavish gifts than you are to accept them. This is Jesus' joy and his glory. So in these springtimes we find our growth in begging "to be glad and rejoice intensely" not because of the great go6ds God is bestowing on us, but "because of the great joy and the glory of Christ our Lord." A Simple Matter of Moving Along Understand, the Four Weeks are not epigenetic stages that build one on another in succession, with the latest stage transmuting the earlier ones. This is the model used by Erik Erikson and the growth psychologists, and it is not appropriate here. The "seasons" mean something much simpler here. Nor does the word refer to an account of the adult life cycle, the "seasons. of a person's life" devised by Daniel Levinson and his colleagues. The "seasons" here are briefer and include not only internal dynamics but also the actuali-ties of your life world. As phases or stages, they would hardly be long-term and do not name permanent changes in the self. Think of it this way: Many skilled retreat directors begin an eight-day retreat by asking the retreatant what Week they are living. The retreat guide does not imply that the retreatant is going through a life cycle or.a phase with permanent effects--nothing so essential and long-range. The implica-tion is that we all go through certain seasoris and that we can usefully think of those seasons in terms of the Four Weeks of the Spiritual Exercises. Many who have made the Spiritual Exercises yearn to keep the sense of progress and of forward motion that sustained them through the long days or months of prayer. They can help themselves do that by continuing one exer-cise that promoted that sense of progress during the Exercises: the preparato-ry prayer. Even those who turn to the Church's lectionary for the material of daily meditation or contemplation can ask for the special grace of the season they are in. They feel no unease or contradiction. On the contrary, they have a sense of familiarity and consonance, and a sense of getting on with life and with prayer. Few of us feel inclined to go back through the prayer texts and cycles of the Four Weeks, particularly over and over again. But you might find it useful to keep mindful of the special graces of the Weeks, and of the preparatory prayer. Re-creating Religious Life Joel Giallanza, C S. C Brother Joel recently completed his service in the ministry of provincial administra-tion and is currently Adjunct Retreat Director at Maryhill Renewal Center. His address is Maryhill Renewal Center; 600 Maryhill Road; Pineville, Louisiana 71360. /'~mong the principal tasks confronting religious life as the twenty-first cen-tury approaches is refoundation or, more descriptively, re-creation. While religious may not be completely comfortable with the demographics of increasing ages and decreasing numbers, they do not appear discouraged or despairing about the future: In fact, some communities have been reporting a modest and consistent increase in vocations and new apostolic ventures. Chapters, assemblies, and other gatherings of religious continue to search for the most effective means of responding to the needs of the Church and the culture in which they live. Among those means they assign high priority to ~'efounding or re-creating religious life itself. To that end, religious have explored the !ives and teachings of their founders and foundresses as well as the experiences and events which shaped the darly years of their communi-ties. The work now is to interpret those lives, teachings, experiences, and events for further practical application to contemporary religious life. The work now is to prepare for the future. Any creation, by its very nature, does not follow a predetermined blueprint. Nevertheless, there is one primordial model we can consider: "In the beginning God created the heavens and the earth." These reflections will focus on the first three days of creation as a metaphor for the re-creation which religious need to undertake as they move toward and into the twenty-first century. In the Beginning During the first three days of creation, as Genesis relates the story, God 649 650 / Review for Religious, September-October 1991 separates creation, giving each part a distinct identity. Only after this funda-mental work of separation and identification does God begin the cultivation of creation, filling it with a rich variety of living things, culminating in the appearance of humanity. Day 1 ~ Observation In the beginning God created the heavens and the earth. The earth was without form and void, covered in darkness; and the Spirit of God was moving over the face of the waters. God said, "Let there be light"; and there was light. God saw that the light was good; and God separated the light from the darkness. God called the light Day, and the darkness he called Night. And there was evening and there was morning, one day (Gn 1:1-5). It is intriguing that, after the heavens and the earth, light is God's first creation. Light enables us to observe and to distinguish; light enables us to see what needs to be done. God was present and active, though creation was covered in darkness. The creation of light makes observation and identifica-tion possible. Thus, light is distinguished from darkness; the former is iden-tified as day, the latter as night. Re-creating religious life involves observation. Religious must look courageously and see clearly the quality of every aspect of their lives and then distinguish between what will enhance that quality and what will not. To some degree this self-observation has been going on as religious respond-ed to the Church's call to read the signs of the times. However, with chang-ing demographics and subsequent adjustments to communal life and institutional commitments, religious need to refresh their response to this call and examine their lives yet more closely. In recent years apostolic religious life has known what it is to be "with-out form and void, covered in darkness." Some of this experience stems from the demographics and economics which have signaled the significant change--if not the death--of the religious life of twenty-five years ago. Some stems from the communal, ministerial, and structural implications of those demographics and economics. Some stems from modifications which religious themselves initiated through the process of'revising their constitu-tions and the traditional practices of their personal and communal lives. The ways in which religious live and minister and organize their congregations have changed and no doubt will continue to do so. Clearly, religious life has responsed to the Church and the cultures in which it witnesses. That religious life has undergone change is by itself no indication that nothing further need be done. Could the formlessness, emptiness, and dark- Re-creating Religious Life / 65'1 ness which religious sometimes feel about their way of life be the result of not observing areas needing yet further clarification and identification? These observations of mine focus on one area central to the lives of apostolic religious: celibate community. There is an asceticism inherent in any way of life in which two or more individuals have committed themselves to one another. Principally, that asceti-cism involves maintaining the common good over personal preferences. The acceptance of such an asceticism is essential to a healthy marriage and family life and to a healthy celibate community. Without that asceticism, the basic mutuality of the commitment begins to erode, and eventually the passion and dynamism within the relationships dissipate, then disappear altogether. If we observe the quality of our celibate community life over recent years, we have to ask whether there are times when consecrated commitment degenerates into corporate complacency. This is not to imply that religious have lost the ability to live community. Rather, it asks whether we have suf-ficiently explored other models of living a celibate communal lifestyle with-in the heritage and tradition of our congregations. Frequently in the past, community "happened" in a relatively large resi-dence associated with a congregational ministry. The daily schedules and general patterns of life within the community were much influenced by the needs of the ministry. Generally, those schedules and patterns reflected and were consistent with individuals' expectations. As ministry diversified (and individualized) during the last twenty-five years, expectations also diversi-fied. Common schedules and patterns became less possible and less realistic, given the broad spectrum of responsibilities and time commitments of local community members. Unless those expectations are observed, articulated, and modified as necessary, particularly in residences originally associated with a single ministry, those members unable to be present at certain times and events can be branded as having lost their sensitivity to or even their appreciation of the value of community. The ways in which expectations are lived are not solely internal; others observe how we live together, for better or for worse. Coworkers and other associates shape their perception and understanding of religious life by the pattern and quality of life they observe among us. Though we cannot live our lives in slavery to the multiple, diverse, and often inconsistent expecta-tions and assumptions with which others characterize us, we should not for-get that religious life is a form of witness to the Church and the culture. It bears a responsibility to be a living example of the Gospel and a working model of Jesus' mission. We need to observe our life as celibate community with a probing and 652 / Review for Religious, September-October 1991 questioning eye. Are our communities prayerful, hospitable, and happy? Do we take individual and collective responsibility for the house in which we reside? In our communities, can we comfortably and frequently discuss the Gospel, faith, and religious life? Do we invite and welcomethose consider-ing religious life? Do we enjoy one another? Do we know one another? Do we live our life together with passion? Day 2 -- Separation God said, "Let there be a space between the waters, and let it separate the waters from the waters." God made the space and separated the waters which were under the space from the waters which were above it. And it was so.And God,called the space Heaven. And there was evening and there was morning, a second day (Gn 1:6-8). With the dawn of the second day, God begins to put order into creation. Specifically, he makes some working room, so to speak, space in which to continue and complete the work of creation. If the first day emphasized observation and identification, then this second day emphasizes separation and distinction. Re-creating religious life involves separation. In recent years religious have spoken and written much about the need for continuing renewal. Chapters and other gatherings have focused extensively, and sometimes exclusively, on the renewal and refoundation necessary for religious life to be a continuing evangelical and apostolic force. Chapter documentation often remains disembodied as the demands of ministry and the routines of daily life reassert themselves after the chapter closes. Patterns of life change neither quickly nor easily. Regardless of how sublime and profound chapter proceedings may be, we will never effectively legislate renewal and refoun-dation. We must provide space for patterns of individual and communal life to be re-created. For celibate community, the observation and articulation of differing and conflicting expectations may suggest creating some new space. Can quality of life be sustained and intensified if those expectations are left to coexist without enough space for coordination? But, on the other hand, if coordina-tion becomes synonymous with the lowest common denominator, is the effort to provide such space worthwhile at all? Sometimes, no doubt, coordi-nation will bring about re-creation, but this does not seem to be the normal pattern; more often than not, re-creation by separation should be considered. Separation will involve establishing new local communities. Alternative housing could be provided for members who are committed to exploring and implementing a communal lifestyle that will meet their expectations and Re-creating Religious Life / 653 maintain a consistency and an integrity which reflect clearly their commit-ment as religious. The assumption here is that such alternative communities would be established with the highest common denominator as the standard. Prayer and relationships and the practice of the vows would be regularly reviewed to assure that standard. Separation is not schism, it is not a condemnation of other communal lifestyles within a congregation. Twenty-five years ago it was possible to find striking, and even exact, parallels throughout the local communities of a sin-gle congregation. Often those parallels were evident among many congrega-tions, also. Today, even between large local communities of the same congregation, we can find striking differences. Separation has to do with dis-tinction, not division. It seeks to express the rich diversity of ways in which a congregational heritage can be embodied among those committed to it. Major superiors have a significant role in this, a multifaceted role. First, they can take the initiative of identifying people and providing resources for new ventures even if the original initiativecame from community members themselves. The major superiors' involvement could signal the validity of the venture for those whose first reaction is critical. Second, major superiors can offer their support, encouragement, and assistance as new communities get underway. When some "red tape" needs cutting or some bureaucratic procedure needs streamlining, they are usually in a privileged position for expediting whatever needs to be done. Third, they can serve as initial observers and objective consultants for new local communities, Their role is not to mold groups into their own image and likeness, but to see that the members remain faithful to the principles and practices they have agreed upon for their life together. Finally, major superiors can be a buffer between nascent local communities and the established community. Not everyone in the latter group will agree with new ventures and the direction they repre-sent. Major superiors should avoid any defensive posture which would make the new communities look like aberrations in the eyes of the established community. They should focus their explanations about these ventures on their continuity with the congregational heritage. Separation is a means of re-creating celibate community; it is an invest-ment in the future. No doubt there are risks involved, but the prophetic nature of religious life has always placed religious in precarious situations. The risks are a challenge to acknowledge God's providential presence and activity. As religious we must reaffirm our faith in providence and move boldly into the future. Without faith, we undermine the very foundation of our religious life; without movement, we betray any assurance we profess to have about the future. 654 / Review for Religious, September-October 1991 The future will come, but not in a vacuum. The choices we make now will determine the quality of that future. In making those choices, we need to create a fresh space, to provide a place for the future. Day 3 -- Cultivation God said, "Let the waters under the heavens be gathered into one place, and let the dry land appear." And it was so. God called the dry land Earth, and the waters that were gathered he called Seas. And God saw that it was good. God said, "Let the earth produce growing things, plants bearing seed, and fruit trees bearing fruit containing their seed, each according to its kind, upon the earth." And it was so. The earth produced vegetation, plants bearing seed according to their own kinds, and trees bearing fruit containing their seed, each according to its kind. And God saw that it was good. And there was evening and there was morning, a third day (Gn 1:9-13). The third day brings cultivation to what has been created. With the emergence of land, "growing things" can appear; each of these growing things contains individuality and generativity. Life--and all of creation-- will continue; there will be another day. "And God saw that it was good." With this third day, God has completed the foundation for what will appear on the succeeding days of creation. And the foundation was good. Re-creating religious life involves cultivation. The future quality of celi-bate community will not appear by spontaneous generation, nor will it be manufactured according to elaborate specifications. It must be cultivated. Establishing new local communities does not signal the dawn of the seventh day; it is not the time to rest and lay aside further efforts. Quite the contrary, it is the time to move forward enthusiastically and confidently with every-thing that has been initiated thus far. This is the time for "growing things?' The root of the word cultivate is a term which can be translated "to move around" and "to dwell," depending upon the context. This dual ety-mology is quite appropriate for these present reflections. Cultivating celibate community requires some moving around. Community compromises vitality if it stops moving according to its own informed choices; that is, if it begins to operate on automatic pilot. Vitality springs from the continuing observa-tion and articulation of expectations. Patterns of personal and communal life must be mutually monitored with integrity and without fear of reprisal. Relationships must be nurtured naturally With quality time and refreshed regularly through reconciliation. Cultivation assumes that expectations and patterns and relationships will evolve. Cultivation flourishes in an environ-ment of exchange, interest, care, and concern. Cultivation moves around Re-creating Religious Life / 655 within and among community members to prevent that stagnation which taxes commitment and tempts to convenience. Cultivating celibate community requires some dwelling. Cohabitation is not celibate community; it merely means that two or more people inhabit the same residential space and need not involve any interpersonal commitment. Dwelling goes beyond living together to include entrusting our lives to one another. If we do not have mutual trust with those with whom we live, then what grounds do we have for claiming we entrust our lives to the Lord? It is a basic tenet of faith that the quality of our relationships with one another verifies or falsifies the quality of our relationship with the Lord. Truly dwelling with one another, recognizing that our life together makes a home of the house, is a certification of our love relationship with one another and with the Lord, and a witness of integrity to others. There is no flawless formula for assuring cultivation; it involves all the effort, discipline, and asceticism requisite for any healthy relationship. There are, however, some principles which can support that effort, discipline, and asceticism. First, clarity of vision: Members must have a sense of the direction in which they hope the community to move. More than an in-house conve-nience, that vision is part of the apostolic character of celibate community. Second, communication of values: A common vision is built upon shared values. Without this sharing, there is little common ground to cultivate; com-munity quickly becomes an arid land. Third, cooperation for vitality: This is a discipline and an asceticism which positions the common good as the high-est priority. The vitality of vision and values can be cultivated only coopera-tively; it cannot be assumed. Fourth, concern for vocation: This is the foundational principle. Vision and values have no vital and substantive pur-pose and meaning unless community members share a sincere concern for the integrity of their commitment to the vocation of religious life. In practice, these principles are skrategies which must characterize the re-creation of celibate community. Cultivation is a daily enterprise which will mark the presence and activity of community members with one anoth-er. Thus, cultivation never comes to a point of sufficiency, beyond which no further efforts are necessary. There will always be both peaks and plateaus in the quality of life within any community. The principles of clarity, communi-cation, cooperation, and concern are reminders that neither the peaks nor the plateaus are places of permanence. We must cultivate celibate community if it is to have a prophetic place in the future and even if it is to have a future at all. We must cultivate it since the culture will not support it. We live in a culture whose materialistic, indi- 656 / Review for Religious, September-October 1991 vidualistic, and sensualistic preferences and practices have compromised its capability for fostering the personal commitment which lies at the heart of both celibacy and community. The decline of marriage and the family is but one testimony to that compromise. Celibate community can stand as a prophetic sign that such a commitment is humanly possible. For the future, that sign may be the small seed which is cultivated into the means of trans-formation for the entire culture. In the Days to Come "In the beginning God created the heavens and the earth." As the story is presented, nothing existed before God began his creative work. Everything could be made as an original, without the pressing and pressuring influence of a long-standing tradition. God could, so to speak, work from scratch. Re-creating religious life, and celibate 'community in particular, cannot assume the absence of any influence. There are values and traditions and practices by which communal religious life has endured and prospe,red over the cen-turies. The observation, separation, and cultivation which will position reli-gious life for re-creation cannot dismiss that influence as unnecessary, nor distance it as untouchable. The influence of those realities which have shaped religious life can be incorporated and assimilated into the re-creation; thus will be their creative transformation. Admittedly, some refinement may be necessary to preserve the spirit of those values, traditions, and practices. Nevertheless, such refinement is not a ruling of inadequacy, but a rendering unto new life. In the days to come we must observe closely the ways and means of our religious life together. We need to articulate clearly and forcefully the values by which we will actually live.Prophetic statements from individuals or chapters or other gatherings that remain forever disembodied phrases will never be true characterizations of religious life. Indeed, they can become pharisaical, lofty ideals without living intent. Observation, as I have used the term, has more to do with enacting motivation than with simply gathering information. In the days to come we must separate ourselves from whatever patterns of life have compromised or constricted our desire and ability to live our religious commitment with intensity and integrity. We must re-create the spirit of being called, of being set apart for the Gospel. Without that spirit, the prophetic prowess of religious life is neither affectively experienced nor effectively expressed. Within that spirit, religious life claims the power and proclamation which are the inheritance of Gospel witnesses. In the days to come we must cultivate our life together. We need to re- Re-creat.ing Religious Life / 657 create the commitment we have made to God and to one another. We have at our disposal a power for and a promise of common life that can bring hope to a world broken by betrayal, gouged by greed, and disheartened by deceit. The passion with which we live our celibacy, poverty, and obedience will counteract the standards set by that betrayal, greed, and deceit. The convic-tion with which we re-create and realize our communal life will cultivate and confirm the presence and activity of the kingdom within and around us. "In the beginning God created the heavens and the earth." This is an old story, but one that may be enacted once again as religious life approaches the twenty-first century. Observation, separation, and cultivation are strategies which can support the work of re-creation; and yet we should never displace the fundamental truth that this is God's work, all is grace. The alliance between those strategies and that grace will enable us to speak of religious life and of celibate community with the same bold confidence which marked Yahweh's promise for the temple. "The Lord Almighty speaks: 'Is there any-one among you who can still remember how splendid the temple used to be? How does it look to you now? It must seem like nothing at all. But now do not be discouraged, any of you. Do the work that is needed, for I am with you, so do not be afraid . In the_days to come the new temple will be more splendid than the old one, and there I will give you prosperity and peace' " (Hg 2:3-4, 9). To the Bird of My Prayer Songster, your hymn of praise Never ceases in a melody all your own; Chanting a song--pleading, thanking-- With the sheer joy of having voice to sing. From highest pole to roof, you find your perch, No earth-bound bush can stifle flight to God. Anna Louise Staub, S.S.J. 217 W. Commercial St. East Rochester, NY 14445 Prophetic Witness in Contemporary Religious Life Jean Steffes, CSA: Sister Jean Steffes has been general superior for the Congregation of the Sisters of Saint Agnes. Her address is: 427 Gillett Street; Fond du Lac, Wisconsin 54935-4598. The notion of being prophetic in today's society can conjure up many images in us, depending upon our perspective. For some of us being prophetic might seem a quality to be admired in Dorothy Day, Archbishop Romero, the martyred Jesuits of El Salvador, and the Agnesians Maureen and Teresa of Nicaragua, but one to which we could never aspire. It wo~ld mean speaking, acting, or giving witness in larger-than-life situations that may never be the platform for most of us. Another perspective might give rise to images of angry demonstrations directed at society and culture or at our Church. The call for greater inclusion of women in roles in Church and society, for the right to life of the unborn, the unwanted, and the elderly, and for the preservation of our environment can result in tactics that seem or are angry. For those who shrink from such approaches, even the very valid and necessary content can be lost. A third image of the prophet (which we may enjoy) is of one who foretells the future. In our society there are those who use past patterns to predict our economy's collapse or other dire conse-quences. For those of us who live a Gospel faith, such prophets do not give the hope so necessary to engage in present realities and so make the world a better place here and now. The images I have shared are overdrawn stereotypes, but they show the difficulty in speaking on the topic of prophetic wit]aess. In this reflection I will explore three broad areas: (1) What does it mean to be prophetic? (2) prophetic witness and the current experience of religious life: (3) an agenda for the future. 658 Prophetic Witness / 659 What Does It Mean to be Prophetic? Walter Brueggemann says in The Prophetic Imagination, "The time may be ripe in the church for a serious consideration of prophecy as a crucial ele-ment in ministry."~ Prophets understood how change is effected. They knew the power of language, how to "evoke newness, 'fresh from the word.' ,,2 Let us develop at some length Brueggemann's ideas of prophecy. He states, "The task of prophetic ministry is to nurture, nourish, and evoke a consciousness and perception alternative to the consciousness and perception of the domi-nant culture around us . ,,3 I believe his approach can help us understand prophetic witness as it applies to the goals and meaning of religious life. Beginning with the story of Moses, we can learn what it means to form an alternative community. The story of the Exodus shows us how Moses and the Israelite people were brought out from their domination by an imperial religion and the politics of oppression and exploitation. The religion and pol-itics of Pharaoh worked hand in hand to keep him in power and control. Through the interaction of Moses and Aaron with Pharaoh and his regime, the Israelites began to see the difference between the freedom of God and the lack of freedom of the Egyptian gods. Belief in the Egyptian gods served to maintain a social order that allowed for oppression and exploitation. The God revealed to the Israelites is tied to no social order. God is a God of free-dom who calls for an alternative community built on the politics of justice and compassion. The alternative consciousness that Moses fostered in the Israelites was both critical and energizing. His critique, validated when the Egyptians were struck by plagues which their gods were powerless to counter, showed up false claims to power and authority which could not keep promises in the face of the free God. Prophetic criticism has an element of grieving in it as the prophet mourns the oppressions encountered. The Israelites were afflict-ed, oppressed, and ground down by the dominant Egyptian culture, and so they risked the freedom of the free God against the regime. The energizing happened not through what the Israelites already possessed but through what was promised. God went before them in pillars of fire and cloud and trans-figured this fear into energy. The people were energized to follow the free God to establish an alternative community built on justice and compassion. Though the Israelites left Egypt to live more freely, they, too, eventually developed a dominant culture. It was characterized by the reign of Solomon, whose whole achievement appears to have had the self-serving purpose of securing the place of the king and king's dynasty. Solomon did not welcome the ideas of a free God and an alternative community any more than did Pharaoh, for they threatened the established order. There were three bases 660 / Review for Religious, September-October 1991 for Solomon's rule that generally mark any dominant culture. First, there was incredible well-being and affluence, though it was not equitably shared. Some went without enough so that others might have too much. Second, an oppressive social policy sustained the standard of living. There was a system of forced labor in which laborers met the needs of the state although unable to meet their own needs. The politics of justice and compassion disappeared, and the order of the state became the overriding agenda. Third, there was the establishment of a controlled and static religion. God and God's temple became part of the royal landscape. How could God, seen as living in a house provided by the king, say anything critical or abrasive? Solomon was countering the counterculture of Moses: the economics of equality was countered with the economics of affluence, the politics of justice with the politics of oppression, and the religion of God's freedom with the religion of God's accessibility. The dominant culture of Solomon managed to brush aside Moses' vision. The gift of freedom was taken over by the yearning for order, and the human agenda of justice was used for security. Against reali-ties like these, people are called to utter prophetic words. Moses both criticized and energized. Like him, Jeremiah is shown as proclaiming the critique while Second Isaiah offers the energy for the new vision. The prophets offer symbols that contradict a situation of hopelessness and give public expression to long-unspoken fears and hopes. They show us that the dominant culture leads people to despair of new life. They present an alternative consciousness, grounded in the unwavering faithfulness of God, that can energize the community to new forms of faithfulness and vital-ity. Jesus, too, is shown as a prophet who criticized the dominant culture of his day. "Jesus is remembered and presented by the early Church as the faithful embodiment of an alternative consciousness.''4 Jesus' ministry and death oppose the politics of oppression with the politics of justice and com-passion. The counterpart to the crucifixion is the birth of a new reality that finds full expression in the resurrection. What does this very challenging reflection on prophets and prophetic consciousness have to say to us in religious life? What is apostolic religious life's prophetic role in church and society today? It is important to reflect on this, recognizing that we have generous portions of both dominant culture and alternative consciousness within us. We recognize our conflicted nature, yet we aspire to a prophetic role in church and society. We must ask, then, whether apostolic women religious have been co-opted by our dominant consumer culture or whether we manifest an alterna-tive consciousness based on the freedom of a free God. Do we show a belief in community and interdependence as inherent in our way of life, or are we Prophetic Witness / 66'1 fragmented and self-centered? Are we motivated by a desire for justice and compassion, or do we prefer stability even at the price of the exploitation and oppression of "invisible" others? The questions are hard but necessary as we examine the religious way of life for evidence of prophetic witness. Prophetic Witness and the Current Experience of Religious Life Our challenge as women religious is to position ourselves to recognize the revelation of the future. One current writer, Mary Jo Leddy, N.D.S., speaks of the need to develop a postliberal model of religious life. Her thesis is that the basis for our contemporary religious life in North America is a declining culture that depends on the liberal thought fed by industrial capi-talism. While liberalism has made many contributions to modern society, it cannot deal with the reality of limits. If there can be no limits, ultimately there can be no meaning or values. Liberals tend to see themselves as contemporary or progressive and in conflict with the conservative or traditionalist ideas of Church and religious life. In Leddy's view, the more serious obstacle to the transformation and renewal of religious life results from the tension between the liberal and the prophetic approaches. The prophetic leads us to a more radical response in spirituality, mission, ministry, and community. The prophetic is risky, for it calls us to response to an unknown future rather than reaction to a no-longer-valid past. Leddy says, "We who live in a disintegrating empire today are summoned at prophetic moments to criticize the patterns of decline within our culture and within ourselves, to contemplate the holiness of God in the midst of these dark times, and to evoke the creative desire in one another for a meaningful alternative for the future.''5 These words are very similar to those Brueggemann uses to describe the prophetic imagination. The prophetic intersects with our apostolic religious life. Contemporary writers call religious to the same challenge the prophets faced in biblical times. Religious congregatiohs represent an alternative to the values of the dominant culture but do not stand apart from the people. Rather, apostolic religious recognize clearly the need for reflection, discernment, and a ground-ing in the holy as they criticize, yet energize, themselves and their peers to bring the values of the Gospel into contemporary society and culture. We have reflected on what it means to be a prophet. We have also recog-nized the challenge it presents to apostolic religious. Let us now look at cur-rent beliefs and responses regarding apostolic religious life in light of prophetic witness. I will consider mission direction, the meaning of member-ship, and some current realities. These areas provide us with the material to critique and energize our own prophetic potential. 662 / Review for Religious, September-October 1991 Mission Direction Although expressed differently in each congregation, mission direction today involves in some way a commitment to transformation of the world, the Church, and ourselves through promoting systemic change for the quali-ty of life; justice for the economically poor; furtherance of the role of women in church and society; and mutuality, inclusivity, and collaboration in all relationships. Such mission direction clearly reminds us of our partici-pation in the mission of Jesus. When we call ourselves to systemic change for the quality of life, what do we mean? We are asking for two things, systemic change and quality of life. When we say the system is not working well, how do we want to change it so it will work better? For whom do we want it to work better? If we take a global view, we see that entirely too much of the world's popula-tion is forced to live at a level that does not meet its basic needs of food, shelter, health care, and education while a minority has more than its share. We see that, in order to feed the wants and needs of a market economy, rain forests are irrevocably destroyed, topsoil is depleted, deserts are expanded mercilessly, and the world's fresh-water supply is tainted and diminished. On local and national levels we 'must ask ourselves how the needs of the poor are being met. After all, Jesus was clear in showing us that whatever we do to the least of his people we are doing to him. The poor are receiving poorer education, less nourishing food, substandard or no housing, and inad-equate health care in this country so rich in resources and technology. We must use our ingenuity, gifts, and talents to change a system that has canonized greed and competition in order to satisfy wants. How can we in our own daily living point the way to change that would benefit those with least access to the system without denying the legitimate gains and goods of our society and culture? Such responses as simplifying our lifestyle by avoiding use of Styrofoam, recycling our disposables, and making thought-ful choices regarding food and other consumer goods can raise our con-sciousness and lead us to getting others involved and to networking with those already involved. Indeed, most changes begin as ordinary people change their thinking and the patterns that go with their thinking. We must know our values so that they, rather than the manipulative marketing of an over- consumptive dominant culture, will shape our choices and responses. We claim that we want justice for the economically poor. This value links with the goal of systemic change for the quality of life. Jesus' life and ministry showed us his love of preference for the poor. This is not to say that Jesus does not love all, but that his ministry was not directed in the main to those who were the power brokers of his day. These, of course, he invited to Prophetic Witness / 663 join him in loving God and neighbor, but the cost was generosity, sharing their possessions. Jesus was good news for the poor. Are we who are called to continue Jesus' mission also good news for the poor? Whether in direct service So the poor or in ministry with middle- and upper-middle-class peo-ple, are we focused on a more just distribution of and access to necessary goods and resources? Do we in our teaching and in our healing, pastoral, and social works always have in mind those who are less fortunate than we are? Are we willing ~o call others to this consciousness even when we see and know that the poor are not to be idealized? They, like us, have faults and failings and may not reflect Christ as we might want them to. A reverence for the poor calls us to a view of Christ very different from that of popular piety. While comforting, it is challenging; while open and inviting, it is demanding; and while satisfying, it never ceases to call out for more--more love, more generosity, more hospitality. Not all of us are called to direct ser-vice with the poor, but all of us are called to seek justice for the poor. In this quest we continually recognize that we, too, are among the needy and are enriched by those we serve. Another commitment common to religious is to the furtherance of the role of women in church and society. Worldwide, the conditions of women vary from those in countries where women have legal equality to those where brides are still considered property. Women the world over have the primary responsibility to feed and care for the children even though means and resources are not equitably at their disposal. In the United States a vio-lent crime is committed against a woman every three minutes, and a woman is raped every six minutes. Households headed by women are increasing while the rate of their income is dropping. Children are our most precious resource, but those who care for them are denied the necessary means. Our Church struggles with the role women are to play in its pastoral, liturgical, and philosophical reflections.In the U.S. the most recent draft document on women's role in the Church and society calls for equality for women in theory but holds back in p.ractice. As John XXIII said in Pacem in Terris in 1963, "Since women are becoming ever more conscious of their human dignity, they will not tolerate being treated as inanimate objects or mere instruments, but claim, both in domestic and in public life, the rights and duties that befit a human person.''6 The women's issue is more than an issue, it is a perspective that demands attention and response. Once unleashed, the forces of confusion and dissension drive towards resolution. In our lives we will use inclusive language, advocate for women, and net-work to help make society a friendlier place for women to develop and share their gifts and talents. Despite such a commitment on the part of congrega- 664 / Review for Religious, September-October 1991 tions, there is dissension among women religious in language usage and other matters. Our heads and hearts find themselves in conflict here, leading to results that could be less than satisfying. Can we avoid being our own worst enemy in the search for inclusivity? Let us not deny the richness of our past, the demands of the present, or the call of the future as we work for justice and right for women in contemporary society and church. Another area of commitment of apostolic religious today has to do with mutuality, inclusivity, and collaboration in all our relationships. The values implied here are very positive, and yet to achieve them one must give in order to receive. The mystery of sacrifice is contained in these words in a way that is not apparent at first glance. For mutuality to occur, I must not only believe in myself, I must also learn to believe and trust in the other. With whom do we allow ourselves to be mutual? Do we let power, position, language, style of dress, or education prevent us from speaking our truth or hearing that of others? In terms of inclusivity, do we go to the extremes either of having no boundaries or expectations or of expecting everyone to fulfill every role or function in an organization? Inclusivity involves includ-ing others in the concerns affecting their own lives. Not all will do every-thing, but there must be input from those affected. In terms of discernment, though all are included, not all perspectives can be responded to or chosen. We often try to make inclusivity mean pleasing everyone all of the time even though this may be impossible. Finally, let us look at c.ollaboration. If we pull the word apart, we can see the meaning as co-labor or working with. At one time we may have considered ourselves collaborative if we hired lay teachers and nurses and more so if we hired lay administrators. Collaboration at its most radical, however, calls us not just to bring others into our projects and have them do things our way, but to work with others and to respond to the signs and needs of the times together. Unhe.althy com-petition or too rigid control in ministry or community strikes at the heart of the love which binds us together so that the 'risen Christ may be discovered among us and in our world. The Meaning of Membership The consideration of mutuality, inclusivity, and collaboration leads us into the meaning of membership. Community life is a topic, issue, and reali-ty that continues to generate much attention. As apostolic religious we have such different experiences, expectations, and definitions regarding commu-nity life and the meaning of local community. Sometimes when the phrase "local community" is used, the assumptions and expectations already in place cause us to "shut down," to become unable to continue a dialogu~ Prophetic Witness because we are really unable to h~ar one another. (I personally have felt anger, despair, defensiveness, longing, fear--and also hope--around this topic.) What has led religious women to this state and what can we do to move beyond shutdown and breakdown to a breakthrough? It is clear that, in this matter, apostolic women religious are striving, striving to understand meaningful bonding and to express it through authentic participation in community. Someone recently said that we may have so emphasized mission and ministry in the years of renewal following Vatican II that c6mmunity has become the shadow side of our way of life. If that is the case, the difficulties surrounding our efforts to deal with community life are deep and profound. We must face and deal with this central area of our way of life so that we are nok torn apart by unclear expectations and assumptions. I offer three perspectives for consideration in the area of community: human-growth issues, the importance of faith community and faith sharing, and l~ousin~ in community. We sometimes get bogged down by human-growth issues in our lives with one another on the local or on the broader community level even though our lived experience points to the need for human growth and development among ourselveg. Each of us knows how difficult it is to change herself and how truly futile it is to expect to change another. Each of us must deal with herself and her own issues in as healthy a fashion as 16ossible. Only when my behaviors and patterng are healthy may I be able to imiarove the dynamics between myself and those with whom I interact on a r~gular basis. The challenge here is to deal with my own behav-iors, realizing that I have no real or lasting power over the behaviors another may choose. My role is to try not to feed into unhealthy behaviors that may be pre.sent around me. Although unatteiaded human-growth issues can wreak havoc on healthy relating within community, still apostolic religious must recognize that we will never overcome all of these problems either individually or corpbrately. Gra~e biailds on nature; it will not replace or deny our humanness. We must realize how eadh sister's desire and motivation influence her choices regard-ing her behavior and interaction. We cannot choose for each other, only for ourselves. Each ~'eligious needs to be challenged to a self-knowledge and self-awareness leading to growth. Practices such as spiritual direction, the annual retreat, and the daily consciousness examen can keep us grounded in reality yet open to ongoing conversion. We must deal with human-growth-and-development issues, but not remain there. We must be committed to the making of or participating in faith community as a means of nurturing shared life, shared love, and shared vision. We must find ways to relate regularly and meaningfully with our sis- 666 / Review for Religious, September-October 1991 ters in community in order to reflect on, renew, and recommit ourselves to the mission, charism, and spirit of our congregation in our daily lives. Depending upon our miriistry and the proximity of other congregational members, how we do this will differ; that we must do it if membership is to mean more than an annual touchdown or the reading of congregational mate-rials is the reality we face. Some Current Realities I. recogniz9 that each congregational member will have other communi-ties thai will lay claim to her time, energy, and affection. That is good and healthy. My point is that we must have quality time for our own congrega-tion as well, as part of the ordering rhythm of our lives. Sometimes one's commitment to ministry or to parish can become so all-encompassing that ther~ is. little or no time or energy left for her to express her membership in her religious congregation. For me, the making of faith community involves reverence for one another, presence to one another for celebration as well ag dialogue and reflection, honesty so that we can affirm one another or call each other to growth, and a commitment to the goals and developing agenda of our congregation. This topic of makirig and participating in faith community leads to another important topic: the difference between housing and local communi-ty: We often equaie the two and this ~quation may not reflect that community life is broader than housing. The recent lived reality of women religious shows that faith community on the "local" level is not necessarily synony-mous with where a sister lives. In some locales th~ sisters have committed themselves to hei,ng a faith community without walls; regular meetings, cele-brations, and gatherings among them challenge and deepen their member-ship in the cbngi'egation, in other locales the sisters in a particular house function well as a faith community. We must recognize such differing com-munity realities and encourage them on the local level as well as on the con-gregational level. A commitment to community in our current society of intenge individualism and consumer gratification keeps us involved in a prophetic role. An Agenda for the Future The prophetic nature of this life to which we are called leads us to cob-sider an agenda for~the future. Any living organization must be open to change or it will die. In a sense change is an ordered type of death, not death as final but rather death leading to new life. One of the greatest strengths of apostolic women religious is the serise that the agenda or common goals Prophetic Witness / 667 belong to all of us. This strength we will build on as we look at change and new life for us religious. Central to understanding ourselves as women religious is understanding our spirituality. I believe that the biggest challenge for each of us with regard to spirituality is to lead more integrated lives. Integration does not just hap-pen in a person's life. It must be worked at daily through a continuous blend of action and reflection leading to further action. Somehow the aspects of one's life must be part of a whole rather than segments that do not overlap. In an integrated life my religious commitment is not separate from who I am when I am at leisure. My response in mission and ministry is not limited to my paid professional work but may overlap into volunteer involvements in food pantries, visiting the sick or elderly, letter writing, and other activities. Community life is not an end in itself in an apostolic religious institute, nor is it merely a refuge that ought to be there when I want and need it. Community is a place or space where I share faith and vision, humanness, and the quest for the divine. My ministry is not all-consuming; I do allow myself necessary time for recreation and reflection. And my prayer life is more than specified exercises or spiritual reading. All these somehow fit together and reflect my spirituality, my integration of life. An integrated life has powerful witness value in a society that wants everything and does not want to be reminded of the need for balance. Integration is not synonymous with transformation, but it can surely open us to being transforming elements in the institutions and structures of society and culture. In our desire to be prophetic witnesses, we commit our-selves to transformation of the Church, the world, and ourselves~ I recently read that one way of understanding transformation is to look at the life cycle of the butterfly. First there is a caterpillar; next there is the chrysalis stage, in which the organic matter is quite shapeless and formless; finally, there is the butterfly. Transformation is what happens in the chrysalis stage. The process is not very appealing; it suggests a profound letting go as well as an openness to a different future. While transformation has global ramifications, it will not begin at the global level but rather at the local level, where we can encourage one anoth-er to let go of attitudes or practices that may have been more helpful to a known and comfortable past than to the needs of the present or the concerns of the future. The desire for transformation of the world, the Church and our-selves flows directly from our relationship to God, self, others, and creation. It is expressed in a commitment to justice, peace, and the integrity of cre-ation. Transformation is not something anyone can directly make happen by willing it. No one person caused the recent freedom movement in Eastern 668 / Review for Religious, September-October 1991 Europe, nor can one individual move our economy from a military focus to a domestic and global focus responding to human and planetary needs in a humane fashion. Likewise, no ond person's recycling of materials will reverse our problem with excessive waste. Yet all of these and many other alternative responses can indeed lead to transformation. When such respons-es begin, networking or replicating starts to happen and systems begin to change. At the May 1990 meeting of the council of the International Union of Superiors General (UISG) in Rome, the following global challenges to evan-gelization were identified: the widening gap between the rich and poor; indi-vidualism characterized by greed, violence, terrorism, abandonment, indifference, and irresponsibility; loss of human dignity through political oppression, social discrimination, and economic injustice; the breakdown of family life; the destruction of the environment; inability to trust the human community, coupled with a preoccupation with survival. These challenges help us to formulate an agenda for transformation that is larger than ourselves, and they clearly link with the transformative ele-ments for religious life in the future developed by the major superiors of U.S. women's and men's communities (LCWR/CMSM) in August 1989: prophetic witness; contemplative attitude toward life; poor and marginalized persons as the focus for ministry; spirituality of wholeness and global inter-connectedness; charism and mission as sources of identity; change of the locus of power; living with less; broad-based inclusive communities; under-standing ourselves as Church; and developing interdependence among peo-ple of diverse cultures. These challenges and transformative elements reflect in broad strokes the goals and concerns ofapostolic religious. Though the future depends in part upon us and our efforts, it depends even more on the grace of God our Creator, the inspiration of the Spirit, and our cooperation with each other as members of the body of Christ, joined in a common humanity and gifted with a common creation. Our communion with and in Christ calls all humanity "to reclaim relationships with family, clan, and tribe, to choose the common good, to seek solidarity with one another and with the earth.''7 For transformation to occur, we must believe and act in such a way that we give the message that life has meaning and that, assisted by God's grace, our responses make a difference. The prophetic imagination described by Brueggemann remains viable as we respond in our own times with an alter-native consciousness, as we critique our dominant culture and yet energize one another for a more just and compassionate future. Our faith gives us the vision and the mission, our hope gives us spirit and energy, and our love Prophetic Witness / 669 grounds us in the mysterious blend of transcendence and immanence that is life. I close this reflection on prophetic witness and apostolic religious life with Isaiah's words: "Remember not the events of the past, the things of long ago consider not; see, I am doing something new! Now it springs forth, do you not perceive it?" (Is 43:18-19). NOTES I Walter Brueggemann, The Prophetic Imagination (Philadelphia: Fortress Press, 1978), p. 9. 2 Ibid. 3 Ibid, p. 13. 4 Ibid, p. 88. 5 Mary Jo Leddy, Reweaving Religious Life: Beyond the Liberal Model (Mystic, Connecticut: Twenty-Third Publications, 1990), p. 164. 6 John XXIII, Pacem In Terris, in Seven Great Encyclicals (Glen Rock, New Jersey: Paulist Press, 1963), p. 297. 7 Helen Maher Garvey, B.V.M., excerpt from notes on the Meeting of the General Council, UISG, Rome, Italy, May 7-11, 1990, p. 2. Storms Tornado watch, the weatherman said, to last until ten o'clock. Four hours to wait for what may be or not. Storms of spirit come suddenly; swirl through the heart's towns and wash its skies to morning clean-- with no hours to wait for what so swiftly is. Sister Elizabeth deSales Dee, S.S.J. St. Joseph Convent 7300 Torresdale Avenue Philadelphia, Pa. 19136 Mission or Consecrated Religious Person: Which Comes First in Apostolic Institutes? Marie Therese Levey, R.S.~. Sister Marie Therese has taught school in country areas of Australia. Later she spe-cialized in teaching instrumental music: piano and violin. More recently she has done research in liturgical music and earned a Ph.D. Her address is St. Joseph's Convent; P.O. Box 472; North Sydney, N.S.W. 2059; Australia. In May/June 1988 this joumal published Sister Georgine Scarpino's article "The Unemployed Sister: Challenge and Opportunity." It defines the unem-ployed sister as a woman religious physically and emotionally capable of active ministry who, despite seeking work, currently has no formal position. It gives two causes for this modem phenomenon: the location of the work and the way ministry decisions are made. In summary, Sister Georgine points out the need for congregations of women religious to develop programs within religious institutes to address both employment and unemployment. Surprisingly, no published response has followed her article until now. Since women religious have sacrificed potential material wealth, marriage, and motherhood in order to serve the Church in institutes devoted to apos-tolic works, it seems unjtist that the situations described occur. However, occur they do, and the first step toward rectifying the problems is to admit them. One then asks why they exist and seeks an appropriate cure. Sister Georgine presents causes of these problems in the United States. Although here in Australia there are general parallels to what she describes, yet the causes and thus the cures seem somewhat different here. The present writer has, in religious life, personally experienced "job search" and the special type of demoralization which occurs in close-knit communities when one is the "odd man out." I thus feel equipped to write on this subject. Regardless of the differences between countries in reasons for the phe-nomenon of the unemployed sister, I believe that the two elements most 670 Mission or Consecrated Religious Person? / 671 needed in addressing the problem of appropriate placement in apostolic works of religious personnel in institutes of consecrated life are: (l) a correct balance in religious leaders between their attitudes towards responsibility for the institute's authentic mission and their attitudes towards the rights of the individual members; (2) adequate use of written media, particularly those which are internal to the religious institutes and which include forums for peer review and the opportunity for subjects to respectfully challenge those directives or oversights of superiors which seem to threaten the authentic mission of the institute or the rights of its members. Mission and Person The religious state belongs to the life and holiness of the Church (canon 574), and the primary mission of the Church is the care of souls. Ecclesiastical law insists that apostolic action for institutes of consecrated life should confirm and foster union with God (c. 675, §2). The Church has Msb a social mission, namely, to support and protect people's material well-being and to inspire and promote true civilization through Christian philoso-phy. 1 In the social category of mission can be placed the apostolic pati'imony of many institutes, and the Church insists that such patrimony, or intentions of the founder, should be.preserved by the institute (c. 578). Thus, leaders of institutes of consecrated life f6unded for apostolic works, in order to justify their ongoing existence and their acceptance of candidates, need to ensure that both the corporate entity and the individual members have a correct con-cept of this patrimony as well as machinery to implement it. Bearing in mind that the Church places the person at the center of the social order, religious leaders have a r~sponsibility to see that members of the institute are placed in apostolic works which are appropriate to the tal-ents and needs of each (see Perfectae Caritatis 18). The pastoral commit-ment of a leader in an apostolic institute does not remove--but, rather, ¯ increases--her obligation towards seeing to appropriate placement of per-sonnel. Although religious leaders nowadays delegate administrators for works for which members of their institute are the trustees, a large part of the responsibility of preventing serious damage to the person through long-term lack of appropriate apostolic work must lie, by the nature of their role, with the religious leaders. Moreover, the responsibilities leaders have to individtial persons within the institute vary according to how long and in what manner they have contributed to the institute (see REVIEW FOR RELIGIOUS 1989, p. 460). Since it is often claimed that consecrated religious are in short supply, the application of the above principles might seem straightforward. In reality 672 / Review for Religious, September-October 1991 there are circumstances in the modem world in general, and here in Australia in particular, which cause it to be very difficult for congregational leaders. As in the United States, the location of the work in Australia affects the opportunity to do it, and the way ministry decisions are made in America has parallels h~re. Some details may clarify the differences between practices in the two countries. Conditions in Australia Prior to Vatican II, the missioning procedures in Australian apostolic religious congregations were relatively simple. Obedience, or the will of God, was equa~ed with doing what a superior told one to do and living where the superior told one to live. In larger Australian congregations, (over 1,000 members) often more than half were primary school teachers, and a large proportion of the remainder were either secondary teachers or nurses. Changes of residence for those "in the ranks" usually involved interchange between personnel engaged in similar works. This principle of interchange was fundamental to the smooth application of the third vow. When a difficult posting was required--for example, to isolated rural areas--younger reli-gious under perpetual vows were usually sent. Postings to apostolic works almost invariably came directly from a major superior, whether or not that superior's apostoli~c background was in the relevant work. Recruitment of staff for a school or a hospital by an administrator, or board, was foreign to most Australian apostolic religious congregations of women prior to about 1960, whether the mission was in the city or in the country. In the early 1960s a radical change occurred in the overall secondary education system in the most populous state of Australia, New South Wales. That change to what was called the Wyndham System, emphasizing science and the arts, was much more revolutionary in Catholic education for girls than it was either in state education or in Catholic education for boys. In the typical local Catholic school run by consecrated religioi~s women in Australia before that time, the girls remained in the same school, almost entirely staffed by r(ligious, from kindergarten through secondary school years. In state education and in Catholic education for boys, secondary schools were already separated at least from lower primary schools. Thus, state-school teachers and men religious in secondary education had been required to have university degrees before some larger institutes of w~men religious recognized such a need. When the more farsighted Catholic educa-tors pointed out that it would now be a problem to provide adequate sec-ondary education for the girls of less well-off families in local pa~:ish schools, some congregations saw in their higher grades a source of more Mission or Consecrated Religious Person? / 673 thoroughly trained religious personnel. That vain hope made difficulties in long-term planning for the transition from religious to lay staff. A further dramatic change in Australian education, which was to affect all ministries, occurred in the early 1970s. After a break of twenty years, the Australian Labor Party, headed by Prime Minister Gough Whitlam, was elected to govern the country. One of its earliest reforms was to make uni-versity education free. Although some criticized the extraordinary cost this was to the nation, the move brought the opportunity for tertiary education to the masses. Before that time, university education had been for the fortunate and the chosen. Now the initiative for tertiary education was up to the indi-vidual. The suc.c~'ss achieved by some "late starters," many in their forties and fifties, revealed how much talent had previously been unused. From about 1975, attitudes within religious congregations changed for both superi-ors and subjects. Superiors began to listen more attentively to those who did well in their tertiary studies, and subjects found their personal confidence and self-esteem strengthened by their academic achievement. With the advances made in the study of theology and the social sciences, it is now rarel~ pretended that apostolic religious life is simple, or that doing the will of God is always as clear-cut as that decided by another human being alone, whether or not that person h.appens to be a religious superior. Because of the broader scope of ministries open to women religious, modem specialization, and improved administrative techniques, the principle of interchange among personnel--which for many years had been integral to the practice of the third vow--is now becoming more and more difficult. In addition, although the median age of religious congregations is rising faster than that of the general population, many religious feel they have the right, and indeed the duty, to request proximity to aging parents. Religious congre-gations in serious decline have virtually no young sisters under perpetual vows who might be sent to isolated schools in rural areas. Since the majority of Australian sisters have reached the "winding down" stage of their lives, many now look to the cities from whence they originally came. In addition to these developments within the Church, the governments of Australia and New Zealand have acknowledged, in the form of funding, the benefits to the country as a whole of certain works of the private sector, including Catholic, and have thus made it necessary to rethink the ecclesias-tical structures for some ministries in which religious are involved. The equitable processing of government funding necessitated merging many local works, including parish schools within dioceses, into larger systems, most of whose personnel are now lay. These mergings required the develop-ment of policies acceptable to the relevant bishops, major religious superi- 674 / Review for Religious, September-October 1991 ors, and state and union representatives for the management of the works, particularly those of healthcare and education. Making the policies work in practice required the establishment of sophisticated structures, which in turn required religious or lay personnel with the proper management skills. As a result, the power of the leaders of religious institutes with regard to the placement of personnel in traditional works in Australia and New Zealand has been lessened. Unlike lay staff, religious in Australia are not permitted employment status; this is not the case in New Zealand.2 Because of all of these circumstances, religious superiors have had to rethink how to preserve their true patrimony oi" authentic mission and what human cost would be involved. Mission or Consecrated Religious Person? The whole issue of the employment, or active involvement, of religious personnel leads to the question: Which is of greater importance to an insti-tute claiming to be dedicated to apostolic works, the works for which it was founded or the persons who will serve in those works? For leaders of insti-tutes whose acceptance of candidates demands that they offer them appropri-ate apostolic work, the answer is neither obvious nor simple. However, the Church has offered some very sound advice in the general area of human work. Of the documents which have come from the Vatican since the council, few could be more relevant to our times than the encyclical letter Laborem Exercens (LE) of the present pope. Pope John Paul II presents human work as "one of the characteristics that distinguish man from the rest of the crea-tures." It is "from work [that man's life] derives its specific dignity" (LE Introduction). Pope John Paul describes the "conflict between labor and cap-ital in the present phase of history" (LE 1 l f f). The Church, he points out, has always taught "the principle of labor over capital." Both are causes of pro-duction, but while capital is the mere "instrumental cause," labor is the "pri-mary efficient cause" (LE 12). In the labor-over-capital issue, Pope John Paul equates labor with per-sons and capital with the material returns from their labor. Consecrated reli-gious, even those who have employment, individually receive no capital }'or their labor. They have sacrificed this right for a stable form of living by which they can follow Christ more closely under the action of the Holy Spirit (c. 573). In Australia and New Zealand, more than half of the person-nel in apostolic institutes made their commitment in the years when religious superiors had supreme control over placement into works, and they are now beyond the stage at which they might have arranged for alternative security Mission or Consecrated Religious Person? / 675 in old age upon seeing that the original system in which they sacrificed pos-sible wealth, marriage, and motherhood was beginning to break down. So the competent authorities obviously have a serious question of obligation towards them now. Many of the religious have perhaps forty years of life which they could still offer in apostolic works within the Church. Pope John Paul also writes concerning the roles of the "direct and indi-rect employer" (LE 17). By the "indirect employer" he refers to many differ-ent elements in society which make up the human environment of the worker. He says: "The role of the agents included under the title of indirect employer is to act against unemployment, which in all cases is an evil, and which, when it reaches a certain level, can become a real social disaster" (LE 18). These are strong words from the pen of the vicar of Christ. The principal agent in the concept of indirect employer for religious personnel would be the wider Church in that country. Should not, then, sections of the local Church accept part of the responsibility to address any problems of unem-ployment for religious? As well, the question should be raised within reli-gious institutes: Is it justifiable for religious superiors to accept candidates to poverty and obedience within a particular institute when those superiors do not have the power to place them in suitable work soon after profession? Perhaps declining numbers in a congregation increase the temptation for superiors to do so, and perhaps they excuse their actions with the reminder that all should "trust in God." I believe that succumbing to such a temptation would constitute power abuse of a particularly destructive kind. The abuse would surely be more damaging if others within the institute were already searching for similar employment, and were exposed to the same market forces. Power and Recruitment for Apostolic Works The power of recruitment brings us to the heart of the present discus-sion, namely, the opportunity for or deprivation of suitable apostolic work for religious personnel. It is neither possible nor desirable to completely sep-arate apostolic persons from the society in which they live. Professed mem-bers of Australian religious institutes are exposed to the forces which are part of the sophisticated living of the decade leading up to the twenty-first century. In this society ~nd age, control of recruitment for works represents power. For religious personnel, recruitment can be translated into mission-ing. Procedures for the missioning of religious should be such that they lead to the spiritual strengthening of the members and the corporate growth of the institute. The immediate practical problem to be faced by governing bodies of religious institutes is to develop policies for missioning procedures that 676 / Review for Religious, September-October 1991 are within their power to implement, that support evangelization, that are just and equitable and adapted to the personhood of each sister, and that accord with both canon and civil law. Nowadays apostolic work for religious may be broadly placed into four categories: (1) viable institutions of which the con-gregation is the trustee, (2) charitable works of the congregation or of other ecclesiastical bodies, (3) viable institutions of other ecclesiastical bodies which pay stipends or salaries for the work of the sister, and (4) viable and nonviable works found in profane structures at the initiative of the religious. (1) Viable institutions owned by a religious institute are, in a distinctive manner, part of its patrimony. They are, as well, material assets of the insti-tute, which its leaders should, in. poverty, care for "with the diligence of a good householder" (canon 1284). Viable works of religious congregations are businesses, and for businesses to survive and attract personnel today, they must be competitive. Vatican II (Gaudium et Spes 64) teaches that eco-nomic development through technical progress "must be fostered, along with a spirit of initiative, an eagerness to create and expand enterprises," and that the purpose of productivity "must be th.e service of. the whole human per-son, viewed in terms of his or her material needs and the demands of his or her intellectual, moral, spiritual, and religious life." Pope John Paul points out that "capital cannot be separated fr6m labor" (LE 13) though, of course, in the case of religious persons, the capital is, through poverty, directed elsewhere than themselves. Religious persons, knowing that they are materially contributing towards the whole, find in the capital "confirma-tion and support" (LE 13) for the work done. Sound economics and evangel-ical poverty should go hand in hand. In order to maintain the correct balance between responsibility to the institute's mission and respect for the rights of the individual members of the institute, congregational leaders (trustees of the works) must regard the work and those involved in it as separate entities: the work itself is important regardless of who does it. Individual members must have the same percep-tion so that they may practice the spirit of poverty, or detachment. There should, accordingly, be protective structures for the ministry, including sometimes the combining of similar works under one administration so that they will continue even in cases of illness or of anyone's taking longservice leave. It is particularly important that this principle of continuation be respected when works require only one person in the local area, for example, instrumental music practices.3 Setting up protective structures for ministries in order to maintain the institute's patrimony will include policies for recruitment of staff. In those works in which a number of religious and lay people, are engaged, religious superiors have the direct power to influence Mission or Consecrated Religious Person? / 677 administrators in the recruitment of personnel. It stands to reason, then, that---other things, like professional qualifications, being equal--in recruit-ment for works of which the religious institute is the trustee, preference should be given to its own members. (2) The category of charitable works might include refuges for the needy which are supported by the congregation and by external donations. Without viable works there can be no charitable works. The Church's teaching on a "preferential option for the poor," by which the poor should have a preferen-tial claim on the Church's resources, cannot be initially applied without the resources. Once competent authorities decide that a charitable work is authentic to the charism of the institute, then the congregation should set up, as it should for its viable institutions, protective structures to preserve the work, whether or not there are religious personnel to staff it. Indeed, true missionaries strive to make themselves ultimately dispensable--teaching the disadvantaged how to be self-reliant and how to recover the dignity which is their right (see LE 9). Protective structures would include finance arrange-ments which can be monitored, and the work should be the source of support for the individual religious workers; that is, their salaries or stipends should be fed back into the general system. Again, for a religious institute's own charitable works, other things being equal, one would expect that members of the institute who are under civil retirement age should be considered first when positions are vacant. In Australia, women over sixty years of age (men over sixty-five) who have limited assets (a category which includes religious) are eligible to apply for the Social Security payments from the government. With the pres-ent societal structures, it seems that religious who receive Social Security should not deprive others (perhaps more deserving) of needed employment positions. In some dioceses it is established policy not to accept into stipend-ed positions religious women who are over sixty. If protective structures for an institute's works do not include allocationof salaries, or stipends which are independent of Social Security payments, then receipt of the latter would generate for the ministry an artificial security which could destabilize long-term plans for it. (3) In the third category above, which here in Australia refers principally to Catholic education, lie the greatest current problems of placement of reli-gious personnel. In most of Australia, the recruitment of staffs for nonpro-motional positions in Catholic schools is in the hands of local principals. This power evolved with the gradual acceptance of lay staffs into the parish schools previously staffed by religious. Perhaps to our discredit, it is only recently (since about 1975) that there has been widespread acceptance of lay 678 / Review for Religious, September-October 1991 teachers into promotional positions. In general, the power of religious supe-riors to place personnel in diocesan works is limited to those positions which were previously held by other religious of their own congregations. Declining numbers, and thus declining positions, led to some religious being exposed to market forces for ministries. School principals, whether religious or lay, still have the power and responsibility of staffing. This has now become an excessive burden for principals of Catholic schools in the coun-try, and an excessive power for those in the city. One solution would be to have staff recruitment moved to the systemic level so that consistent staffing policies might be applied across dioceses. This might lessen the number of religious who today feel forced into the fourth category above. The exposure of some religious to market forces in the area of ministry is quite a different method of missioning than the appropriate placement of a person by a religious superior. The question should be asked: Is it just for the two types of missioning to coexist ~within the same religious institute? The answer to this important question will require great honesty and humility on the part of religious leaders. Religious exposed to market forces are some-times refused employment in diocesan works or, when school enrollments drop, dismissed by school principals of their own congregation who have the power of recruitment. Such practices are effectively structuring out of Catholic education the few teaching religious who are left, and are a serious cause of unemployment amongst religious. Some religious teachers even turn to the state school system for employment rather than lose touch with the classroom and "real life." Considering the authentic commitment which the religious have made, this alternative seems to the present writer an anomaly. On the other hand, relatively little investment has been made by the wider Australian Church over the last twenty years for the education in theology of lay teachers for Catholic schools. The above problems can now be solved only by negotiations between diocesan and religious leaders who have in mind the well-being of both the mission and the persons. As well, past oversight in planning could perhaps be avoided in the future if religious are encouraged to contribute ideas through appropriate media. Adequate Use of Media There are two levels of written communication which are particularly important in preserving a correct balance between responsibility for authen-tic mission and respect for the rights of individuals. These levels are media within the wider Church and media within religious institutes. Media within the Wider Church. Recruitment of personnel for Catholic works is effected via both the Catholic journals and the metropolitan dailies. Mission or Consecrated Religious Person? / 679 Like most other countries, Australia has its regular Catholic state and dioce-san papers. Because these are virtually all the Catholic community has for information on what is happening in the Church, they warrant better support and readership than they receive~ In general, editorial staffs in this country strive to maintain an adequate standard of journalism. Despite these vehicles of communication, religious leaders sometimes offer only private invitations to coveted positions which become available. They would avoid much criti-cism if they were to justify, via the Catholic media, such private invitations, especially those to academic posts in Catholic theological institutes, which remain predominantly male. Media within Religious Institutes. If any group of people ever needed to be skilled in transmitting information to each other, it would surely be the members of a religious community. Today there is frequent reference to the "role of the prophet" within religious institutes. Prophets must have vehicles in which they can deliver the message, and the printed word offers the par-ticular benefit of time for considered expression and response. I believe that religious institutes need especially these two kinds of print media: directo-ries and forums for challenge. Directories. In order for general leaders to affirm a work as part of the institute's authentic mission, they must understand clearly what the work is about and be sufficiently convinced of its value to defend it, if necessary, at the general chapter. On the other hand, if chapter delegates believe that the congregation has more ministries than they can validly affirm, they should seriously and courageously argue that systematic steps be taken towards reducing the number.4 Chapter delegates, in order to make valid contribu-tions to discussions and debates regarding works, must have information about their nature and value. Since this is so, it stands to reason that those who elected them--namely, all members of the institute--should have it too. Therefore, each apostolic institute in today's world needs its own official directOry, revised and published annually and containing information on the residence and mission of each member. The directory, which would be an implicit demographic study of the institute, should contain, as well, an annu-al financial statement of the institute and its provinces, with statistics on works which had some elements in common. I believe this would assist greatly in the appropriate placement of personnel and act as a deterrent to increasing fragmentation in ministries. Forum for Challenge. If members of religious institutes with at least parallel qualifications to lay teachers are to have the same work opportuni-ties in the institutes' traditional ministries, then positions that are open should be advertised first within "the system." Trade unions insist on this 680 / Review for Religious, September-October 1991 right for their civilly employed members, so it should not be too much to expect within the religious institutes themselves. As well, religious subjects often have insights and ideas for better management which are unknown to superiors. They should have the opportunity to share them. Their ideas may be of benefit to all so that problems like unemployment may be addressed before they gain a hold. Since religious women were, for over a hundred years, to an extent indoctrinated not to express an opinion, they will need to be encouraged to contribute. Therefore, internal journals which contain forums for challenge must have a mandate from a competent authority and must be frequent and regular. When what is written in them is not uncharita-ble- that is, criticizes a policy or a structure and does not attack a particular person--and is limited in audience to professed members of the institute, then it is not a threat to loyalty. Indeed, such a forum could become a c.orpo-rate examination of conscience and could preserve or restore the balance between responsibility for authentic mission and the rights of the person. It could also act as a specific prevention or cure of the evil of unemployment within the religious institute. In educating religious to the use of an internal journal, it should be pointed out that the institute, being made up of human beings, is quite subject to error and that it could be harmful to their beioved congregation to write only of its virtues and to overlook its faults, including possibly incorrect policies with regard to the placement of personnel. Conclusion More than twenty years have passed now since religious congregations first experienced declining numbers and lay teachers became an ac.cepted part of Catholic education here in Australia, so there has be~n adequate time to face up to problems which have occurred regarding recruitment for specif-ic works. Sister Georgine recommends that a program "address all the dimensions of employment and unemployment." However, "job clubs" and "comprehensive programs" are unlikely to take shape until religious leaders acknowledge that the problem is there. I believe that leaders also have the duty to provide those engaged in the works with information and reflection based on surveys or particular works so that they will know what the scope of that work will be in the future, how long the work itself is likely to sur-vive, and what the superiors are planning in that regard. There is no guarantee that any of the above proposals are a complete cure for the evil of unemployment within religious life. However, endeavor-ing to maintain a correct balance between responsibility f~r the mission and respect for the persons of the members of the institute goes to the causes of the evil and is more likely to effect a long-term cure. The use of appropriate Mission or Consecrated Religious Person? / 681 media is a method of achieving the "maximum feasible participation" in effecting a cure. We are living in a world at the brink of the third Christian millennium. It is a world which needs the commitment of consecrated reli-gious life as much as ever and perhaps more than ever. A life wholly dedi-cated to contemplation is a rare gift. However, there is plenty of evidence to indicate that apostolic institutes of consecrated life have an important place in contemporary society. The chief characteristic of Christian moral doctrine besides its Christocentric orientation is the integration of love and justice, the latter being "the strong and firm will to give to each his due.''5 For a reli-gious woman who has sacrificed potential marriage, motherhood, and career in order to serve the Church in an institute devoted to apostolic ministry, unemployment is a serious injustice. The Church and religious institutes should work together for both prevention and cure. NOTES I See R. Hoffman, "Mission," in The New Catholic Encyclopedia. 2 For the purpose of the present article, the word employment will sometimes refer to apostolic work, whether or not the religious has employment status in the civil law. 3 The present writer admits to a certain bias towards instrumental music teaching. I believe that this work is of great importance to the liturgy of the Church. One of the long-term effects of the mergings of parish schools and the employment of lay teach-ers in Australian Catholic education was the death of much traditional music prac-tice, which was not absorbed into the diocesan systems and had few protective structures. It seems to me that the most important strategy for preserving the practice of music is to remove revenue management from the hands of the individual teacher. Otherwise the work tends to become like that of a self-employed person--a situation which is not compatible with either poverty or obedience. Skilled musicians in parishes attract worshipers. I believe that budgeting towards producing musicians for the Church should be part of its primary mission. 4 The idea of permitting novices to have unlimited scope in "working out" their future ministry is, I believe, a recipe for disaster; apostolic congregations already have difficulty in staffing missions recognized as authentic to their charism. 5 New Catholic Encyclopedia, vol. 8, p. 70. Quotation from St. Thomas Aquinas (ST 2 a2ae, 58.1). Inner Africa: A ,Journey of Conversion Susan Rakoczy, 1.H.M. Sister Susan Rakoczy, I.H.M., began ministry in South Africa in October 1989 and currently lectures in systematic theology and spirituality at St. Joseph's Theological Institute in Cedara. Her address is 21 Buchanan Street; 3290 Howick; South Africa. It was about 2:30 in the morning as the door of the plane was opened. The humid and steaming air of West Africa enveloped me as I was pushed down the stairs by the crowd onto the tarmac of Ougadougou airport. Swept along with women carrying immense bondles on their heads, children looking for their parents, and determined men striding forward, 1 suddenly thought, "I am on holy ground--I am in Africa." But if I had bent down to kiss the ground I would have been trampled--better to let myself be borne by the flow of humanity to the small airport terminal and the arrival procedures. In the rush and confusion of all the formalities I could sense that I had now entered something deeper than my own self for 1 was touching "mother Africa." Later, as we stowed our luggage in a friend's car for the drive to the hostel to spend what was left of the night I wondered, "What have I done with my life?" What indeed. ? The experiences of my years in Ghana (1982 to 1988) provided many different answers to that question. Most essentially they led me into the depths of conversion Which I can describe now as "inner Africa" for I soon learned that "mother Africa" would ask everything of me. The Call Some people dream all their lives of serving outside their own country, but that was not my experience. Not until I was finishing my doctoral studies in religion at Catholic University in 1980 did I sense a call to serve beyond North America. Through the months of preparation, prayer, and discussion 682 Inner Africa: A Journey of Conversion / 683 which preceded my journey to Ghana, people often asked, "Why are you going?" Slowly I clarified my own sense of call, speaking of my desire to share something of my gifts and education with the "young Church" of Africa. As I read about Africa and its needs, struggles, and promise I became aware of a continent and Church reaching towards maturity of faith and vision. Somehow I sensed very deeply that I wanted to be part of that. But it is not enough just to desire to serve in Africa. It is an immense continent, large enough to contain the continental United States two-and-a-half times. I received an invitation to teach in the major seminary in northern Ghana (our congregation had come to that section of the country in 1976) and so the plan was to come and spend a year getting acquainted with the culture and life of the people and then to begin teaching in 1983. As with many people who come to Africa, things did not turn out quite as I had planned. While I did work in Navrongo, a small town in Ghana for a year, the seminary door never opened wide enough to admit a woman theologian. But life at the Centre for Spiritual Renewal, a retreat center in the city of Kumasi, gave me a much wider scope for ministry with opportunities in retreats and spiritual direction, intensive leadership formation with prayer group leaders, and writing and editing, all of which enabled me to enter more deeply into Ghanaian life and culture. All the preparation I tried to do, while helpful in some ways, was still inadequate to the challenge of Africa. After I arrived I realized that what I needed was a radical openness, a sense of adventure, a desire to meet the continent and its people on their own terms. As the day of departure neared my own sense of expectancy of what was ahead increased. Shortly before I left I spent a few days on retreat at our com-munity hermitage. The entries in my journal for those days speak of praying for courage and joy and experiencing great wonder at this call I had received. The night before I left I wrote: Tomorrow~departure. I feel more than ready. Mostly I feel a deep free-dom and joy which has placed fear on the sidelines. Somehow 1 know I will meet the Lord--in and of his people--in ways never before imag-ined and experienced. And that is enough--more than enough--to move me across oceans and cultures. 1 go in utter joy and freedom. As the plane left United States soil the next day, ! remember how my whole spirit moved forward towards Africa. Soon I descended the steps of that plane that hot morning in Ougadougou. Inner and outer Africa now began. Call To Conversion As I reflect on my years in Ghana, I experience them in the images of 684 / Review for Religious; September-October 1991 "outer" and "inner" Africa. The first was the living of African reality in terms of my ministry; it describes what I did, with whom I lived, the rich-ness of my experience in those years. But "inner Africa" was the core of it all. My years in Ghana were fore-most an experience of conversion--a turning from, in order to turn to some-thing else, something which challenged everything I thought I was, knew, and had within me. Paul Robb, S.J., describes well the essence of conversion as a journey into the unknown: It is difficult to endure conversion because it seems to put into jeopardy our very lifestyle and ministry, but even more so because we sense that it touches the very roots of our life. It reaches deep into our being---our personality, our choices, our very self. It touches in places that are unknown, places where we are strangers. To begin a journey into an unfamiliar, haunting land is frightening, but not to know whether we will find life or death, blessing or curse, at the end can be terrifying. To enter the journey with all its uncertainties proves the possibility of finding life and life in abundance. Not to begin the journey, but to harden and steel oneself against it, is already death.2 The images are true and strong and evocative of my own African experi-ence. In my first weeks, as I entered "outer Africa" in its immensity with all the challenges of a new culture, 1 also experienced a sense of inner chaos. Some days I felt as if I were drowning, the waters of Africa enveloping me, About two months after I arrived I realized that I had to truly "walk through the door of Africa" ifI were to survive. In my journal I wrote: I have straddled first- and third-world existence in great disharmony. Today I felt that part of this is ended--it is within Africa now--that (God's) grace will work, from the inside out. It is as though 1 have now truly entered Africa. Once I had walked onto the solid ground of Africa never again did I feel this inner chaos. The work of conversion could now begin. These conver-sions were multiple and touched every dimension of my life as a North American woman of faith in a radically different culture: My first-world perspective was turned upside down; I was called from idealism to realism; I moved from giving to receiving; 1 experienced strength becoming weakness; I passed from death to life--from myself to God alone. Inner Africa: A Journey of Conversion / 685 First-World Perspective Turned Up-Side Down We come to a new culture as we are. If we are even halfway faithful to the challenges of cross-cultural experience, our own self-understanding of our home culture will change dramatically. This I experienced very pro-foundly. I discovered that I had brought a very large amount of cultural bag-gage with me. It was disconcerting to be criticized as "too American" at times--that is, too self-assured, too curious, too organized, too conscious of time; too ready with my questions and opinions. What was salutary, if painful, was the opportunity to allow my world-view to shift into new patterns. I first learned that the United States is not the center of the universe, even if it often acts that way and its military and eco-nomic policies impact the rest of the planet in such dramatic ways. It is one country among many, with its own strengths and weaknesses. I learned also how diverse and beautiful are the gifts of the people of other countries. 1 especially experienced this gift in the opportunities 1 had to meet people from so many different parts of the world and to enter into something of the richness of the world's cultural heritage, to see how differently people can feel, think, and organize human life. There were two central ways in which my world began to be "turned upside down": my experience of poverty and my attempts to learn new dimensions of the common life and hospitality. Poverty is a hard and often a "loaded" word. We fight it and yet some-how sense that in being poor we will find the key to new life in solidarity with others. The Gospel's call to detachment from riches and from every-thing that would hinder our response to the invitation from Jesus to disciple-ship has always challenged Christians profoundly. To come to Ghana was certainly to see poverty and share in it in some small ways. It was indeed a shock for me to see the extent of poverty and marginality: lack of clean and safe water for so many, schools with few books, hospitals and clinics without supplies, limited transportation, rudi-mentary communication, erratic electricity. Some of the practical details of my new lifestyle were a challenge. It was "farewell" to dependable electrici-ty, unlimited water, telephone service, easily available fuel, and to book-shops, movies, and regular postal service. It was, on the other hand, "hello" to a sense of living on the "edge of things" at times--lanterns and attempts to get kerosene for them, recycling every possible drop of water, limited food supplies, simple amusements, and difficulties in communication. All these changes were hard in different ways. I wrote: I am struck again by the gap between theory and practice in my life, for 686 / Review for Religious, September-October 1991 example, to talk about poverty, being with the poor--and then not to embrace poverty wholeheartedly, as indeed Jesus did. The:conversion to acceptance of and a certain ease with my new simple lifestyle took time. I never did get used to the erratic postal system and its consequences for poor communication with family and friends. On the other hand, as the years went by I gradually experienced in myself a certain ability to live with much less and to find in that a real freedom. To have to do things simply and patiently experience inconvenience gradually became a way for me to share some sense of solidarity with the poor who have no options and no outside resources. I was becoming comfortable with the simplicity of Ghanaian life and my heart was slowly becoming centered on what was most essential. I was not poor in the way the ordinary Ghanaian is poor but I did come to experience in small ways the shocks and diminishments of poverty. 1 also learned new meanings of community life and hospitality because African life is lived in common. The extended family of several generations living together in one compound has been the normal pattern in rural areas. Daily activities take place outside, and people are inside only when it is rain-ing, or at night, or if they are sick. The atmosphere in both urban and rural areas is one of physical and psychological openness to friend and stranger. Entering into such a different cultural atmosphere of hospitality and availability also challenged my Western habits. In the West we live inside; people come into our lives generally at our convenience thanks to the cultur-al presuppositions that one lives by calendars and schedules. But in a situa-tion where the culture says "welcome" all that changes. People walk into one's life often unannounced, and the person at the door could bring the unexpected pleasure of a friend coming to visit or someone arriving for a retreat without any previous communication or someone coming to ask for prayer---or the bishop with overseas visitors. 1 learned to be always ready to adapt to people's needs and to realize that my life and my time were really no longer my own, Prayer time was often interrupted; reading and study had to be immediately abandoned to answer someone's need. Privacy became very relative since, although I had my own room and office, my own space and time were now the resources of the people I tried to serve. These demands taught me much about my own selfishness, the need to have my own way, my own schedule, my own plans. I never did become totally comfortable with being physically and psychologically available at all times. Yet gradually I learned to absorb something of the spirit of welcome and hospitality which are so important in Ghanaian culture and to live them in my halting way. Inner Africa: A Journey of Conversion / 687 The first dimension of conversion in my life then was a shift in con-sciousness from being a woman of the first world to one living in the third world and trying to enter fully into life there. My American perspective and cultural habits were turned upside down and inside out. The result was a double-consciousness for I saw, and felt, and experienced first- and third-world realities at the same time. Nothing could or would be the same again. From Idealism to Realism Soon after I came to Ghana I realized what a "good press" the African Church has in the West. The reading I had done before I arrived had given me the overwhelming impression of a "young Church" on its way to real inculturation as a true African expression of the Christian faith, with signifi-cant achievements already made in liturgy and catechesis. It is true that inculturation is happening, theological development and reflection are proceeding, liturgy is more authentically African in some places--but the pace of everything is slow and that is the pace of Africa. Idealism about the Church was gradually replaced by a realism about the Church as it is. To be a "young" Church is exactly that. In the southern part of Ghana modern Catholic

Issue 21.5 of the Review for Religious, 1962. ; JOHN XXIII M editatiOnS on the Rosary [On September 29, 1961, Pope John XXIII. issued the apos-tolic epistle, II religioso convegno, in which he exhorted the faithful.to recite the Rosary for the intention of peace among nations,Later on April 28, 1962, the Holy Father issued another apostolic epistle, Oecumenicum Conciliurn, urging the saying of the Rosary for the success of Vatican Council II. To assis~ the faithful in a fruitful saying of the Rosary, His Holiness com-posed a set of meditations on each mystery of'the Rosary: These are here translated from the original Italian text as given in Discorsi, Messaggi, Colloqui del Santo Padre Giovanni XXIII, v. 3 (Vatican City: Vatican Polyglot Press, 1962), pages 762- 72.] THE JOYFUL MYSTERIES The Annunciation This is the first luminous point of contact between heaven and earth; ,.it is the first of the greatest events in the history of the ages. In this mystery the Son of God, the Word of the Father through whom "all things were made". (Jn 1:3) in this order of creation, takes on a human nature; He becomes man in order that He might be the Redeemer and the Savior of man andof all humanity. Mary Immaculate, most beautiful and most fragrant flower of all creation, by her "Behold the handmaid of the Lord" (Lk 2:38) given in reply to the words of the angel, accepts the honor of divine motherhood; and at that instant it is fulfilled in her. We who were once born with our father Adam as adopted ~hildren of God and who then fell from this grace are now today brothers, adopted sons of the Father, because we have. been re-stored to our adoption by the redemption which begins with this event. At the foot of the cross we shall be sons of Mary together with Christ conceived by her at this moment. From this event on she will be the Mother of God and our Mother. + + + T~e Rosary VOLUME 21, 1962 397 0 the sublimity and the tenderness of this first mys-teryl As we reflect on this scene, our principal and constant duty is to thank the Lord because He has deigned to come to save us and because He has become man and our human brother. He is associated with us in the state of sonhood to the woman who at the foot of the cross will make us adopted sons. Since We are adopted sons of His heavenly Father, Fie has willed that we should also be children of the same Mother. In the contemplation of this first scene, besides the habitual thought of gratitude, our prayer should be di-rected towards a real and sincere effort to become hum-ble, pure, and actively charitable, for all these are virtues of which the Blessed Virgin gives us a shining example. The Visitation JOHN XXIH REVIEW FOR RELIGIOUS 398 What graciousness and sweetness is to be found in this three-month visit of Mary with her beloved cousinl Both women bear a motherhood that will soon come to term. The motherhood of the Virgin Mary is the most sacred imaginable. A sweet harmony is to be found in the can-ticles that the two interchange with each other: on the one hand, "Blessed art thou amongst women" (Lk 1:42), and on the other, "The Lord has regarded the lowliness of his handmaid; all generations shall call me blessed" (Lk 1:48). The event .that happens here at Ain-Karim on the hill-top of 'Epron showers a light, both human and heavenly, on the bonds that unite Christian' families which have been formed by the ancient school of the holy Rosary: the Rosary recited every evening in the intimate circle of the home; the Rosary recited not by one or a hundred or a thousand families, but by all families; the Rosary recited in all places of the earth where man "suffers, struggles, and prays" (A. Manzoni, La Pentecoste, v. 6); the Rosary re-cited by those called by inspiration from on high to the priesthood, or to missionary work, or to a longed-for apostolate; the Rosary recited by all those who are called by motives, legitimate as well as pressing, to labor, to business, to military service, to study, to teaching, to what-ever occupation. During the saying of the Hail Marys of-this mystery, it is good to join ourselves to the many persons united to. us by blood, by family, and by every bond that sanctifies and therefore strengthens the feeling of love which binds us to those we particularly love: parents and children, broth-ers and relatives, fellow countrymen, fellow citizens~ All this should be done for the purpose of sustaining, increas-ing, and illuminating the presence of that universal char- ity the exercise of which is the profoundest and highest joy of this life. The Birth oI Our Lord At the time appointed by the laws of the human nature He has assumed, the Word of God madff ~th °comes forth from the holy tabernacle of the immaculate womb of Mary. His first appearance in the world is in a man-ger where animals feed and where everything is. silence, poverty, simplicity, innocence. The voices of angels re-sound in the heavens as they announce the peace which the new-born Infant brings to the world. The first wor-shipers are Mary His Mother and Joseph His foster Father; afterwards humble shepherds come from the hill-side, invited by angelic voices. Later will come.a caravan of nobler rank led by a star; they will offer precious gifts pregnant with hidden meaning: In this night of Bethle-hem everything speaks in a language understandable by all. In this mystery, there should be no one who does not bend his knee in adoration before this crib, no one who does not gaze at the eyes of the divine Infant as they look into the distance as though viewing all the peoples of the earth passing one after another before His presence. He recognizes them all, knows them all, and smilingly greets them all: Jews, Romans, Greeks, ,Chinese, Indians, the peoples of Africa, the peoples of every region of the universe, of every epoch of history, it makes no difference if the regions be far distant, solitary, remote, secret, and unexplored; nor does it matter whether the epoch is past, present, or future. During the praying of this decade the Holy Father likes to recommend to the new-born Jesus the uncount-able number of babies of all the peoples of the earth who in the preceding twenty-four hours have come to the light of day everywhere on the face of the earth. All of them, whether they will be baptized or not, belong by right to Him, to this Babe born in Bethlehem. They are His brothers, called to a lordship .that is the,highest and gentlest in the heart of man and in the history of the world. It is a lordship that alone is worthy of God and of men, a lordship of light and of peace; it is the "kingdom" we pray for in the Our Father. The Presentation in the Temple Christ, supported by the arms of His mother, is offered to the priest; at the same instant He holds out His own armsin front of Him: it is the meeting of the two Testa-ments. There is an advance here towards "the light and revelation of the Gentiles" (Lk 2:32), to Him who is the splendor of the Chosen People, the Son of Mary, Present ÷ The Rosary VOLUME 21, 1962 399 ÷ ÷ ÷ JOHN XXIII REVIEW FOR RELIGIOUS 400 also is Joseph who equally shares in the presentation rites prescribed by the Law. In a different but analogous way this episode is con-tinued and perpetuated in the Church; while we recite this decade how good it is to contemplate the field grow-ing to harvest: "Lift up your eyes to the fields already white with the harvest" (Jn 4.:35). This harvest consists of the joyful hopes of the priesthood and of co-workers of the priesthood; there are many of these in the kihgdom of God and yet never enough, They are the youths in semi-naries, in religious houses, in missionary institutes; and because all Christians are called to be apostles, they are also in Catholic universities; they are all those other hopes of the future apostolate inseparable from the laity. It is an apostolate which grows in spite of difficulties and of opposition; it enters even .into nations suffering from per-secution; it offers and will never cease to offer a spectacle so consoling that it calls forth words of joyful admira-tion. "The light and revelation of the Gentiles".(Lk 2:32); the glory of the Chosen People. The Finding in the Temple Christ is now twelve years old. Mary and Joseph ac-company Him to Jerusalem for the prescribed worship. Unexpectedly He disappears, unseen by their vigilant and loving eyes. Their anguish is great and for three days they search for Him in vain. Sorrow is succeeded by joy when they find Him in the area around the Temple, hold-ing discussions with the doctors of the Law. How signifi-cant and detailed are the words With which St. Luke de-scribes the scene: "They find him in the midst of the doctors, listening to them and questioning them" (Lk 2:46). At that time a meeting such as this had a deep sig-nificance: knowledge~ wisdom, guidance of practical life in the light of the .Old.Testament. Such at every moment of time is the task of human in-telligence: to collect the thought of the ages, to transmit sound teaching, firmly, and humbly to lift the gaze of scientific investigation to the future, for we all die one after the other and we go to God; humanity journeys to-wards the future. Both on the level of supernatural and natural knowl-edge, Christ is never absent; He is always found there at His place: "One only is your mfister, Chrisi" (Mt 23:10). This fifth decade, the last of the joyful mysteries, should be considered a specially beneficial invocation for all those called by God through the gifts of nature, the cir-cumstances of life, the wishes of superiors, to the service of truth. Whether they are engaged in research or in teaching, whether they diffuse knowledge long attained!. or new techniques, whether they write books or are con-cerned with audiovisual projects; all of them are invited to imitate Jesus. They are the intellectuals, professional men, journalists. All of these, especially journalists since they are characterized by the daily duty of honoring truth, should communicate the truth with religious fidelity, with the utmost prudence, and without fantastic distortion or falsification. Let us pray for all of these, whether they be priests or lay persons; let us pray that they be able to listen, to the truth--and for this ther~ is needed great purity of heart. Let them learn to understand the truth---and for this great humility of mind is required. Let them be able to defend the truth--and for this is required that which was the strength of Christ and of the saints, obedience. Only obedience secures peace and.victory. THE SORROWFUL MYSTERIES The Agony in the Garden The mind returns again and again to thescene of the Savior in the place and hour of His supreme abandon: "And his sweat became as drops of blood running down upon the ground" (Lk 22:44). It is an interior p~iin of the soul, the bitterness of an extreme loneliness, the fail-ing of an exhausted body. It is an agony ,that could be caused only by the Passion which.Jesus now sees not as distant or even as near, but as already present. The scene of Gethsemani gives us the strength and the courage to strain, our wills to accept even great suffering when that suffering is willed or permitted by God: "Not my will but thine be done" (Lk 22:42). These are words that both wound and heal; they teach us the glowing ardor that can and should be reached by the Christian who suffers together with the suffering Christ; they give us a certainty of the indescribable reward of the divine life that exists in us now through grace and will be in us later through glory. In the present mystery the particular intention that should be considered is the "solicitude for all the Churches" (2 Cor 2:28), the anxiety that troubles the mind as the wind disturbed the lake of Genesareth: "The wind was against them" (Mt 14:24). This is the object of the daily prayer of the Holy Father: the anxiety of the most fearful hours of his pastoral ministry; the anxiety of the Church which suffers with him throughout the world, while at the same time he suffers with the Church present and suffering in him; the anxiety of souls and of entire portions of the flock of Christ that are subjected to perse-cution against the freedom to believe, to think, and to live. "Who is weak, and I am not alsoweak?" (2 Cor I 1:29). + + + The Rosary VOLUME 21, 196Z 401 JOHN XXIII REVIEW FOR RELIGIOUS 402 This sharing in the sorrows of the brethren, this suffer-ing with those who suffer, this weeping with those who weep (Rom 12:15) is a merciful blessing for the entire Church. Is not this the communion of saints that each and all possess in common the Blood of Christ, the love of the saints and of the virtuous, and, alas, our sin and our in-firmity? We should continually reflect on this communion which is a union and, as Christ said, a kind of unity: "That they may be one" (Jn 17:22). The cross of our Lord not only ennobles us, it draws souls: "And I, if I be lifted up from the earth, will draw all things to myself" (Jn 12:32). The Scourging This mystery recalls to our minds the merciless lashing of the immaculate and holy.Body of Christ. Human na-ture is composed of body and soul. The body endures humiliating temptations, while the will in its weakness can easily be carried away. In this mystery, then, is to be found a reminder of that salutary penance which implies and involves the true well-being of man, a well-being which comprehends bodily welfare and spiritual salvation. The teaching that comes from this mystery is important for all. We are not called to a bloody martyrdom but to the constant, discipline and daily mortification of our pas-sions. This path is a true way of the cross, daily, inevitable, necessary; at times it can become heroic in its demands. By it we gradually arrive at an ever greater resemblance to Christ, at a participation in His merits, at a greater cleansing of every fault through His immaculate Blood. We never arrive at this by way of easy enthusiasm or by way of useless and ineffective extravagance. His Mother, stricken with sorrow, sees Him after His scourging; her affliction is overwhelming. How many mothers desire to see their children grow perfect as they initiate them into the discipline of a good training and of a sound life; yet instead they must mourn the disap-pearance of their hopes, saddened because so much care has led to nothing. The Hail Marys of this mystery, then, will ask of the Lord the gift of purity for the family, for society, and espe-cially for young people since they are most exposed to the seductions of the senses. They will also plead for strength of character and for loyalty in the face of all trials tO teaching already received and to resolutions previously made. The Crowning with Thorns The contemplation of this mystery is especially con-cerned with those who bear the burdensome responsibility of the direction of social life; it is the mystery of those whoi govern, who make laws, and. who judge. On the head of this King, there is a cross of thorns. So also on their .heads there will be a crown; it is a crown that undeniably shines with the glow of dignity and distinction; it is a glow that comes from an authority that comes from God and is therefore divine. Yet interwbven into this crown are things that press down, that pierce, that bring perplexity, that tempt to bitterness; it is in brief a crown of thorns and of worry; and it is this even aside from the sorrow caused by the ill will and faults of men, which is a sorrow all the more keen as one loves them and has the duty of representing to them the Father who is in heaven. Another useful application o~ the mystery would be to think of the serious responsibilities of those who have re-ceived greater talents and hence are bound to bring forth fruit in proportionate measure by means of a persevering exercise of their faculties and of their intelligence. The service of thought, the duty of those so endowed to act as a light and a guide to others, should be carried out pa-tiently,, while temptations of pride, of egoism, and of de-structive separation are avoided. The Carrying of the Cross Human life is a long and burdensome pilgrimage; it is an upward journey over the rocky ascents that are marked to be the lot of all men. In the present mystery Christ represents the human race. If each man did not pos-sess his own cross, sooner or later he would fall by the way-side, tempted by egoism or by indifference. By contemplating Christ as He climbs up Calvary, we learn--more through the heart than the mind--to em-brace and to kiss the cross, to carry it with generosity and even with joy according to the words of the Imitation of Christ: "In the cross there is salvation; in the cross there is life; in the cross there is protection from our enemies and a pouring forth of a heavenly sweetness" (Book l, Chapter 12:2). And should not our prayer extend also to Mary who in her sorrow follows Christ in a spirit of intimate participa-tion in His merits and in His sorrows? This mystery should bring before our eyes the immense scene.of those in tribulation: orphans, the aged, the sick, prisoners, the weak, refugees. For all of these let us ask for strength and the consolation that only hope can give. Let us repeat tenderly and with the hidden interior tears of the soul: "O cross, hail, our only hope" (Vesper Hymn of Passion Sunday). The Crucifixion "Life and death meet in a wondrous battle" (Sequence of the Easter Mass); life and death are the two significant The Rosary VOLUME 21, 1962 4O3 and decisive aspects of the sacrifice of Christ. From Bethle-hem's smile-~one such as is found in all the sons of men at their first appearance on this earth--to Calvary's last breath and gasp which gathers into one all our sorrows in order to sanctify them and which expiates our sins in or-der to blot them out; this is the life of Christ on earth among us. And Mary stands near the cross as she once stood near the Babe of Bethlehem. Let us pray to her, our Mother, that she may pray for us "now and at the hour of our death." In this mystery we can see outlined the mystery of those who will never acknowledge the Blood which has been poured forth for them by'the Son of God. It is the mystery especially of obstinate sinners, of the unbelieving, of those who receive and then reject the light of the gospel. Such thoughts cause prayer to break forth in one immense sigh, in one burst of grief-stricken reparation in a worldwide view of the apostolate. We beg wholeheartedly that the Precious Blood poured forth for all men may finally give to all men salvation and conversion and that the Blood of Christ may give to all a pledge and a token of life eternal. THE GLORIOUS MYSTERIES + + + JOHN XXIII REVIEW FOR RELIGIOUS The Resurrection This is .the mystery of death confronted and defeated. The Resurrection marks the definitive triumph of Christ and it is at the same time the assurance of the triumph of the Catholic Church over adversities and persecutions past and present. "Christ, Lord of glory; Christ, Prince of na-tions; Christ, King of kings." It is good to recall that the first appearance of the risen Christ was to the women who had been close to Him during His humble life and who remained close to Him even on Calvary. In the splendor of this mystery the gaze of our faith goes out to the living souls now united with the risen Christ, the souls of those dearest to us, the souls of those who were close to us and with whom we shared the anguishes of life. In the light of the Resurrection of.Christ there rises up in our hearts the remembrance of our dead. Remembered by us and aided by the sacrifice of the crucified and risen Lord, they still share in that better life of ours which is prayer and which is Christ. It is not without reason that the Eastern liturgy con-cludes the funeral rite with an Alleluia for all the dead. Let us ask for the dead the light of an eternal resting place while at the same time our thoughts are directed to the resurrection of our own mortal remains: "I await the resurrection of the dead." To be able to await, to place one's continual trust in the promise of that of which the Resurrection of Christ is a sure pledge--this is a foretaste of heaven. The .Ascension In this scene let us contemplate the,consummation and final fulfillment of theprortiises of Christ.~It is. His' re-sponse to our .longing for paradise. His final return to the Father from whom He had descended to us in the world gives us assurance that He has prepared a place for us: "I go to prepare a place for you" (Jn 14:2). This mystery, above all others, presents itself as a light and a guide to those souls who strive to follow their proper vocations. This is the background of that spiritual ac-tivity and ardor that contin.ually burn in the hearts of priestswho are not held down and distracted by the goods of this earth but seek only to open to themselves and to others the ways that lead to sanctity and perfection. This is that level of grace to which one and all must come; priests, religious, missionaries, laypersons devoted to-God and the Church, souls that are the good odor of Christ (2 Cor.2:15). Where such are, Christ is felt to be near; and they already live in a continual union with the life of heaven. This mystery teaches and urges us not to allow ourselves to be held back by that which burdens and weighs down the soul, but to abandon ourselves to the will of the Lord who draws us upwards. The arms of Christ, .as He returns to His Father at His Ascension¯ into heaven, are extended in blessing on the Apostles and on all those who follow them in their belief in Him. In the hearts of such there is a calm and serene certainty of a final meeting with Him and with all the saved in the realm of eternal happiness. The Descent of the Holy Spirit At the Last Supper the Apostles received the promise of the Spirit; later in the Cenacle, with Christ gone but Mary present, they receive Him as the supreme gift of Christ; what else indeed could the Spirit of Christ be? And He is the Strengthener and the Vivifier of souls. The Holy Spirit continues to pour forth His grace on and in the Church day by day;.centuries and peoples belong tothe Spiri~ and to the Church. The triumphs of the Church are not al-ways apparent externally; but they are always there, full of surprises and marvels~ The Hail Marys of this mystery are directed towards a special intention in this year of fervor as we see the pilgrim Church plan and prepare an ecumenical council. The council is to be a new Pentecost Of faith, of the apostolate, and of extraordinary graces for the well-being of men and the peace of the entire world. Mary, the Mother of Christ The Rosary VOLUME 2I, ~.962 405 ÷ ÷ JOHN XXIII REVIEW FOR RELIGIOUS 406 and our own living Mother, is with the Apostles in the Cenacle at Pentecost. Let us ever remain close to her through the "Rosary during this year. Our prayers united with hers will effect once more the ancient event of Pente-cost; it will be the rise of a new day, the dawn of new ac-tivi. ty for the Church as she grows holier and more catholic in these our times. The Assumption The lovely image of Mary becomes glowing and bril-liant in this greatest of exaltations that a creature may have. How full of grace, of sweetness, and of solemnity is the dormition of Mary as the Christians of the East love " to think about it. She lies there in the quiet sleep of death; Christ stands near her, holds her to His Heart as though the soul of Mary were an infant; thus is symbolized the wonder of Mary's immediate resurrection and glorifica-tion. The Christians of the West, on the other hand, prefer to raise their eyes and their hearts to follow Mary as she is assumed body and soul into the eternal kingdoms. It is in this way that our greatest artists have represented her in her incomparable beauty. Let us too follow her in this way; let us allow ourselves to be carried away with her amid the angelic procession. On days of sorrow this scene is a source of consolation and fidelity for privileged souls--and we. can all be such if we respond to grace--whom God silently prepares for the greatest of triumphs, that of sainthood. The mystery of the Assumption makes the thought of death, including our own, familiar to us; it gives us the light of a serene abandon of ourselves, for it familiarizes and accustoms us to the thought that, as we would desire, the Lord will be near us in our death agony to gather into His hands our immortal souls. May your favor be always with us, 0 immaculate Virginl The Coronation of Mary This is the synthesis of the entire Rosary which thus ends in joy and in glory. The great theme that opened .with the Annunciation of the angel to Mary has passed like a thread of fire and light through each of the mysteries; it is the eternal plan of God for our salvation. It has been imaged in many scenes; it has been present in all the mysteries up to now; and now it ends with God in the splendor of heaven. The glory of Mary, the Mother of Christ and our Mother, shines in the splendor of the most august Trinity and is dazzlingly reflected in holy Church in all her states: triumphant in heaven, suffering in the confident expec-tation that is Purgatory, militant on earth. 0 Mary, pray with us, pray for us, as we know and feel you do. How real are the delights, how lofty the glory in the divine-human relationships of. affection, words, and life that the Rosary has given and continues to give to us. It softens our human afflictions; it is a foretaste of the peace of the other world; it is our hope fore'ternal life. ÷ ÷ ÷ The Rosary VOLUME 21, 1962 407 JOSEPH F. GALLEN, S.J. Practice of the Holy See ÷ ÷ ÷ Joseph F. Gallen, S.J., is professor of canon law at Woodstock College, Woodstock, Mary-land. REVIEW FOR RELIGIOUS This article gives, from January 1, 1959, the contents of replies or rescripts of the Holy See to particular re-quests and the practical points of constitutions approved by the Holy See. The rescript or approval is always that of the Sacred Congregation of Religious unless otherwise indicated. Similar articles appeared in the REVtEW ~oR RELICXOUS, I0 (1951), 22--24; 11 (1952), 12--18, 69--74, 151-- 58; 12 (1953), 252--72, 285--90; 18 (1959), 77--85, 156--68, 214--24. We have also listed under each heading the is-sues of the REvmw FOR RELIGIOUS in which the same mat-ter had been at least generally explained. Such references will be useful and sometimes even necessary because the practice of the Holy See is not fixed and invariable in sev-eral of the matters contained in the article. Choir and lay nuns. In one order of nuns, the titles now in use are choir nuns and lay nuns. The latter are therefore no longer called lay sisters in this order. In the same order, the lay nuns have a vote in the conventual chapter but not in elections. REwv.w ~-oR P~V.L~CIOUS, 15 (1956), 266-67. Change of the religious habit. Several congregations of sisters simplified the religious habit to some degree. A monastery of nuns was permitted to change the white veil of the lay sisters to black on trial for ten years and provided it was certain that the chapter of the monastery consented to the change. A federation of nuns changed the habit of its extern sisters to conform completely to that of the choir nuns. In one order of nuns, it is no longer of obligation for the habit to be of wool and the lay nuns now wear the same habit as the choir nuns. In granting a request for a change in the habit to a congregation of sisters, the Sacred Congrega-tion stated: "However, even for temporary changes of this nature, this Sacred Congregation requires that the matter be referred to each and every superior and sister. If the majority of those qualified to vote are in favor of the change . " The Holy See is approving constitutions that contain the following article: "No substantial, per-manent, or general change in the color or form of the habit may be made without the permission of the Holy See." R~vIEw FOR RELIGIOUS, 18 (1959), 80-81; 13 (1954), 298. Time of giving dowry (c: 547, ~§ 1'-3). Ina general revision of the constitutions of a congregation of sisters proposed to the Holy See, the article on this point was presented in the usual wording: "The dowry must be given to the congregation before the begihning of the noviceship, or at least its payment guaranteed in a man-ner recognized as valid indvil law," The Holy See added the following sentence: "The dowry may also be given in parts." The same article in another set of approved constitutions reads: "Each aspirant is obliged to bring a dowry . The dowry may also, for just reasons, be set up in installments or after the death of the parents, provision being made in the meantime for the payments of the an-nual interest." REVIEW FOR RELIGIOUS, 3 (1944), 229-30. Length of postulancy (c. 539). The Holy See is approving articles of the following type: "The time prescribed for the postulancy is one year. For a just reason and with the advice of the council, the mother general may shorten or prolong this time, but not beyond six months in either case." Before they are admitted to the noviceship, the aspirants are to make a postulancy of ten months, which may be reduced to six months or extended to sixteen months by the mother general with the advice of her coun-cil." "Before being admitted to the noviceship, the as-pirants must spend nine months as postulants. The pro-vincial superior or the superior general, as. the case may be, may prolong this time but not beyond an additional six months; she may shorten it, but never beyond three months." REVIEW FOR RELIGIOUS, 18 (1959), 82; 11 (1952), 151-53; 13 (1954), 301; 3 (1944), 410. Two years of noviceship in monasteries and federations of nuns. One entire federation of nuns was permitted to change its noviceship from a duration of one to two years. Two monasteries of the federation already possessed this permission. A monastery of another order was granted the same duration of the noviceship on trial for five years, and several monasteries of still another order are request-ing a noviceship of two years. REVIEW FOR RELIGIOUS, 18 (1959), 83-84; 13 (1954), 301. Dispensation from second year of noviceship. The Holy See dispensed from the sec-ond year of noviceship in favor of a-novice who had been professed of perpetual vows in another institute. REVIEW VOR RELIGIOUS, 18 (1959), 84; 12 (1953), 260; 13 (1954), 301. Those who may admit to the profession of a novice in danger of death. The Holy See continues to approve the following article: "Even though she has not completed 4" 4" 4" Practice o] the Holy See VOLUME 21, 1962' 409 ÷ ÷ ÷ ]. F. Gallen, $.]. REVIEW FOR RELIGIOUS 410 the time of her noviceship, a novice in danger of death may for the consolation of her soul be admitted to pro-fession by any superior, the mistress o/novices, and their delegates. " REVIEW EOR Ri~L*GIOUS, 18 (1959), 84--85; 15 (1956), 263-64; 1 (1942), 117-22. First profession out-side novitiate house (c. 574, § 1). Two congregations of sisters secured a dispensation for five years to have the first temporary profession outside the novitiate house, a third to do the same indefinitely in the chapel of the generalate, and four others to hold the reception and pro-fession ceremonies in a nearby parish church because of inadequate space in the novitiate chapel. REVIEW FOR LIG~OUS, 18 (1959), 156; 12 (1953), 264; 15 (1956), 222--24, Temporary prolession of l~ve years. Congregations of sis-ters continue to change from three to five years of tempo-rary vows. A prolongation of a five-year profession is limited to a year (c. 574, § 2), The Sacred Congregation does not insist on any determined division of the five-year duration, for example, out of fourteen approved changes, five congregations have five annual professions, two have three annual professions and one of two years, two have a profession of two years followed by one of three years, and five have a profession of three years followed by one of two years. REVIEW FOg RELIGIOUS, 18 (1959), 156-57; 16 (1957), 379-80; 15 (1956), 267; 12 (1953), 263-64; 13 (1954), 302-303. Abbreviation of constitutional duration of temporary profession. One congregation that has a pre-scribed temporary profession of six years was granted a dispensation to abbreviate this time by two years for an individual religious. REVIEW FOR RELIGIOUS, 12 (1953), 262--63; 19 (1960), 337--52. Reception o[ profession (c. 572, § I, 6°). Articles of the following type are approved and inserted into constitutions by the Holy See. "That it be received by the mother general or a sister delegated by her. Regional and local superiors and their legitimate substitutes are delegated by the constitutions to receive the renewal of ~'ows and with power also to subdelegate. They possess the same authority for the reception of other professions in the default of a sister expressly delegated by the mother general." REVIEW FOR RELIGIOUS, 18 (1959), 157--58; 16 (1957), 113; 8 (1949), 130--39. Renunciation o[ patrimony. In five dispensations for a sister of simple vows in a congregation to renounce her patrimony in [avor oI her congregation (c. 583, 1°), according to the printed and thus regular form of the rescript the dispen-sation was granted, "under the condition that the entire sum will be restored to the petitioner if for any reason whatever she leaves the congregation." This condition was not found in another dispensation in virtue of which the property was to be given to a brother and sister. RE-. VIEW fOR RELIGIOUS, 12 (1953), 257-59; 16 (1957), 311. No precedence in receiving Holy Communion. In one request for changes in the constitutions, the Holy See it-self added the following sentence: "No precedence is to be observed in approaching Holy Communion." REVIEW FOR RELIGIOUS, 9 (1950), 149; 18 (1959), 162; ~5 (1956), 25; 3 (1944), 252--67, 268~70, 428; 1'1 (1952), 213;' 12 (1953), 147--50. Feast of our Lady of Mercy. Several communities of the Sisters of Mercy have obtained from the Sacred Congregation of Rites the faculty of celebrating the feast of our Lady of Mercy, September 24, as a feast of the I class, with. a proper Mass approved on May 30, 1955 for the Sisters of Mercy of the Australian Union, and with the faculty also of using it as a votive Mass. REVIEW FOR RELIGIOUS, 18 (1959), 163; 12 (1953), 289--90. Obligation of the choral recitation of the Little Office of the Blessed Virgin by nuns. Authors commonly state that the obliga-tion of choral recitation is only under venial sin in the orders of nuns that are not obliged by their constitutions to the Divine Office but only to the Little Office of the Blessed Virgin. Some add that this is the Office recited by Visitandine nuns or give the Visitandine nuns as an ex-ample of the venial obligation cited above. Cf, De Carlo, ]us Religiosorum, n. 375, 8. In a rescript of October 26, 1959, the Sacred Congregation of Religious declared that the recitation of the Little Office of the Blessed Virgin, prescribed by the constitutions and spiritual directory of the Order of the Visitation of Holy Mary, is an obligation imposed upon the religious under venial and not under mortal sin. Change to the Short Breviar~ from the Little Office of the Blessed Virgih. This was granted on trial for one year to a congregation of sisters by the Sacred Congregation of Religious, on May 23, 1961, and to another congregation of sisters absolutely by the Sacred Congregation for the Propagation of the Faith, on March 4, 1960. Articles approved on the Little Office of the Blessed Virgin. The Holy See approved the following arti-cles of constitutions on this Office: "The sisters shall re-cite daily Lauds, Vespers, and Compline of the Little Office of the Blessed Virgin, using an approved transla-tion in the vernacular." "In formal houses, on Sundays and on the principal feasts of the Blessed Virgin, they shall recite in common the Little Office of the Blessed Virgin." REVIEW FOR RELIGIOUS, 20 (1961), 304--306; 18 (1959), 163; 9 (1950), 156; 6 (1947), 18--24; 2 (1943), 66, 406; 11 (1952), 44; 13 (1954), 129--30, 149--52, 299--300. Frequency o[ chapter of faults. The Holy See approved a requested change in the chapter of faults from once a week to once a month. REVIEW FOR RELIGIOUS, 13 (1954), 135; 7 (1948), 163--64. Indulgences. Privileged altar (cc. 916-18), A congregation of sisters obtained from the Sacred Penitentiary, Office on Indulgences, for seven 4- 4- 4. Practice o] the Holy See VOLUME 21, 1962 411 J. F. Gallen, S.J. REVIEW FOR RELIGIOUS 412 years that the main altar of its motherhouse .be a privi-leged altar for the dead. For recitation of the Little OI~ice o[ the Blessed Virgin. The indulgences commonly granted are listed in the Raccolta, n. 318. A congregation of sisters secured from the same source the following indulgences to be gained under the usual conditions: (1) A plenary indulgence, if the sisters recite this entire Office, even though interruptedly, in the presence of the Blessed Sacra-ment solemnly exposed or ~eserved in the tabernacle: (2) A partial indulgence of five hundred days for every hour of this Office that they have recited with at least a con-trite heart before the Blessed Sacrament, as above, and even though they do not recite the complete Office be: fore the Blessed Sacrament. Rv.virw for RELXG~OUS, 15 (1956), 24. Papal blessing at the end of a retreat [or those not physically present. Through their cardinal protector, a congregation of sisters obtained from the Holy Father, John XXIII, a privilege that permits the sisters who are in the infirmary and cannot go to the chapel to gain the plenary indulgence attached to the papal blessing given at the close of a retreat by hearing this blessing imparted by the priest on the public address system. Montague ex-presses the common opinion on this point briefly and clearly: "It should be noted that this privilege of receiV: ing the blessing and indulgence over the radio is attached by positive decree only to the blessing given by the Pope 'Urbi et Orbi'; when the Apostolic Benediction is given by a bishop or priest, its benefits accrue only to those who are physically present to receive it." Problems in the Lit-urgy, 374. Cf. Bouscaren, Canon Law Digest, II, 231,227; Ephemerides Liturgicae, 53 (1939), 122-23; De Angelis, De Indulgentiis, nn~ 143-50; Heylen, Tractatus de Indul-gentiis, 274; Coronata, De Sacramentis, I, 525, note 5; Cappello, De Sacramentis, II, n. 678, who holds that physi-cal presence is not necessary; Regatillo, Interpretatio et Iurisprudentia Codicis Iuris Canonici, 366; Dizionario Di Teologia Morale, 154; Ferreres-Mondria, Compendium Theologiae Moralis, II, n. 753; De Herdt, Praxis Litur-gica, III, n. 294; De Amicis, Caeremoniale Parochorum, n. 386, 3. Common cloister. Absence beyond six months. In giv-ing permission for an absence beyond six months outside the houses of the institute because of ill health (c. 606, § 2), the Sacred Congregation is adding (1) the granting of "an appropriate dispensation from the rules incom-patible with the state of infirm health 0f the aforesaid sister," and (2) the injunction to superiors: "The perti-nent superiors shall take care that the sick sister is aided as much as possible by a thoughtful charity, especially with regard to spiritual matters, and that she be properly assisted." Permission given [or as long as necessary. The' petition stated: "Sister has been a. mental patient for sev-eral years, and the doctors have advised that she remain in this hospital." When granted the permission was not for any determined period but for as long as necessary. REVIEW fOR REr.IGIOUS, 15 (1956), 289--91; 18 (1959), 166. Admitting sisters o[ other institutes into tho refectory ol a congregation. "This Sacred Congregation hereby grants a general dispensation from the prescriptions of arti-cle., of your constitutions so that you may receive at table in your refectory all those sisters of other communi-ties whom you take into your juniorate." REVIEW FOR RELIGIOUS, 15 (1956), 285--87. Papal cloister. Veil covering grille. The Holy See permitted the removal of the veil covering the grille in.the parlor of a monastery Of nuns for the visits of relatives and others at the discretion of the abbess; REVIEW for RELIGIOUS, 16 (1957), 40-41. Ad-mission .o[ instructors. One monastery of nuns was per-mitted for ten years to admit into papal cloister "quali-fied feminine instructors to train the nuns in such arts and crafts as are compatible with the life of enclosed nuns., for the time strictly necessary . ~' REVIEW FOR RELIGIOUS, 16 (1957), 43-48. Entrance of extern sisters. One monastery of nuns received the faculty, in 1959, to permit the finally professed extern sisters to enter the enclosure (I) to take part in the community exercises in-sofar as, according to the judgment of the prioress, their duties on the outside permit; (2) for private retreats; (3) medical and dental examination and care; (4) sleep, when the prioress deems it expedient; to permit the tempo-rarily professed extern sisters to enter the enclosure for their renewals of vows and final profession; that these, the second-year novices, and postulants be permitted to enter (I) for novitiate exercises; (2) community exercises and sleep, according to the discretion of the prioress; (3) private retreats; and (4) medical and dental examination and care. REVIEW VO~ RELIGIOUS, 12 (1953), 289; 16 (1957), 47-48; 21 (1962), 1--9. General chapter. Ordinary and extraordinary. The Holy See is consistently defining an ordinary general chap-ter as the one that takes place at the expiration of the term of office of the superior general and on the vacancy of this office by reason of death, resignation, or deposi-tion, whereas an extraordinary general chapter is one held for any reason other than the election of a superior gen-eral. REVIEW VO~ RELIGIOUS, 18 (1959), 244; "1 (1942), 146. Anticipation or postponement of' general chapter: The Holy See approves an article of the following type: "The assembly of the ordinary general chapter at the end of the six-year term of office of the superior general may for weighty reasons and with the consent of the general coun-cil'be convened three months before or after the expira-÷ ÷ ÷ Practice oy the Holy See VOLUME 21, 1962 413 ~. F. Gallen, S.J. REVIEW FOR RELIGIOUS 414 tion of the term." "The general chapter will be held three months before or after the expiration of the term of mother general." REvIEw for RELIGIOUS, 19 (1960), 302-303. Secretary general and treasurer general. The Holy See now demands that both of these be given ex officio membership in the general chapter and that the treasurer general~be elected by the general chapter. It permits the appointment of the secretary general by the superior general with the consent of the general council. By the law of one congregation, the secretary general and bursar general were not elected but appointed by the mother general with the Consent of her council. The)' also did not have ex officio membership in the general chapter. The mother general with the consent of her council requested that they be given such ex officio mem-bership. The request was granted only for the next gen. eral chapter, in which the matter was to be submitted to the discussion and vote of the general chapter and again proposed to the Sacred Congregation. In the case of another congregation, the Sacred Congregation refused a requested change of the constitutions from the election of the secretary general and bursar general by the general chapter to appointment by the mother general with the consent of her council for a term of three years each. In one definitive approval of constitutions, a gendral re-vision, and a request for particular changes in the con-stitutions, the secretary general and bursar general were given ex officio membership in the general chapter but they were to be appointed to their offices for a term of three years by the mother general with the consent of her council. The Sacred Congregation, in all three cases, approved such an appointment of the secretary general but changed the appointment to elefition by the general chapter in the case of the bursar general. The approved constitutions of a congregation that was made pontifical contain the following: "After the election of the superior general, the chapter shall proceed on the same day, or on the following, to the election of the four general coun-cilors and the general treasurer . As soon as convenient after the gene(al chapter, the superior general and her council meet for the appointment of the secretary gen-eral . The general council, the secretary general, and the treasurer general remain in office until the next elec-tive general chapter." REWEW for RELIGXOUS, 18 (1959), 218; 12 (1953), 286; 10 (1951), 190--91. Ex oficio member-ship of regional superiors. In some constitutions, these are given ex officio membership; in others, they are not. Local superior of the motherhouse. In one set of consti-tutions, this superior was given ex officio membership in the general chapter of an institute divided into provinces, Use of proposed revision for an approaching general chap.~ ter. One congregation of sisters asked permission to use for an approaching general chapter the section on the general chapter from a general revision of the constitu-tions that was being prepared. The Sacred Congregation granted this request only for the approaching general chapter and with the following changes. (1) This revision enacted that the elected delegates from the provinces were to be, "four from each large province which numbers at least two hundred sisters of perpetual vows; three from each small province; and two from the houses, immedi-ately subject to the mother general." The Sacred Congre-gation added the following clause to the last. part of this article: "provided the number of sisters in all these houses [those immediately subject to the mother general] is equal at least to the number of sisters in the smallest province." (2) The ex officio members of the general chapter were: the mother general, general councilors, secretary general, bursar general, former mothers general, and mothers pro-vincial. The Sacred Congregation added to this article: "Should there be a question of replacing an ex officio delegate to the general chapter, a sister shall be chosen by the mother general with the consent of her council, unless there is question of a provincial. A provincial will be replaced in the chapter by her assistant." This is the first case I have ever encountered of substitutes for the general officials in the constitutions of lay congregations, nor are such substitutes found in constitutions or general revisions of constitutions recently approved by the Holy See, Time of election of tellers and secretary of the general chapter. The Holy See approved the request of a congre-gation of sisters to transfer these elections from the day of the election of the mother general to the preliminary session of the general chapter on the preceding day. RE-VIEW FOR RELIGIOUS, 21 (1962), 63-64; 17 (1958), 229-30. Definitive system of delegates must be approved by the general chapter. A mother general obtained permission to use one of the group systems of electing delegates .for an approaching general chapter, but the manner of elect-ing delegates in the future had to be discussed and voted for in the chapter and again proposed to the Sacred Con-gregation for approval. In another congregation, a gen-eral chapter voted to change the method of electing its delegates but left the determination of the method to the decision of the mother general and her council, who decided on the system and requested the approval of the Holy See. The Sacred Congregation replied that the sys-tem must be first discussed in the general chapter and put to the vote of the chapter. An analysis of the house system of electing delegates. In its petition for a change to a group system, one congregation gave an interesting analy-sis of the house system that it was then using, that is, a 4- 4- Practice o~ the Holy See VOLUME 21, 1962 4. .L F. Gallen, S.]. REVIEW EOR RELIGIOUS 416 larger house was one of twelve sisters of perpetual vows, and the smaller houses were combined into groups of at least twelve and not more than twenty-four sisters of per-petual vows. According to the analysis, four-fifths of the houses had fewer than twelve sisters of perpetual vows. Houses Sisters 15 of 12 or more sisters 324 29 of 6 to 12 sisters 251 31 of less than 6 sisters 108 75 683 There were 60 houses with less than 12 sisters; 26 houses had no representation in the chapter; but 3 houses with 4 sisters and 1 house with 6 sisters each had two represent-atives. This analysis i~ interesting, but it is of a house system whose basic norm is a house of twelve sisters of perpetual vows. The more common practice in the house system is to require only temporary vows, that is, to give the religious of temporary vows active voice. This would increase the number of larger houses, that is, of houses of twelve or more sisters professed of at least temporary vows; but it would be profitable to know to what degree the number of larger houses would be increased in this case. It is also to be recalled that the function of a general chapter is to treat of the more important affairs that con-cern the entire institute, not those of a particular house. Representation from all houses is not essential to such a purpose. GroUp systems are now receiving greater atten-tion, but some houses will always lack representation in any form of the group system. REVIEW FOR RELIGIOUS, 18 (1959), 215--17, 307--308; 10 (1951), 189; 5 (1946), 264-65. Systems of electing delegates apprdved by the Holy See. Five groups according to horizontal precedence. In the following system, thirty-five delegates are elected from the houses. The advantage of this particular form is that there are only five groups, not ten or twelve as are usually found in this system. The smaller number of groups gives each sister a larger number to choose from in her group. The pertinent article is: ". The names comprising these lists shall be divided into five groups, arranged by seniority according to profession, the local superiors first, then non-superiors. These shall be formed by the general c6uncil and shall be arranged by distributing the names of the local superiors and then the non-superiors horizontally in parallel columns. Each sister shall vote for seven of the sisters, that is, three superiors, four non-superiors, in her own particular group, in such a way that thirty-five dele-gates, fifteen local superiors and twenty non-superiors, will be elected." The following system is similar but al-lows for an increase to ten groups: "The mother general, with the deliberative vote of her council, shall divide the congregation into five equal groups of perpetually pro-fessed sisters. The sisters shall be listed across the five columns in order of precedence. From this grouping, one superior in each column shall be chosen as a delegate. The non-superiors are then listed in rank across the col-umns. From these, two delegates from each column shall be chosen. Thus the total number of elected delegates shall be fifteen . The number of districts or columns may be increased to ten, in proportion to the number of religious in the congregation." REvmw VOR RELm~O.US, 18 (1959), 216~17; 20 (1961), 143; 21 (1962), 64. Graduated vote and exclusion of preferred position of local superiors. In the following system, no local superiors were ex officio members of the general chapter nor did any fractional part of the elected delegates have to be local superiors. ".All sisters perpetually professed ten years or more shall have passive voice. Delegates are elected by secret graduated vote. Each sister having active voice shall indi-cate, in order of her preference, the sisters having passive voice for whom she wishes to vote. Each ballot shall con-tain the space for twenty-five names. The name listed first will receive twenty-five points. The name listed second, twenty-four points, and so forth. Each sister having active voice shall vote for not more than twenty-five nor fewer than fifteen sisters having passive voice. Repetition of a name on this ballot renders the second listing invalid. Ballots containing more than twenty-five names or fewer than fifteen names are invalid." REVIEW ~'oR RELIGIOUS, 20 (1961), 379-80; 18 (1959), 217. Second balloting in votes mailed in to the higher superior. This large congregation is divided into regions. Five delegates are elected from each region. As in the preceding system, local superiors are given no preferred position¯ ". each of the sisters will indicate on a specially prepared ballot, provided by the regional superior, her choice of five of the eligible sisters. ¯. The mother general, in a meeting of the general coun-cil, shall open and examine the ballots . She shall then make known the results to the sisters in each of the houses ofeach region. (c) Any sister who has received a majority of the votes of the sisters of the region is declared elected. If among the other sisters voted for, none has received an absolute majority, the sisters of the interested region will vote once again, as be[ore~ [or as many delegates as did not receive such a majority in the first ballot. Upon receipt of the second ballots, the same procedure as in (c) shall be followed but a simple plurality suffices for elec-tion . The five sisters receiving the highest number of votes after those elected on the second ballot shall be re-garded as the substitute delegates for their region." Ter-ritorial groups in a large congregation. "The delegates + + + Practice o] the Holy See VOLUME 21, 1962 417 4, ~. F. Gallen, S.]. REVIEW FOR RELIGIOUS to the general chapter shall be elected by the sisters pro-fessed of perpetual vows, as indicated hereafter, divided into groups of not less than 75 and not more than 90 electors. The grouping of houses for the formation of elec-toral groups to choose delegates to the chapter shall be determined by the superior general, or as the case may ¯ be, the sister assistant, with the deliberative vote of her council. Each group shall choose by secret ballot two dele-gates, one a superior and one a non-superior. It shall moreover choose in like manner one superior and one non-superior as substitutes . On the appointed day the sisters of each group shall meet in a room of the desig-nated house. The senior superior shall preside . " Public voting in the chapter of alyairs. The Holy See continues to approve an article of the following type in the constitutions of congregations of sisters. "All these matters are decided by an absolute majority. If the votes are equal, the mother general has the right of deciding the matter after the third balloting. The voting is public. Any capitular, however, has the right of requesting a secret vote on a particular matter. Such a request shall be put to the public vote of the chapter. If a majority favor the request, the voting on the particular matter shall be secret." R~vIEw VOR RELIGIOUS, 17 (1958), 368-69; 21 (1962), 55-57. General councilor residing outside the motherhouse. The usual practice of the Holy See in approving consti-tutions permits two of the general councilors, with the exception of the assistant superior general, to live outside the motherhouse in a case of necessity, provided they can easily attend the meetings of the council and that they are always summoned to its sessions. The constitutions of one congregation command all general councilors, without exception, to live in the motherhouse. The Holy See gave a dispensation for three years from this law to permit a newly elected councilor to reside outside the motherhouse and thus remain as superior and principal of a high school in another city, provided that it was not a question of the assistant superior general, that the coun-cilor in question could easily attend all sessions of the council, and would be summoned to all of them. R~vi~w voR RELIGIOUS, 19 (1960), 130. ~General councilor also local superior. The general norm of the Holy See in ap-proving constitutions is that a general councilor should not have any other assignment that would prevent the proper fulfillment of the duties of a councilor. The con-stitutions of one congregation specifically forbid a general councilor to be also local superior. A local superior, in her fifth year of office, was elected a general councilor. The Holy See was petitioned and granted the dispensa-tion for her to complete the six years as local superior. The reason, given was that her supervision was necessary until the erection of a building then in process was com-pleted. REVIEW l~oR RELIGIOUS, 19 (1960), 130-31. Re-gional superiors are given delegated authorit)). It appears to be the present practice to give regional superiors only delegated, not ordinary, auth6rity. REVIEW Fo~'REILIGIOUS, 90 (1961), 63; 18 (1959),.946--47. Immediate third te~rn of local superior (c. 505). In granting a dispensation to per-mit an immediate third three-year term in th~ same house to a local superior, the Holy See added the condition, "provided there had been no reasonable complaints against her." REVIEW FOR RELIGIOUS, 10 (1951), 197-98; 19 (1960), 301. First washing of purificators, palls, and corporals (c. 1306, § 2). At the request of the Minister General of the Order of Friars Minor, the Sacred Con-gregation of Rites renewed for five years on May 30, 1961 the faculty by which one brother or' sister sacristan in all houses of congregations of the Third Order of St. Francis may be designated to do the first washing of the purifica-tors, palls~ and corporals used inthe sacrifice of the Mass. Cf. Capobianco, Privilegia et Facultates Ordinis Fratrum Minorum, ed. 4, Romae: Antonianum, 1961, n. 353; RE-VIEW I~OR RELIGIOUS, 15 (1956), 101; 6 (1947), 374--75. Changes in constitutions. In two cases, changes requested in constitutions were approved on trial until the next general chapter. REVIEW FOR RXLIGIOUS, 19 (1960), 352- 63; 3 (1944), 68-69. 4- 4- 4- Practice ot the Holy See VOLUME 21~ 1962 419 RICHARD P. VAUGHAN, s.J. Obedience and Psychological Maturity ÷ ÷ ÷ Richard Vaughan, s.J. teaches at the University of San Francisco, San Fran-cisco 17, California. REVIEW FOR RELIGIOUS Obedience is a virtue through which an individual promptly and agreeably follows the commandments of his superior.1 It involves the sacrificing of one's own will so as to follow the will of the superior who stands in the place of God. Since it is the will of another that must be followed, obedience may mean that a religious must put aside what he actually thinks better so as to do the wish of his superior. Since obedience is a virtue, it calls for an habitual way of responding. A religious does not become ol~edient simply because he has a desire to be obedient. He must learn to be obedient. He must learn to see God acting through the commands of his superior. It is only after a considerable effort and practice that he becomes an obedient religious. Training in Obedience The initial phases of training in obedience usually take place in the novitiate where the young religious is taught to obey the least command, of his superior. During this phase of his life, he follows a strict routine aiad he is taught that he must seek permission to deviate from this routine in the smallest way. If he fails to do so, he is told that he is failing in obedience. In some orders or congregations, it not infrequently happens that the practice of obedience relieves the young religious of the personal responsibilities which he pre-viously faced before entering the religious life. He or she learns that the obedient religious is one who follows the command of the superior in his or her every action. This practice can eliminate all need of making decisions of any importance. Were the same seminarian or sister still living outside the religious life, he or she might well be facing the responsibilities of financing a college edu-cation or even of caring for a growing family. In the re- St. Thomas Aquinas, Summa Theologiae, 2-2, q.104, a.2. ligious life such responsibilities are removed. The re-ligious finds that all his needs are cared for. All that is asked of him is that he be prompt and generous in follow-ing commands. In many ways he is treated as a child and may find a certain contentment in such treatment. The question, therefore, present~ itself: "Is ~he praqtice of obedience at odds with full personality growth? Can a religious practice obedience and still become a mature individual?" Meaning of Obedience To answer this question one needs to consider what is the nature of true obedience and then reflect upon some of the developmental aspects of obedience. True obedi-ence calls for a human act; It is an act that springs from the will.2 It involves the exercise of freedom and judge-ment. It is not a mechanically performed act that flows from passive conformity or childish submission to au-thority. In other words, the supernatural obedience of a religious should differ radically from the mechanical habit of obedience practiced by a child towards his par-ents. The obedience of the religious is an act that calls for an active choice which is based upon faith and char-ity. It is an act which requires the individual to overcome his own will. In all its perfection, it is an act which re-qUires that the religious accept the judgement of tile su-perior as his own. True obedience, therefore, should de-mand the making of mature decisions. There are many possible reasons why a religious may obey his superior. Some of these reasons may spring from childhood or adolescent sources. Frequently the religious may be unconscious as to the precise reason .why he obeys. It is this unconscious aspect of obeying that often presents obstacles when a subject is given an order of obedience. The religious who has developed true obedience knows why he obeys and his reason is deeply rooted in faith. He accepts the demands of obedience because he loves God. He gives up his own wishes and desires, so as to lead a life more fully dedicated to God. In other words, he has developed for himself a supernatural way of life built on faith which he has made his own. He does not obey be-cause he is afraid of the consequence of disobedience. He does not obey because he cannot stand to live with the feelings of shame and guilt that follow his acts of dis-obedience. He does not obey because he desires the ap-proval and admiration of his superior. Rather he obeys because he is convinced that obedience is one of the vir-tues that he must practice if he is to follow the way of life that he has freely chosen for himself. To arrive at Ibid., a.3. ÷ ÷ ÷ Obedience and Maturity VOLUME 21, 1962 R. P. Vaughan, S.]. REVIEW FOR RELIGIOUS such a conviction calls for mature deliberation followed by a mature decision. Natural Foundation The young man or woman who enters the religious life has not come into this life completely devoid of the habit of obedience. Usually. he or she enters with the nat-ural foundation for future supernatural obedience al-ready well established. Natural obedience is a necessary part of human living. It is theproduct of Christian family life. Were there no such thing as obedience, chaos would reign in most homes and this chaos would continue on in every other form of social life. As long as men live to-gether in social groups a certain amount of obedience will always be demanded of them.s For the privilege of group living, the indi,~idual must sacrifice some of his freedom; but by the sacrifice of this freedom he gains new freedom. He is not less a man because he obeys but rather more of a man because by so doing he is living according to his God-given social nature. Since obedience is a necessary part of human living, it stands to reason that one must somehow develop the habit of obeying. It is not an inborn characteristic nor is it something that suddenly springs into being. Rather like many of the other developmental processes that mark the life of man, the practice of obedience too follows defi-nite stages of development until it reaches a state of full maturity. For example, the child develops the ability to sit before he develops the ability to walk;, and he develops the ability to walk before he develops the ability to roller skate. The infant has no experience with obedience. His first acquaintance with the demands of obedience usually are connected with fear and punishment. He either com-plies with the wishes of his mother or he is punished. He either submits to her demands or runs the risk of losing her love. As he grows older, he comes to imitate more and more the ways of his parents. He incorporates into his own personality many of their ideals, attitudes, opinions, and values. He now obeys because he wants to be like them. At this time there also comes into being the emotions of shame and guilt which are quickly attached to certain forms of behavior. These emotions play a major role in the obedience of a child. He obeys because a boy is sup-posed to obey his parents. When he fails to obey, he is plagued with feelings of guilt and shame. The uncom-fortableness of these feelings causes him to think twice before he gives way once again to disobedience. Thus through childhood and early adolescence the motivating force behind obedience can be reduced to the reactions of fear, shame, guilt, and admiration. St. Thomas Aquinas, Summa Contra Gentiles, 3, c. 117. Adolescent Rebellion With the advent of full adolescence, the average boy or girl begins to re-evaluate many of the idea/s, attitudes, and values that he or she has taken from his or her par-ents. Frequently the adolesce.nt,re, bels agai, nst, these,atti-tudes and values, not ~ecessarily becati~e he f~ils to see their intrinsic worth but simply because he realizes that they are not his own but his parents'. He realizes all too well that he must develop his own standards and values. He must form his own opinions. His attitudes must be his own and not those of his parents. Rebellion is a neces-sary part of growing up. It definitely influences the de-velopment of obedience but most outgrow .rebelliousness and progress to a mature practice of obedience. Then an individual obeys the laws of God and the State and the demands of thole placed over him because he sees that obedience in some form is a necessary part of the philos-ophy of life which he has worked out for himself. Defective Foundation The virtue, of supernatural obedience as .practiced in the religious life is built upon the foundation of.natural obedience that was established in childhood and adoles-cence. Where that foundation is weak or warped, the practice of religious obedience will be faulty. The re-ligious who has never advanced 'beyond the childish level of obeying because of fear will often find that this is the motivating force behind his obedience in the religious life. Likewise the religious whose chief reason for obeying has never gone beyond the level of guilt and shame over vio-lating a divine or human command will find himself obeying his superior for this same reason. Finally, the re-ligious' who has never fully passed through the stage of adolescent rebellion frequently finds himself at odds with his superior simply because of this rebellious spirit. Un-fortunately, there is a bit of the child left in all of us, which in regard to obedience means that to some extent motives peculiar to childhood and adolescence linger on. The extent of their influence often depends upon our ability to detect and counteract such motivation by the development of full maturity in our obedience. When a young man or woman enters the religious life, he or she has already achieved a certain level in the de-velopment of natural obedience. Success in the develop-ment of supernatural virtue will depend upon the nature of the natural obedience. If the natural foundation for supernatural obedience is faulty, then this handicap must be remedied before the novice can be expected to practice true supernatural obedience. Effective training in obedi-ence, therefore, may require such counseling and direction as would be necessary to allow the young religious to see Obedience and Maturity VOLUME 21, 1962 + + ÷ R. P. Yaughan, S.]. REVIEW FOR RELIGIOUS 424 why he obeys or why he fails to obey or why obedience presents such a problem to him. It is hoped that such counseling would result in insight into failures at specific levels of development followed by a change in attitude and motivation. For example, the seminarian who meets every command with a feeling of inner rebellion might be led to see that he is simply reacting to his superior in a way quite similar to the manner that he reacted to his father or mother when as an adolescent he was given a command: Once the natural foundation has been repaired, then the religious is in a position to develop supernatural obedi-ence. Supernatural Obedience Ultimately, however, whether the natural foundation for obedience must be repaired or whether that founda-tion is solid, training for supernatural obedience demands the building of a deep spiritual and ascetical life that is highly personalized. An essential part of this highly per-sonalized spiritual life would be an inner conviction that the most perfect way to love God is through the sacrifice demanded by obedience. If this personal conviction is at-tained, then acts of obedience will pose no problem but will be undertaken as a necessary part of the more perfect way of life which the religious has freely chosen to fol-low. Thus there would seem to be no value in practicing the young religious in useless acts of obedience, since obedience flows from a conviction and not from frequently repeated acts. 0bedience.is simply the natural outcome of a deeply spiritual life founded on faith and charity. The religious who understands the meaning and purpose of obedience and at the same time has a firm desire to live his life totally for God cannot help but practice the virtue of supernatural obedience when faced with a command from his superior. His total dedication to God leaves him no other choice but to follow God's will as manifest through the voice of his superior rather than his own will. To make a true act of obedience, therefore, demands a certain level of maturity. It demands that one has put aside at least to a significant degree any childish or adoles-cent qualities and' that he has assumed the responsibility of making a total dedication of himself to God. Generally speaking, only the mature person is capable of such a dedi-cation. True supernatural obedience is, therefore, a virtue possessed only by mature religious. Immaturity in Religious The mode of training given some young religious, how-ever, would actually seem to militate against the achieving o~ supernatural obedience. Under the guise of obedience; some groups of religious demand of their novices and newly professed religious a type of submission that simu-lates the obedience expected of a.child. It should not be surprising then to see in these religious a regression to childish forms of behavior. All one has to do is witness the immature actions of some novices and young religious to become aware that a return to earlier levels of behavior must be taking place. Often their way of acting is totally inappropriate to their age level. If it were seen in a college student or even more so in a young married man or woman, it would meet with amazement and embarrassment. Such behavior is often passed over with the justification that the seminarian or sister is just a novice or junior professed (as if these stages of the religious life entitle a person to regress to childish modes of acting). Noticeably absent in many novitiates and houses of stud-ies are opportunities to make important decisions for one's self. All that is required is fidelity to a routine way of life or to a course of studies, such as would be expected of the average ten year old. Frequently this absence of oppor-tunities to make decisions continues on long after the re-ligious has left the formative period. If the young religious is a teacher, the superior makes all decisions in regard to every phase of school activity. All initiative must come from the superior, and not from the subject. Thus One should not. be surprised that many religious do manifest certain signs of immaturity. They have been "treated as children and respond accordingly. Responsibility and Initiative The practice of obedience does not demand that the religious abandon all responsibilities, refrain from making decisions, and take up a childish existence. Within the framework of obedience, there is ample room for personal responsibility, initiative, and creativity. Whether these factors do exist in a group practicing the vow of obedience will depend upon the concept of obedience held by both the superior and the subject. If the superior envisions obedience as a process whereby his subjects become mere mechanical extensions of his own ego, then the practice of obedience will probably stifle psychological growth as expressed through initiative and creativity. In this situa-tion all initiative must come from the superior. No deci-sion is made by the subject without the explicit approba-tion of the superior. However, it would seem safe to say that such a limited view of obedience is far from the true view. A religious can practice the virtue of obedience without being under the explicit aegis of obedience in his every act. Thus he may be assigned a project and given full responsibility for making all decisions in regard to this project and still be operating under the vow of obedi- 4- 4. + Obedience and Maturity VOLUME 21, 1962 425 ÷ ÷ ÷ R. P. Vaughan, S.]. REVIEW FOR RELIGIOUS 426 ence. It might be said that young religious should be given such responsibilities if for no other reason than to hasten the process of psychological maturity. For example, a novice should be given the full responsibility of teaching catechism to a group of public school children. He should be impressed with the idea that it is his responsibility to plan what is to be taught and how it is to be taught--pre-supposing some kind of general syllabus. He should be made aware of the fact that the success or failure .of the undertaking rests upon his shoulders and not upon those of the master of novices. Furthermore, the initial concep-tion and impetus for a project need not necessarily come from a superior if it is to be a work of obedience. It is the superior's approval that places the work under the banner of obedience. Thus if the novice who is teaching catechism develops some new ideas in regard to audio-visual aids, these ideas should not be stifled but encour-aged. The wise superior is one who realizes his own limita-tions and at the same time the potentialities ol~ his subjects and, as a result, looks for that initiative and creativity in his subjects which he may find wanting in himself. Personality, Weakness, and Obedience On the other side of the coin is the subject's attitude to-wards obedience. Due to a certain weakness of personality, some religious make use of a false notion of obedience as a means of solving their inner problems. Pseudo-obedience relieves the religious of overwhelming responsibilities and allows others to make decisions which he himself may be actually unable to make. It allows him to lead a protected, passive existence, free from the demands of adulthood. It requires no initiative on his part. It asks only that he do what he is told. Such conformity can hardly be honored by the name df obedience. Actually there, is no sacrifice of one's own will to follow the will of the superior. There is simply a following of the will of the superior because the subject is too weak to do otherwise or because childish sub-mission offers him a protection against a threatening world. On the other hand, the subject who understands the meaning of true obedience sees that he can take the initiative in many situations and that he can make use of his God-given creative powers as long as he does so under the approbation of his superior. He is also one who is will-ing to sacrifice these powers when the approbation of a su-perior is not forthcoming. Thus whether initiative and creativity will be limited in a life that professes the vow of obedience will depend upon the meaning that both the superior and the subject give to obedience. In conclusion, it can be said that the practice of obedi-ence and maturity are far from incompatible. If the obedi-ence is not mere submission but rather the true virtue of supernatural obedience, then it should further psychologi-cal maturity since only the mature religious is capable of a total dedication to God demanded by the virtue of obe~li-ence. Moreover, it can be said that true obedience offers the subject ample opportunity to assume such responsibil-ities as foster maturity. 4. ,4. 4- Obedience and Maturity VOLUME 21, 1962 427 ANDRE AUW, C.P. Contentment: Child of Poverty ÷ ÷ ÷ Andre Auw, C.P. is stationed at the Passionist Semi-nary, 1924 Newburg Road, Louisville 5, Kentucky. REVIEWFOR RELIGIOUS 428 Nothing is more characteristic of our modern jet age than the desire for change. Every day we Ere faced with constantly changing challenges to buy and try new magic-ingredient tooth pastes and detergents, to exchange old-model cars and freezers for better, newer ones. Dom Hu-bert Van Zeller, O.S.B., has summed up this spirit very neatly: "A man today will think little of changing his job, his house, his son's school, his religion, his political alle-giance, his car and his wife--perhaps all in the one year.''x This restless spirit is a sign and symbol of man's discon-tent. Men are discontented today, and they are discon-tented because they have a feverish thirst for things. They want things they would be better off without; they want things they cannot even use; they want things they simply cannot have. Men want things for many reasons: often be-cause having things is a symbol of security or a mark of distinction. But whatever the reason, men keep reaching out for new things to possess as if their very survival de-pended upon it. The sad fact is that the acquisition of all these things only adds to man's discontent. It is like a man who seeks relief from pain by taking morphine; the ensuing pain of addiction is worse than that of the original malady. Mother Janet stuart has supplied us with a better pre-scription for the illness of discontent. Faced with these same symptoms she once said: "We must either possess more or desire less." Implicit in Mother Stuart's statement is a rejection of the "possess-more" theory. Experience soon proves to us that the mere addition of things no more solves the problem of the discontented man than does the addition of drinks solve the problem of the alcoholic. The remedy is reduced to one choice: we must desire less if we 1 Dom Hubert Van Zeller, O.S.B., Approach to Calvary (New York: Sheed and Ward, 1961), p. 92. would find contentment. And the way to desire less is to develop the spirit of poverty. Often the very mention of the word poverty causes the formation of a series of unattractiveimages in our minds. The word seems to have the touch of winteT about it, sug-gesting something cold and sterile. But such is not the case. Poverty is a warm, lovely, life-giving thing. St. Francis of Assisi thought of poverty as a beautiful woman: Lady Poverty. St. Ignatius told his followers that they must think of poverty as a mother. The analogy of a woman or mother is especially apt since both are considered as sources of life and beauty. Woman's role is essentially life-giving and love-giving. And so it is with poverty. Poverty prepares us to receive the fullness of the Christ-life, and it continues to nourish that life. It prepares us to receive the everlasting love of the Spirit, and it keeps that love vibrant and strong. Rightly then is contentment called the child of poverty, for it is the first-born of a spirit which is essen-tially life-giving and love-giving. It is the fruit of the Spirit of love. In addition to this, poverty is the great liberator of man. Fallen nature has ringed us round with a steel circle of egocentrism. Poverty breaks through this closed circle and opens'up our souls to the wider worId of which Christ is the center. It gives us the thrilling freedom of the children of God, enabling us to soar instead of having to trudge along, burdened by the leaden weight of useless things. Most of the ugly effects of original sin can be, in some measure, neutralized by the spirit of poverty: self-interest, self-will, and especially self-pity. This latter effect, which is an unreasonable absorption in our current handicaps or misfortunes, can be one of our chief sources of discontent. Yet how wonderfully does a genuine spirit of poverty nul-lify our tendency towards self-pity. Helen Keller furnishes us with an excellent example of such a spirit. From child-hood she has borne the burden of blindness, deafness, and the inability to speak. Few have had better reason to in-dulge in self-pity than Helen Keller, yet never has she done so. Listen to her own life-summary: "It has been a happy life. My limitations never make me sad. Perhaps there is just a touch of yearning at times. But it is vague, like a breeze among flowers. Then the wind passes, and the flowers are content." It was the spirit of poverty which en-abled Helen Keller to appreciate herself as God had fashioned her. Poverty led her to contentment. As we read through the Gospels we cannot fail to notice the insistence of Our Lord upon the necessity for poyerty. Christ promised the "kingdom" to the poor: "Blessed are the poor in spirit, for theirs is the kingdom Of heaven" (Mt 5:3). By "poor in spirit" Christ meant the "little ones," the anawim of the Old Testament. These are the helpless, ÷ ÷ ÷ Contentment VOLUME 21, 1962 429 ÷ Andre Auw, C.P. REVIEW FOR RELIGIOUS 430 childlike souls who accept all things from God's hands, who depend upon Him as a child depends upon a father, who willingly suffer persecution because they know that no matter what happens to them, their heavenly Father will care for them. The spirit of poverty produces in us this same childlike attitude towards ourselves and things and God. One of the ways in which it does this is by painting for us a picture of gratitude. We suddenly see how much we really have, and, as a result, the needs and desires of the moment as-sume a less important value in our eyes. The following story is told of Brother Andrd, C.S.C., the famed apostle of St. Joseph at the shrine in Montreal. One day a man came to him complaining of his numerous misfortunes, and the saintly .brother said to him: "Tell me, would you take a hundred thousand dollars for one of your eyes?" The man answered, "Why, of course notl . Or for.one of your feet or hands or arms? . No!" replied the man. "Well then,'.' said Brother Andre, "count them up: With your eyes and hands and feet and arms and legs, you're worth over a million dollars!" In his simple, homely way, Brother Andr~ conveyed a telling truth: we all are far richer than we realize. Such counting of blessings, this development of a deep sense of gratitude is one of the chief ways in which poverty prepares us for the gift of contentment. It is far easier, once we see how much we have, to control our desires for the things we have not. Slowly thi~ initial realization ex-tends to the conviction that w~ really need very little. And it is then that we will have been made rich by our spirit of poverty. The great reformer of La Trappe, De Ranch, saw the beauty of this paradox and thus wrote: "It is not the man who has much who is rich, but the man who wants nothing." Another way in which the spirit of poverty produces in us a childlike attitude towards things is by filling us with a genuine sense of compunction. Much of our greedy grasping for things derives from an inherited tendency to be what we are not. Like our first parents, we see an. at-tractive object and then begin to act as if we have a right to it. We, also, listen, to the serpent and try to "be like gods," asserting our self-interest and our self-will in oppo-sition to the divine interest and will. Compunction strikes at the roots of this tendency. An analogy is seen in the case of a man who in a moment of weakness has been unfaithful to his marital promises. Al-though the man may be forgiven by his wife and reunited to her love, still he always carries in his heart a remem-brance of his sin. This remembrance is a good thing, for it serves to prevent the man from reaching out again to-wards illicit loves. Now in a similar way, compunction helps us to control our desires by recalling our past infidelity to God's love. Compunction shows us two things clearly: the self-deceit of egocentric desires, on the one hand, and the miracle of God's forgiving love, on the other. Between these two poles of awareness we can live content, no longer ~rusting in selfish d~sires but rather relying totally upon God's will in our regard. Compuction, then, helps us to forget the things we should not remember, and to remember the things we must never forget. We are enabled to forget our unreason-able preoccupation with self. At the same time we can never forget that .we are sinners deserving nothing, lovers who have been unfaithful, and yet, despite all this, we are chosen souls who have been called to become saints, des-tined to share God's love for all eternity. Gratitude and compunction thus constitute two princi-pal ways in which the spirit of poverty will prepare our souls for the gift of contentment. Gratitude says to us: "You have so much." Compunction adds: "You have so much which you do not deserve." Both help.us to see our-selves and things and God with the clear vision of children: humbly, trustingly dependent upon God for all things. The true purpose of the spirit of poverty is the attain-ment of freedom from the captivity of self in order to be united to God. Poverty has the power to swing us from the orbit of egocentrism into the orbit of Christocentrism if we permit it to neutralize, one by one, our self-centered desires and attachments. An important consideration to recall at this point is the fact that our desires and attachments always wear most at-tractive apparel. Yet it is also true that, like Dante's hypo-crites, the beautiful cloaks are inreality leaden weights and the splendor of their appearance in no way lessens the ugliness of that which they try to hide. Desires can come to us under the cover of charity for our neighbor or zeal for souls. And all the while 'such desires may be purely self-centered. One such desire frequently comes to religious who have lived in their community for upwards of five years. The novelty has vanished, and in its place come new yearnings. Suddenly the religious feels that a different religious so-ciety might be the solution. A teaching sister feels that her talents belong in a missionary group; a Jesuit is attracted to the life of the Trappists. Yet almost always the counsel of a prudent spiritual director is: "Stay where you are." Since the desire appears under the guise of greater good for the Mystical Body of Christ, the ensuing trial can be very difficult for the particular religious. It is at such.a time that one discovers the meaning of a spirit of poverty. Thomas Merton went through this or- Contentment VOLUME 21, 1962 + ÷ ÷ Andre Auw, C.P. REVIEW FOR RELIGIOUS 432 deal. He longed to share the solitude of the Carthusians. He thought that such a lifd would better serve the inter-ests of Christ and the Church. He was wrong. Heeding the wise counsel of his spiritual fathers, he remained with the Trappists to become a source of countless other contem-plative vocatons. It is, then, a man with personal expe-rience who later wote these lines: "Do not flee to solitude from the community. Find God in the community and he will lead you to solitude." Thomas Merton met the test of poverty; he relinquished his egocentric desire in a true spirit of poverty. Thus, for him, poverty led to content-ment. The lives of the saints are filled with similar trials. Be-fore they received the gift of contentment, they had to sac-rifice some dear desire or attachment.-For some it was a thing, for others a place, for still others a friendship. But like a cautery, the spirit of poverty had to burn away the cancerous growth of egocentrism. In the book, St. Madeleine Sophie Barat, Mother Ma-guire, R.S.C.J., describes an incident in the lives of Sophie Barat and Philippine Duchesne. Their early years to-gether were marked by a wonderful understanding and intimacy; yet this had to be sacrificed. The author says in reflecting their attitude: "[It was] a brief honeymoon of religious life to which they looked back nostalgically all' their .lives without ever doubting it was better to give it up." Both saints met the test of poverty; and thus, for them,, poverty led to contentment. Not that poverty does its work without pain. We all re-call that Francis of Assisi was the great exemplar of pov-erty, but what we may forget is the price he had to pay to win the hand of Lady Poverty. Francis Bernardone was a. man with warm Italian blood in his veins and had a poet's appreciation for beautiful things in his heart. He liked good food and the taste of fine wine. He enjoyed the ad-miration of his stalwart friends and the adulation of his fair admirers. But one day Infinite Love and Perfect Beauty spoke to Francis in his poet's heart and said: "Sell all, and come follow Me." It took years of struggle with himself, but Francis won the battle. One by one he cast aside his attachments as he had earlier cast aside his cloth-ing at the feet of his bishop and thus, "naked followed the naked Christ." Then it was that he was able to become the Poverello, singing to the birds and blue skies his constant refrain: "My God and my alll" For Francis, poverty led to contentment. And in southern France a young girl who became a woman without ever losing her childlike spirit of poverty was asked one day about a strange paradox in her life. Bernadette Soubirous had seen and talked with the Mother of God. She had been honored as had few mortalg. before her. And yet all the honors disappeared when she entered the convent. There she worked about the kitchen, accepting humiliation as a part of her daily fare. A fellow religious thought it odd that our Lady should give her such recognition and then ignore her, and she asked Ber-nadette why this should be so. Bernadette replied by way of a question, "What do you do when you have finished using a broom? . Why, I put it in the corner," answered the sister. And Bernadette said, "Well, that's just what our Lady has done with me. And. I'm happy in my corner." For Bernadette Soubirous it was equally true: poverty led to contentment. So it is that the spirit of poverty leads us from self to Christ. By its power we are enabled to pull away from the overly strong attraction of self-centered desires and are permitted to be drawn into the dynamic, life-giving love of Christ. As we empty our souls of self, Christ fills them. As we lose a worldly love, we gain a divine one. The spirit of poverty gives us the ability° to accept our-selves as we are, for by means of gratitude wesee how much we really have; and .by means of compunction we see how little we really deserve. Poverty helps us to forget the un-important facts of our lives and to remember the things that matter. Poverty lets us feel. the gentle hand of our Father, soothing the ache of our troubled minds, quieting the cry of our restless hearts, and calming the urgency of our impelling desires. It give~ us childlike trust for the needs of tomorrow and childlike joy for the deeds of to-day. Of all the saints, none has better expressed the life-giving effects of the spirit of.poverty than St. Paul. He .has given us a magnificent example of a man made rich through poverty, of a man living the fullness of the Christ-life. By his own testimony, St. Paul underwent a long cata-logue of apostolic .sufferings: hunger, nakedness, want, imprisonment, scourgings, persecution, lies, misunder-standings, disappointments. And yet with all these suffer-ings Paul was able to say: "Not that I have anything to complain of, for I have learned the secret, in any and all conditions, of being well-fed, and of going hungry, of hav-ing plenty and of going without. I can do anything through Him who gives me strength" (Phil 4:11-14). The example is a shining one for us. The language is clear. It is the statement of a sinner who became a saint, speaking to us in the beautiful vocabulary of Christian contentment. Contentment VOLUME 21~ 1962 GEORGE E. GANSS, S.J. Prudence and Vocations ÷ Rev. George E. Ganss, S.J., .St. Mary's College, St. Marys, Kansas, is the director of the Institute of Jesuit Sources. REVIEW FOR RELIGIOUS This article will deal with the order of practice; that is, its purpose will be to suggest some practical applications of prudence to the technique of counseling young men and women about vocations. For this purpose we do not need any detailed discussion of the metaphysical intrica-cies connected with the topic of prudence. But a brief re-view of the highlights, in one paragraph, will help us to get our bearings. The Concept o[ Prudence Prudence is correct knowledge about things to be done, recta ratio agibilium. St. Thomas accepted this definition from Aristotle and sagely pointed out that prudence is the application by the practical intellect of wisdom to human affairs (Summa Theologiae, 2-2, q. 47, a. 2). This is our basic concept. It is accurate but abstract. Hence we can profitably add some other observations which give it human warmth. Etymologically, prudentia is derived by contraction from pro-videns, looking ahead, St. Augustine says (Quaest. Lib., q. 83, a. 61), "Prudence is the knowledge of things to be sought and things to be avoided." St. Isidore of Seville is a little quaint but charming and not far wrong when he writes (Etymologiae, X, PL 82, 202), "A prudent man--one who, so to speak, looks far ahead; for his sight is keen, and he foresees the probable outcome of uncertainties." Prudence directs the other moral virtues so that fortitude may not degenerate into foolhardiness, or temperance into fanaticism, or justice into unreasonable rigorism. Prudence, too, leads a man to take counsel about the best means to be used to attain some end, to judge soundly about their fit-ness, and to direct their being carried into practice (Summa Theologiae 2-2, q. 47, a. 8; q. 51, a. 1, ad Basically, prudence is a natural~ virtue which is acquired ',, by experience and exercise. But a man in the state of grace receives also the infused virtue of prudence which supernaturalizes both the habit and the act of the natural virtue and makes them fruitful toward the supernatural destiny, the beatific vision (Summa Theolog!ae 2-2, q. 47, a. 14, ad 1). ~ Applications We now proceed to apply this theory in the practical order. The "thing to be done," about which we are seeking at least some "correct knowledge," is the tech-nique of counseling young men and women who may perhaps accept God's invitation .to dedicate their lives to Him in priestly or religious life. I think that our first step had better be to oil the gears of our own sense of humor, Some wag wrote this definition: "A crazy man is one who holds an opinion different from mine." This wag fared happily until his friend the crazy man applied the definition back to the wag who wrote it. After that, nobody could tell which one really was the crazy man, or which was crazier than the other. Now, I shall suggest some techniques of vocational counseling which I hope are prudent. But if the tech-niques of others are different from mine, and if I there-fore brand their techniques as imprudent, then I am crazier than my crazy wag just described above. There are many apt procedures or means to stimulate or guide young men and women to desire to consecrate them-selves to God. Each counselor must seek the methods which work best with his personality and his set of local circumstances. In each case the personalities of the direc-tor and of the advisee are important and highly individu-alistic factors. What works well with one counselor or advi~ee sometimes will not work at all with others. So, for each of us the exercise of prudence is our.continual search for correct knowledge and its application to our task in hand. In this, observation of the techniques of others is sometimes helpful because it brings new ideas which we can apply. It has been my good fortune during the past twenty years to counsel many boys and girls who have entered all the states of life. Most of these youths were in college, but many were in high school, and some in the grades. As a result of this experience, I shall suggest some procedures which God has on His occasions blessed with success. But I state them precisely and merely as suggestions which each one can modify, accept, or reject according to his own personality and situation. 4- 4- Pl/orucadteionnc$e and VOLUME 21, 1962 ÷ ÷ ÷ G. E. Ganss, $.1. REVIEW FOR RELIGIOUS 436 The Function of the V.ocation Counselor One point in which a zealous counselor of potential priests or religious can exercise prudence consists in his being aware of.his proper function. It is not to cajole or to "pressure" youths into "trying out" a seminary or novitiate; that would be the practice of "roping in" which they generally resent. Rather, the advisor's func-tion is to cooperate with God's grace in stimulating the boy or girl in such a way that he or she conceives on his own the desire to dedicate himself to God in priestly or religious life. As means to attain this effect, he can be an example of one who is happy in his dedicated life, and he can say and do things which bring 'the young people to see for themselves both the values and the joys of con-secrated life. The counselor's function can be called one of procreating grace. He stimulates the thoughts and de-sires which God supernaturalizes and through which, as actual graces, He gives the increase. A Sample Procedure How can he do all this prudently? To remain concrete and practical, I shall suggest, or rather exemplify, one procedure which has often turned out to be effective both with individual advisees and with groups (either in re-treats or in the classroom). 1. Put the advisee or group at ease by explaining your policy and procedure, somewhat as follows. "God has given to each young man or woman the right to choose his or her own state of life, and no one else--parent, priest, sister, or friend--ought to force or "pressure" one into any state. A counselor's function is to give the young person information by which he can make his choice mole in-telligently, or to explain the selections open to him, or to point out possible errors in his thinking, or, above all, to give him a chance to think out loud without feeling that he is as yet committing himself. But the making of the decision belongs to the youth himself; and that will be my policy in dealing with you." 2. Point out that the basic consideration, the hub around which everything else turns, is a clear and opera-tive concept of the chief purpose of life. For example, the counselor can present this statement and bring it to life: "God made me to give me an. opportunity to increase my sanctifying grace here below by performing meritori-ous deeds and by receiving the sacraments, and by means of this to merit a proportionately greater capacity here-after to know God directly, to love Him, to praise Him, and to be happy by the act of praising Him. The effor~ to do this here below is the pursuit of Christian perfectionl or spiritual development." 3. Explain that, to speak practically, there are four chief states of permanent situations in life in which one can work out his Christian perfection: those of marriage; single persons in the world; priesthood; and religious life as a nun, brother, or priest. God .invites each you.ng per-son into one of thosefor Which heis ~uited, but He leaves it up to the youth to accept or rejec~ this invitation. Hence the boy or girl should think the matter out, bring it to a head, and make his own decision. After he has made his choice and brought it to its irrevocable stage, God wants him or her to develop himself according to God's directives for the state he has entered, and to for-get about what might have happened if he had chosen some other state. In practice I have found it psychologically best with groups to explain marriage first--at considerable length and as an attractive state in which husband and wife should help each other to work out their Christian p~r-fection, Most of those present will marry, and all are spontaneously interested in this vocation. A careful and' inspiring presentation of Christ's plan for His Mysti-cal Body in miniature disarms the hearers of any fear of being "roped in" to one of the consecrated states. Then they are interested and happy to listen to an explanation of the other vocations to which God invites some. 4. Present a sound norm of choosing. The problem is not which state I like best, or even which is the best, for example, marriage or a consecrated state, Rather it is, which is the best for me with my personality and char-acteristics. To put it concretely, the most prudent pro-cedure for the youth is to conjecture, as prudently as he can: "In which of these states am I, with my personality, my temperament, and my personal abilities, likely to in-crease my sanctifying grace the most?" Variant wordings of this norm can make it clearer and more attractive, for example: ,In which state am I likely to bring greater glory to God?" or "to serve God and my fellow men the best?" 5. Give a theological explanation of what a vocation is, pointing the explanation to the particular.state of life in which the advisee is showing interest, for example, the sisterhood. This can be done in words somewhat like these. "Every vocation, to any sta~e of life, entails three elements: (a) God's invitation, (b) a decision of the in-dividual to accept it or not, and (c) a decision of the Church to admit him to the state in question. "For example, in its completed stage a vocation to the sisterhood comes into existence through these steps. First, through the thoughts or impulses and desires which are actual graces, God invites the qualified girl to offer her-self to serve Him and His Church in religious life. ÷ ÷ ÷ Prudence and Vocations VOLUME 21, 1962 (;;. £. (;(=nss, $.]. REVIEW FOR RELIGIOUS ~t38 "Second, she enters upon her period of deliberation. Helped perhaps by some reading, and surely by prayer, and perhaps by a counselor who will be guide, philos-opher, and friend but not a pressing salesman, she thinks out the details of her physical, intellectual, moral, and temperamental suitability for the life and work of the order she is thinking of entering. She weighs the pros and cons--and generally it is wise to write them in op-posite columns of a paper. Thus she formulates them more clearly, captures them for possible future use in moments of wavering or temptation, and gets the chance to evaluate their cumulative worth. "ALmong the reasons for, she sees the nobility of dedi-cating her life to God, and the spiritual values this of-fers: opportunities for growth in sanctifying grace~ Among the reasons against are the many values she must sacrifice to get those spiritual values: money of her own, marriage, being master of her own decisions, and the like. These latter values, being largely material and tangible, are often more attractive to human nature than the spiritual values which are more abstract. But through her prayerful thought, God gives her the light to see that the spiritual values are in reality the greater ones. Hence, for a good motive (one predominantly spiritual though it may be supplemented by natural motives), she decides to apply for admission. After proper investigation of her character and qualifications, the Church, acting through the re-ligious superior whom she has delegated, accepts her for the order. She now has a religious vocation in its prelim-inary stage, the stage for testing. "She enters the postulancy and then the novitiate, where she tests the life and the life tests her. As she goes along she discovers that her n~otives for leading the life grow stronger. Also, she gives reasonable satisfaction to those in charge of her. Toward the end of the novitiate she decides to pronounce her vows for the length of time the Church permits, and the Church decides, through the superior, to permit her to pronounce them. In similar fashion she goes through the periods of temporary pro-fession and then decides, again with the permission of the Church expressed through the superior, to consecrate her-self to Christ the King forever by perpetual vows. Now her vocation has reached its complete stage. This can be described as a set of circumstances in which she has a well founded hope that she will receive from God the helps she needs to live happily and well as a religious." 6. Gently tell the advisee to think this matter out pray-erfully and come to her decision. Give her a pamphlet or something else to read--preferably something not too long. The present writer has written his own pamphlet for this purpose which embodies the approach described above: On Thinking Out Vocations--to the Four Stages o[ Life (Queen's Work, St. Louis 18, Mo.). Reading this enables the advisee to review and even expand all that she has been told. Also, welcome her to come back for as many informal discussions as she wants. In what way is the procedure .outlined above an appli-cation of our principle of prudence? I think that it is such an application for two main reasons. First, it helps the advisee to set up his problem, and it shows him by ex-ample how to think it through. Second, right from the start it throws the burden of decision upon the individual. That is, it points up to the advisee the fact that sooner or later he or she must bring the matter to a head, think it out, and make a firm decision in the light of the clearly seen motives for and against. If she or he enters a con-secrated state, he will persevere only by the activi.ty of his own will aided by God's grace; and it is well that his first entrance also comes about through a similar act of his own will aided by God's grace. This advisee has not received any urging, but only the encouragement and self-confidence which are inherent in his discovering for him-self clear knowledge of the motives which bring him to enter religious life and to persevere. Raising Motives of Prospective Vocations We come now to a new application of prudence: some suggested means of gradually raising the motives of young men and women who begin to show an interest in the priesthood or religious life. The process which God seems to use most frequently in granting vocations---either vocations to the faith or vo-cations to priestly or religious life--is that of a gradual progression from natural to supernatural motives. This is why many priests have noticed that the majority of their conversions have sprung from courtships. In so many cases the motives which first evoke a non-Catholic's in-terest in the Church are natural ones: intimate friendship with a Catholic and the thought of marrying him or her. If the priest whom the non-Catholic approaches Simply tells his timid inquirer that his motive is unworthy, the inquirer departs and never returns. But if the priest is friendly and sympathetic and by his instructions gradu-ally raises the inquirer's motives, in many instances the latter eventually requests baptism for motives truly supernatural; and he would enter the Church with or without that marriage. God employs a similar technique in bestowing many, if not most, vocations to the priesthood or the religious life. The motives which first lead John or Mary to think of begoming a priest or nun are often on a purely natural plane. He has, perhaps, a religious teacher whom he ad- Prudence and Vocations VOLUME 21, 1962 439 ÷ ÷ ÷ G. E. Ganss, REVIEW FOR RELIGIOUS 440 mires. That teacher's classes are well prepared, and he is always cheerful, approachable, willing to listen and then to help. His happiness and peace of soul shine through his work. John. gets the dim thought: "He (or she) is happy doing something really worthwhile, I'd like to be like him." Someday, perhaps with nervous shyness or clumsy inepititude, he stutters out an inkling of his vaguely formulated thought to a priest or nun who is in a position to direct him. If this director is inclined.to judge--"This person gives evidence of not knowing what a vocation means; his motives are insufficient, unworthy, shallow; therefore he has no true vocation"--he will also be prone to send John or Mary away quickly with a brief or even a curt remark, And John or Mary will not return. But if the direetor is alert and willing to risk his time, often he can gradually, patiently, and tactfully give John or Mary more motives; he can raise their natural ones to a supernatural level, so that eventually they will con-secrate themselves to God from motives truly worthy. In The Faculty Adviser for March, 1944 (St. Louis: The Queen's Work), Father Lawrence Chiuminatto, S.J., wrote that, in replies to a questionnaire, several hundred nuns listed, in order of frequency, the following attrac-tions which brought them to religious life: (1) The happiness, peace, contentment, friendliness, and so forth, of the sisters with whom they came into contact. (2) The good report and example of their relatives in religion. (3) An inner attraction to the life . a sense of happiness they felt in being in the companionship of sisters. (4) An increasing realiza-tion of the emptiness of worldly pleasures, which feeling sur-prisingly often followed the most enjoyable of parties and the best kind of entertainment. (5) An increasing love for Christ and the desire to work for souls. (6) A growing desire for a life of prayer and service, free from the dangers of temptations: (7) Lack of interest in the opposite sex and in establishing a family. (8) The glow of happiness experienced when present at religious processions, or even visiting a convent. (9) Lack of satisfaction and the peace of mind they sought. (10) The desire to make amends for their past life. (11) (Last and least of all) Some book or pamphlet read, sermon heard, retreat or mission made. Notice how many of these motives are natural ones; this is especially true of those observed first and conse-quently often the ones first broached to a director. They are natural, yes, but capable of being supernaturalized. Many of them, for example, 1, 2, half of 3, 4, 7, and 10, may at first seem unworthy motives. What if some director had hastily concluded to the unsuitability of those who had them and discouraged these young women who now are able and happy religious? Clearly, therefore, in many cases the director's tasK and opportunity is to raise natural motives to the superi natural and to supply additional motives as well. As-suredly he will discourage unfit subjects. But he will not be too hasty to conclude that an inquirer is unfit. Rather, he will strive to make true of himself what Isaiah said of Christ: "A bruised reed he will not break~ and a smoking wick he will not quench" (M~°12-:20). '°' ~' ' ' But how shall he proceed with prudence in order to realize his opportunity? Here again each director will have to use his own ingenuity. But here are a few sug-gestions: he can always show himself kindly, approach-able, easily accessible, and interested in the. advisee. He can make him feel welcome, and let him talk, even ram-ble. Once the advisee has worked up the courage to talk freely about vocation, he will talk himself into better motives, especially if he is drawn out a bit by questions somewhat like this: "Yes, that is a good reason [or becom-ing a priest; but isn't there another reason in your.mind, something like this, that you want to serve Christ better?" Other means of raising or adding motives will occur to you as you observe the need of each case. And as you work keep up your courage despite some disappointments. Remember, Christ did not win all his cases; neither will you. So do what you can, and with peace of soul leave the rest to God. Plant and water and pray Him to grant the increase. Allowing Full Freedom in the Choice o[ a Group When John or Mary has decided to .dedicate himself to God, the Church allows him full freedom to apply to the order or diocese in which he thinks he will bring greater glory to God. It is prudent for the counselor to do the same. He may well give information about the type of work done, or the need of personnel, or the out-look on the spiritual life of any of them, including his own. But if he exerts pressure in favor of his own or any other group, he may well stir up resentment in the young person and spoil the vocation for his own and all other groups too. The choice belongs to the boy or girl. In the long run all the groups of priests, brothers, or nuns will come out best if they follow a policy such as this, for all of us will be working to help one another. Each of us should indeed ha,~,e love and loyalty towards his own group, but above all should be our love and loyalty to-ward the welfare of the universal Church. The Screening o[ Candidates It is obvious that applicants who are clearly unfitted or unlikely to become suitable religious should be discour-aged from entering the novitiate. But prudence requires that a vocational counselor should not be too quick to decide that one is clearly unfitted. Frequently through + 4. 4. Prudence and Vocations VOLUME 21, 1962 44.1 academic counseling, or tests of his general intelligence or ability to read English, some one temporary deficiency is discovered which can be remedied. It is wise, too, for the vocational counselor to remember that he is not yet recommending one for ordination or for perpetual pro-fession. Rather, he is recommending that the advisee be given a chance to enter the course in which he will de-velop himself and eventually prove himself fit for ordina-tion or perpetual profession. Virtually every vocational counselor who has had years of experience will discover something like this as he re-flects back over cases he has handled in the past. Many of those about whose fitness and disposition he felt most sure sooner or later dropped out. And many of his border-line cases about whom he felt most insecure happily de-veloped in an unexpected way, and they are today doing excellent work as happy priests or religious. He shudders at the thought of what would have happened if he had been too rigid. We are 'dealing with at least two unpre-dictable factors, human free will and God's grace. We cannot guess all our cases. St. Thomas has told us that in many things human prudence cannot be infallible. In other.words, all we can hope for is a good batting average. Let us accept our human limitations, and with them do the best that we can for God, and confidently leave the test to Him. That is the final application of prudence which I have to suggest. Also, if others think that a dif-ferent approach is better for them than that which I have described, it does not mean that either of us is necessarily wrong. G. E. Ganss, S.]. REVIEW FOR RELIGIOUS WILLIAM C. MclNNES, s.J. Adaptation of Retreats for College Students In one of the introductory observations to the Spiritual Exercises, Saint Ignatius very wisely comments that "the Spiritual Exercises must be adapted to the condition of the one who is engaged in them, that is, to his age, educa-tion, and talent." Hardly any retreat director, amateur or professional, would professedly disregard such an in-struction. Yet many directors are perhaps not fully aware of the practical consequences of such an instruction. Some, succumbing to the favorable comments of ~hree or four delighted sisters after a retreat, will° feel that they have, therefore, successfully reached ninety to one hun-dred retreatants. Others, suspecting that experience by itself brings empathy, feel assured that they can reach sisters and brothers, religious and lay people with little extra effort since "they are all essentially the same." But neither unrepresentative comments nor even ex-perienced intuitions can be a satisfactory basis for the large-scale conducting of retreats today. Adaptation re-quires a firmer foundation than pleasantly prejudiced opinions or intuitive knowledge. It demands a valid and representative insight into the mentality of the audience. Such an insight is, in fact, almost as important as a knowl-edge of the Exercises themselves. It is just as necessary to know whether a message is being received by a particular audience as it is to know what the message is. The retreat director must, then, be armed with some understanding of the audience he is attempting to reach as well' as of the instrument he is trying to use. Without the latter the director has nothing to say; without the former he is talking only to himself. This knowledge of the audience, which is the basis of successful adaptation, is of special importance in plan-ning retreats for college students. Usually these retreats to students are given to rather large groups, they last only three days, and they offer a condensed version of the + William C. Mc- Innes, S.J., is associ-ate dean at Boston College, Chestnut Hill 67, Massachu-setts. VOLUME 21~ 1962 443 ÷ ÷ ÷ W. C. Mclnne$, REVIEW FOR RELIGIOUS Ignatian Exercises. But even more than the changed. circumstances, the changed character of the audience postulates special adaptation. The modern student moves in a world that shapes much of his life and most of his views. It trims his ideals and sets a horizon to his vision. It colors his power to speak and his power to listen. It determines his power to pray and his ability to sit still. A sympathetic insight into this world along with a re-alization of the problems in communication that are raised are fundamental to the success of college retreats. The question is not: should we adapt retreats for college students or not? It is: how can we best adapt? To many outsiders a college campus is a remote, ivy. covered island in a hectic world, and a college student's life is permeated by that pastoral calm. Someone has calle~t college "a four year bracket before the beginning of real living." But the stereotype is inaccurate. Actually the four years of college are years of restless searching, new discoveries, and increasing pressures which leave a deep imprint on student lives and hence are certain to influ-ence receptivity to any message, spiritual or otherwise. A college career today is more institutionalized and pressurized than ever before. The college student begins his college career as a College Board score in the admis-sions office; he survives as a cumulative average in the registrar's file; and his whole academic record is sum-marized and punched out by an IBM printer. During his four years of school, he will be continually pressured to produce, to get good grades "if you want to get into graduate school," to rank in the top ten per cent of your class "if you want an interview for a good job at the placement office." Meanwhile all around him he dis-. covers heightened opportunities for sense pleasure and for taking a "break" when he thinks he needs it or when the pressure gets too great. And frequently he finds that he has the inflated wallet that makes these "breaks" fi-nancially possible. The external pressures from organization and pleasure are matched by an internal confusion which also jams any channel of communication to his soul. No respectable student today would be found dead wearing the label of "organization man." Yet college campuses are cluttered with the symbols of conformity--a conformity ruled by some anonymous Seventh Avenue clothing merchant or a "name" drama critic on a New York newspaper. A grow-ing sophistication makes most college students reject violently any argument from authority. Yet many of them will adhere dogmatically to a relativism that makes all intellectual pursuit an entertaining exercise without either agonizing pain or blinding ecstasy--and, worse~ without any deep commitment. In such an environment! it should not be surprising that the vision of truth is un-consciously tarnished by life's distractions and the dedi-cated pursuit of an abstract ideal is unwittingly slowed down by the practical concerns of life and the growing feeling that "it really isn't what you know but whom you know that counts." It is to this buffeted, pleasure-loving, uncommitted young generation that the retreat movement reaches out. And successfully too. The growing number of retreat houses, the steadily rising statistics of the number of re-treatants making closed retreats annually, the growing importance of the layman's retreat movement prove the fact. Why? Because retreat directors are speaking the message of Christ in language modern students can grasp. As long as there is contact, the message can get through. During the past two years, the author has directed a series of closed weekend retreats for Catholic college men. These retreats were held at a nearby seminary where the retreatants made the standard Ignatian Exercises and were also able to take some part in the community life of the seminary. In an effort to insure a continuing contact be-tween director and retreatants by determining the reac-tions of actual participants, a written questionnaire was devised and distributed at the close of.each retreat. The questionnaire sought to determine their impressions, fa-vorable and unfavorable, what they found most helpful about the retreat and what they found most difficult, what they would suggest to be changed. A~total of 203 detailed returns, representing about eighty per cent of the total number of retreatants, was received and form the basis of this study. Some may object that a sociological instrument of this type has no place in the giving of retreats. Such a device, however, is actually far more representative than the scat-tered oral comments of a few retreatants, and it is far more objective than the intuitive impressions of the director. Will it extract any worthwhile information? It .can, if properly constructed and explained so that bias and leading questions are eliminated. Compared to one hundred per cent accuracy, it is, of course, poor. But compared to a pure guess, it is certainly an improvement. And since one hundred per cent accuracy is impossible by any means and a pure guess is inadequate by any ob-jective standard, it does provide at least some exploratory information that can give important leads to an inquiring retreat director. The retreat groups which form the basis of this study ranged in size from seventeen to fifty-eight. The average number was thirty-five. Three of the groups were made up of undergraduate students majoring in business; two other groups were taking liberal arts. One group was 4. 4. 4- Retreats College Students VOLUME 21, 1962 445 + W. C. Mclnnes, S.I. REVIEW FOR RELIGIOUS 446 composed of sodalists, most of whom had made retreats before; two other groups were composed primarily of students making retreats for the first time. One group wax composed of a senior class taught by the director and so were all known to him beforehand; two other groups were from another Catholic college and had never met the director before. One group was an intercollegiate group of business majors from three colleges; another group was an alumni group~mostly married---of men. working in business. Hence this diversity of composition permits some comparisons between those with a profes-sional education and those with a general education; be-tween those with previous retreat experience and those with none; between undergraduates versus alumni, strangers versus friends of the ,director, those .familiar with retreats and those who had never made a retreat before. Some of the findings of this study are perhaps obvious. Others are revealing. Still others, while obvious in con-tent, are revealing in the extent and force with which they appear. Some of the general highlights of the study follow: 1. A voluntary closed retreat means many different things to each retreatant; but to all it is a very special event which greatly impresses the college student who makes it, especially if he is making a retreat for the first time

Issue 37.1 of the Review for Religious, 1978. ; pies of Discernment According Jesus of N~zareth Culti~atingthe Cegtering Pr yer REVIEW FOR RELIGIOUS is edited in collaboration with faculty members of the Department of Theology of St. Louis University. The editorial offices are located at 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. It is owned by the Missouri Province Educational Institute; St. Louis, Missouri. © 1978 by REVIEW FOR RELIGIOUS. Composed, printed and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $2.00. Subscription U.S.A. and Canada: $8.00 a year; $15.00 for two .years. Other countries: $9.00 a year, $17.00 for two years. For subscription orders or change of address, write REVIEW FOR RELIGIOUS; P.O. Box 6070; Duluth, Minnesota 55802. Daniel F. X. Meenan, S.J. Robert Williams, S.J. Dolores Greeley, R.S.M. Joseph F. Gallen, S.J. Jean Read Editor Associate Editor Associate Editor Questions and Answers Editor Assistant Editor January, 1978 Volume 37 .Number 1 Correspondence with the editor and the associate editors, manuscripts and books for review should be sent to REVIEW FOR RELIGIOUS; 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. Questions for answering should be sent to Joseph F. Gai/en, S.J.; Jesuit Community; St. Joseph's College; City Avenue at 54th Street; Philadelphia, Pennsylvania 19131. "Out of print" issues and articles not re-issued as reprints are available from University Microfilms International; 300 North Zeeb Road; Ann Arbor, Michigan 48106. Review for Religious Volume 37, 1978 Editorial Offices 539 North Grand Boulevard Saint Louis, Missouri 63103 Daniel F. X. Meenan, S.J. Robert Williams, S.J. Dolores Greeley, R.S.M. Joseph F. Gallen, S.J. Miss Jean Read Editor Associate Editor Associate Editor Questions and Answers Editor Assistant Editor Review ]or Religious is published in January, March, May, July, September, and November on the fifteenth of the month. It is indexed in the Catholic Periodical and Literature Index and in Book Review Index. A microfilm edi-tion of Review ]or Religious is available from University Microfilms Inter-national; Ann Arbor, Michigan 48106. Copyright (~) 1978 by Review ]or Religious. Principles for Discernment According to Jesus of Nazareth Br. Jonathan of God and Br. Carith of the Incarnation Brothers Jonathan and Carith reside in the Elias Desert House of the Zion Carmelite Com-munity; R.R. ~1; Garnet, KS 66032. Our age is one of sincere sign seekers unlike the Pharisees and Sadducees rebuffed by Jesus in Matthew 16:1-4. The Pharisees and Sadducees came along, and as a test asked him to show them some sign in the sky. He gave them this reply: "In the evening you say, red sky at night the day will be fight, but in the morning red sky and gloomy, the day will be stormy. If you know how to interpret the look of the sky, can you not read the signs of the times? An evil, faithless age is eager for a sign, but no sign will be given it except the sign of Jonah." With that [the evangelist editorializes rather graphically] he left them abruptly.~ We long, with a deep interior lohging, to know God and to live in his truth. We are the generation that has spawned the Jesus Movement. We have responded, more openly than any previous generation, to the teachings of the Religious East. Titles like Swami, Guru, and Yogi as well as Eastern spiritual practices like Mantra and chanting are becoming well-known in the West. Messianic personalities .have appeared on nearly everyone's spiritual horizon. These wise men from the East speak with persuasion and attract many faithful devotees. All claim to speak the truth and present themselves as ambassadors of God. Religious communities in this climate of sincere aThe New American Bible, (New York: Thomas Nelson, Inc., 1970), p. 1089. 3 4 / Review for Religioas, Volume 37, 1978/I spiritual search have many men and women who feel called to a deeper life of prayer. For superiors this current direction has become an administrative problem by having to replace "good workers'" in now-vacated positions. For the religious seeker it has become a time of painful self-examination. Whether we are attempting to discern the words and actions of a particular spiritual teacher or determine if we have in our religious community a prophet or pious pm'anoid, we will do well to look carefully at the principles for discernment given to us by Jesus himself. Jesus gave ten very clear principles for the discernment of a person's spiritual claims. The principles are found in John's Gospel, chapter 5, verses 27-44.~ The verses are easily divided into two categories: 1) Prin-ciples for judging the person discerning: the subjective element that does come to play in every discerning situation. 2) Principles for discetvdng the person in question: the object of discernment. Since discernment of a religious phenomenon is of ultimate and not relative importance, Jesus was not satisfied with presenting a few static principles applicable by the spiritual and technical man alike. Just as a judge may know the law but lack wisdoml a person seeking to discern a spiritual matter needs more than a set of criteria, even if the norms used are the legacy of a great saint. Jesus insists that the "discerner" begin by scrupulous self-examination. The first set of principles, five in number, are for the purpose of self-discernment. Once the judge can assure himself that he does have the "gift" of discernment, he may turn his attention to the religious question to be reviewed. In testing the spirit of the person being considered, the discerner may use Jesus' second set of criteria, also num-bering five. Principles for Self-reflection The Father who sent me has himself borne witness to me. You have been deaf to his voice, blind to the vision of him, and his word is not continually present in your hearts; that is why you will not trast one whom he has sent (Jn 5:37). FIRST PRINCIPLE Men can recognize that one is sent by God if they are attuned to God and. his voice and vision, and if they continually have his word in their hearts. Commentary A group of teenagers from a street gang are not asked to review a new ballet about to open at the civic auditorium. Promoters of rock music do not solicit opinions from senior citizens. ~The Holy Bible, Trans., Ronald Knox. (New York: Sheed and Ward, inc. 1956), pp. 91-92. New Testament section. Principles fi)r Discernment According to Jesus of Nazareth / 5 With no reflection on teenage gangs or the aged, the pollsters are honestly judging the inability of these groups to evaluate the situations validly. According to this principle of Jesus a person must know God in more than an intellectual manner. He must know God and not only know about God. To put it in thi~ eloquent phraseology of the Carmelite hermit, William McNamara, "He must know the God of theology, not just the theology of God." You pour over the scriptures, thinking to find eternal life in them (indeed it is of these I speak as bearing witness to me) but you will not come to me to find life (5:39). SECOND PRINCIPLE Men fail to trust one as coming from God when they interpret scripture in a static way. Or when they subject gcripture to their own mind's inter-pretation. Commentary This is the problem of fundamentalism. Fundamentalism had tripped up many in the time of Jesus: "'The pharisees and scribes approached Jesus with the question: why do your disciples act contrary to the tradition of our ancestors?" Fundamentalism is the problem that has subdivided Chris-tianity. It is a problem we in the Catholic-Christian tradition, flatter our-selves in having overcome. We have become erudite in scriptural exegesis and are long removed, from the narrowness of the Inquisition. But who among'us can say that we look at reality without our limited personal perspective? Who among us is so egoless as to welcome in an unbiased manner God's messengers? I do not mean that I look for honor from men, but that I can see you have no love of God in your, hearts (5:41). THIRD PRINCIPLE Men fail to trust one as coming from God when they have no genuine love of God in their hearts. Commentary Just as "loving" our offspring by insisting that they become doctors may be a subtle form of self-glorification, so a .person's sincere love for the organization or institution can be a real bloc to God's plan of salvation. If the "temples" of our work are to be destroyed by a genuine loving response to a messenger of God, then we must have faith that better structures will be raised up in "three days." The demons that darken our vision in this area are the ones that Jesus suggests can be expelled only by copious prayer and fasting. 6 / Review for Religious, Volume 37, 1978/1 I have come in my Father's name and you give me no welcome, although you will welcome some other if he comes in his own name (5:43). FOURTH PRINCIPLE We welcome men with credentials from other men and fail to recognize a man who comes from God. Commentary When Saint Peter of Alcantra went to the bishop of Avila to seek his approve! for Theresa of Jesus to open a convent with no "fiked income" he. was rebuked and turned away because he was speaking poor economics. Francis of Assisi needed an introductory letter from ,Bishop Guido to see the pope and the intercession of a cardinal to keep him from being dismissed summarily. We are all beginning to realize that an academic degree does not tell us the degree of real knowledge, wisdom, a person has. The amount of technical information to which an individual has been exposed is indicated by a degree. True knowledge cannot be earned or discerned by degrees. How should you learn to believe, you who are content to receive honors from one another, and are not ambitious for the honor which comes from him, who alone is God (5:44). FIFTH PRINCIPLE Men fail to recognize a man from God when they look for honor from men only instead of being anxious for God's honor alone. Commentary This needs little comment. We are all wounded deeply in this area. Human respect is a serious problem. We all relate with the sentiment of Cardinal Wolsey: "IfI had but served my God as faithfully as I have my king, I now would not be naked to my enemies." Principles to Discern the Man from God As the Father has within him the gift of life, so he has granted to the Son that he too should have with him the gift of life (5:26). FIRST PRINCIPLE The man of God gives life like God gives life. Commentary The holy men of the East state it in this way: A flower filled with honey need not wear a sign to attract bees. The type of life referred to here is the kind Principles for Discernment According to Jesus of Nazareth / 7 we have the privilege of witnessing in the life and work of Mother Theresa of Calcutta. We stand in awe of the miracle of her activity but we are believers like Thomas. We have seen so much evidence of God's work in her life. Blessed are they who first commissioned her to respond to her "call within a call" and go live as the poorest of the poor. Many of us might have looked upon her proposal as a bit too idealistic. I cannot do anything on my own authority. I decide as I am bidden to decide and my decision is never unjust because I am consulting the will of him who sent me not my own will (5:30). SECOND PRINCIPLE A man from God does nothing on his own authority, only on God's, thus he is never unjust. Commentary The men and women who refused to cooperate with the "justice" of the Third Reich because of higher laws are the kinds of individuals seen operating under this principle. Acts done as an obedience to God, by interior realization or e.xternai vision, may contradict man's law but not the Law of God. Although Theresa of Avila seemed disobedient to her local superiors the day she opened her first convent of the then incipient Carmelite Reform, she had acquired permission from the pope and local ordinary. Theresa, also, had the support of her ardent admirer, the General of the Order, Fr. Rossi.3 The father., has also granted him the power to execute judgment (5:27). THIRD PRINCIPLE A man from God judges wisely. C6mmentary Wisdom is a gift that transcends technical thinking. Solomon's wisdom befuddled the two women seeking the custody of the child but the intuitive conclusion to which Solomon came did lead to justice. The words of the wise will often confuse those of us lost in our heads. All of life is mystery yet we want to "understand it." The wise person does understand by transcendir~g his thinking, limited and ego-filled, and begins to see reality through the eyes of God. 3The history of the Carmelite Reform of St. Theresa is immensely complex. For further reading see: Journey to Carith, Peter-Thomas Rohrbach, O. C. D. (Garden City, New York: Dou-bleday and Company, Inc., 1966), Chapter V., and The Carmelites, Joachim Smet, O. Carm. (Darien, Illinois: Carmelite Spiritual Center, 1976), Vol. II., Chapter If. I~ / Review for Religious, Volume 37, 1978/1 lfl t'estify on my own behalf, that testimony of mine is worth nothing; there is another.who testifies to me, and I know well that the testi-mony he bears me is worthy of trust. You yourselves sent a message to John, and he testified to the truth (not that I depend on any human testimony; it is for your own welfare that I say this) (5:31). FOURTH PRINCIPLE A man from God gets testimony from holy men and from God, not from any human testimony. Commentary When it comes to discerning a spiritual person the otherwise hackneyed expression takes on a certain profundity, "it takes one to know one." The example of Peter of Alcantra's witness to the worthiness of Theresa of Avila as described under the commentary of section four of the first, set of principles is applic~.ble here. But the testimony ! have is greater than John's; the actions which my Father has enabled me to achieve, those very actions which I per-form bear me witness that it is the Father who has sent me (5:36). F~F'rn PRINCIPLE A man from God performs actions that are greater than a man can do on his own. Commentary Use Mother Theresa of Calcutta as a present day example of this principle in operation. The growth of her community is precisely the phenomenon that it is because it occurs in an age of vocational depression. Her efforts to sustain the efforts of thousands of Missionaries of Charity from alms alone, refusing any fixed 'income, is an economic miracle. Of simple peasant stock, Mother Theresa has been received as royalty by pontiff, prelates and presidents. Her resources she claims come to her on her knees. Rejecting the benefices of men who wish to tangle her work in red tape, Mother Theresa clings with childlike confidence to the only Benefactor she really trusts. The crowds were divided over the issue of Jesus. Some maintained "he is a good man" and others felt he was misleading the people: They were unable to comprehend how his knowledge surpassed his slight formal religious education. Some went so far as to voice the question: "When the Messiah does come, can he be expected to perform any greater signs than this man?" (Jn 7:31). We believe Jesus did come from God but many of his, and our, contemporarie's did or do not. It is grace that makes us free enough of our own perception of reality to believe that God, who is infinite, Principles for Discernment According to Jesus of Nazareth / 9 manifested himself in toto, in the finite son of Mary. Many of life's givens have been challenged, some taken away. Less of us are certain that those who cry, "the end is near" are mad. Living in a time of technological chaos and intense spiritual confusion, with salvation being offered us in monasteries and marketplace, how do we know who spi~aks with God's authentic voice? A sincere use of the principles given us by the Master will assure u~ of knowing whom he has chosen to represent him and to whom he has entrusted the words of etei'nal life. "Give beauty Retreat's End back., back to God" (G. M. Hopkins) I give you back this pure, full mountain morning, all leaping, blue as robins' eggsr here at Isaac Jogues where giving feeds, feeds the air. I give you back but keep the love, this gentlest affirmation of my need. Each moment as a specially-cared- for now, a nest of robins' eggs that could be eagles-- each one I give you back, but heart-wise I go down this mountain slowly, though light with love, renewed fidelities. I do not look back; the heart has eyes that memorize such mornings. Mary Enda Hughes, S.S.N.D. College of Saint Joseph the Provider Clement Road Rutland, Vermont 05701 Cultivating the Centering Prayer Thomas Keating, O.C.S.O. Abbot Keating's article is based on talks given at "Advanced Centering Prayer Workshops" given at his abbey, St. Joseph's, Spencer, MA 01562. A practical method of contemplative prayer based on the Cloud of Un-knowing, developed by Father William Meninger and called "Centering Prayer," has been made available by means of tapes, workshops sponsored by the Religious Life Committee of the Conference of Major Superiors of Men, and the increasing number of retreats in different parts of the country designed to communicate this method. An introduction to the Centering Prayer by Father Basil Pennington appeared in the REVIEW FOR RELIGIOUS in September, 1976. His book on the same subject, Daily We Touch Him, was published by Doubleday in March, 1977. In any form of prayer, listening, waiting, attending to God have an important place. This article deals with the kinds of thoughts that occur in the silence of listening and gives some indication of how to deal with them. How we cope with unwanted thoughts is of crucial importance since it affects the quality of prayer, its refreshment, and the presence or absence of tension. Considerations proposed in this article in reference to the prac-tice of Centering Prayer, therefore, may be applied, in a manner adapted to it, to one's own preferred form of prayer. Centering Prayer Centering Prayer is a renewal of the traditional prayer of the Church leading to contemplation. It is an attempt to present it in an up-to-date format and to put a certain order and method into it. This prayer is not meant to replace all other kinds of prayer. But it puts all the other kinds into 10 Cultivating the Centering Prayer / 11 a new perspective. It centers one's attention on God's presence within and moves on to discover his presence everywhere else. Thus it is not an end in itself, but a beginning. It is not to be done for the sake of an experience, but for the sake of its fruits in one's life. Here is a parable that points to what is happening in this prayer. There was a little fish who swam up to his mother one day'and said: "Mummy, what is this ocean I hear so much about?" She said to him, "You stupid little fis!! It's all around you and in you. Just swim up onto the be~ch and lie there for a while and you'll find out." Another time, there was a little bear who walked up to his mother one day and said: "Mummy, what is this air I hear so much about?" She said to him, "You stupid, little bear! It's all around you and in you. Just stick your head in a pail of water for a while, and you'll find out." Finally, there was a certfiin beginner in the spiritual life who was having a hard time. One day he went up to his spiritual director and said: "What is this God I hear so much about?" , The spiritual director should not, of course, say to him, "You stupid little novice! He's all around you and in you." But he is supposed to be able to tell him what to do to discover and experience this reality. Centering prayer is one way of doing this. By turning off the ordinary flow of thoughts, which reinforces one's habitual, way of looking at the world, one'.s world begins to change. It is like turning a radio from long wave to short wave. You may be used to a long wave set and the stations it picks up, but if you want to hear stations from far away, you have to turn to the other wave length.' In similar fashion, if you turn off your ordinary thought patterns, you enter into a new world of reality. To do this systematically, take up a position that will enable you to sit still Close your eyes. Half of the world disappears, because we think most of what we see. Then slow down the normal flow of thoughts by thinking just one thought. Choose a sacred word of one or two syllables with which you feel comfortable. It will be the sign of your intention to open yourself interiorly, to the mystery of God's enveloping presence. Keep thinking this sacred word. When you become aware that you are off on some other thought, gently return to this word. As you go to a deeper level of reality, you begin to pick up vibrations that were there all the time but not per-ceived. This broadened perspective gives you a chance to know both your-self and God in a new way. ' Method Our ordinary thoughts are like boats sitting on a river, so closely packed together that we cannot see the river that is holding them up. We are normally aware of one object after another passing across the inner screen 12 / Review for Religious, Volume 37, 1978/1 of consciousness: thoughts, m~mories, feelings, external objects.¯ By slow-ing down that flow for a little while, space begins to appear between the boats. Up comes the reality on which they are floating. The prayer of Centering is a method of directing our attention from the boats to the river on which they are resting, from the particular to the general, from the concrete to the formless. At first you are preoccupied by the boats that are going by. You become interested to see what is on them. You must train yourself to let them all go by. If you catch yourself becoming interested in them, return to the sacred ¯ word you have chosen, which expresses the movement of your whole being toward God who is present within y.ou. A familiar gesture of devotion consists in placing the palms of the hands together with fingers pointing upward. It is meant to express the movement of our body and soul toward God. All our faculties are gathered together and pointed toward God by this gesture. That is what the sacred word is trying to say. It is a pointer. The wofd itself can become vague or disappear. It can be only an impulse of the will. But it points one's whole being to God. Quieting the Mind Various kinds of thoughts may come down the stream of consciousness when one starts to quiet one's mind. The appropriate response is a little different for each. The most obvious are the superficial thoughts that the imagination grinds out because of its natural propensity for perpetual mo-tion. These should be treated like the weather which you just have to accept. The important thing is not to pay any attention to them. They are like the noise in the street which floats through the window of an apartment where two people are carrying on a conversation. Their attention is firmly directed to each other, but they cannot avoid hearing the noise. Sometimes they reach a point where they don't notice it at all. At other times the honking of horns may distract them momentarily. It would be useless to get in the elevator and g6 downstairs and tell the people on the street to shut up. You would have to discontinue the conversation, and you might not be able to take it up again where you left off. The only reasonable attitude is to put up with the noise and pay as little attention to it as possible. In this way you give as much of your undivided attention as circumstances allow to the person with whom you are conversing. The second kind of thought occurs when you get interested in something that is happening in the street. A brawl breaks out and attracts your curiosity. This i~ the kind of thought that calls for some reaction. Here is where returning gently to the sacred word is a means of getting back to the general loving attention you are offering to God. It is important not to be annoyed with yourself if you get involved with these interesting thoughts. That would be a great mistake, because any annoyance or any curiosity that you give in to is another thought, and that takes you farther away from the Cultivating the Centering Prayer interior silence which is the proximate goal of this prayer. Interior silence is always going to be relative. It is important not to reflect on what is happening while doing Centering Prayer. You can do that later. While in this prayer, dedicate the time to interior silence. Silence As we sink into deep peace and then silence, a third kind of thought may arise. Something in our nature--or maybe it is the devil--starts fishing. Brilliant intellectual or theological insights or what seem to be marvelous psychological breakthroughs, like tasty bait, are dangled in front of our minds and we think, "If only I can remember this fantastic insight!" But acquiescence to some beautiful or illuminating thought long enough to remember it afterwards will bring you out of the deep waters of silence. Any thought will bring you out. A very delicate but intimate kind of self-denial is necessary in this prayer. It is not just an experience of rest and refreshment--a sort of spiritual cocktail hour. It involves the denial of what we are most attached to, namely, our own thoughts and feelings---our very selves. This kind of asceticism goes to the very roots of our attachment to our superficial egocentric selves and teaches us to let go. It is the most thorough kind of self-denial, but also a delightful kind. Self-denial does not have to be afflictive to be effective. It is a question of choosing the best kind of self-denial and working at it. This is not the time to think about praying for yourself or somebody else. You can do that at another time. The basic principle for handling thoughts in this prayer is this: whatever thought, feeling or experience attracts your attention, always return to the sacred word. A thought can be anything you notice--inwardly or out-wardly. Even if you should have an overwhelming experience of God, this is not the time to think about it. As you quiet down and go deeper, you may come to a place that is outside time. Time is the measure of motion. With few or no successive thoughts, you may experience the time of prayer passing like the snap of your fingers. "It certainly did not seem like half an hour." As you settle down to deep peace and inner freedom from all thoughts, a great desire to reflect on what is happening may arise. You may think, "At last I am getting some place?' Or, "This feeling of peace is just great." Or, "If only I could make a mental note of how I got here so that I can get back to it whenever I want!" These are good examples of the fourth kind of thought. In deep tranquillity you are offered a choice between reflecting on what 14 / Review for Religious, Volume 37, 1978/1 is going on or letting go in faith. If you let go, you go to deeper silence. If you reflect, you come out and have to start over. There will be a lot of starting over. The presence of God is like the atmosphere we breathe. You can have all you want of it as long as you do not try to take possession of it and hang on to it. Nothing is more delightful than the divine presence. For that very reason we want to carve out a piece of it and hide it in the closet for safe-kee. ping. But that is like trying to grasp a handful of air. As soon as your fingers close over it, it is gone. The presence of God does not respond to greed. It has a different dynamism. It is totally available, but on condition that we freely accept it and do not try to possess it. This prayer is communion with the Spirit of God who is charity, pure gift. The possessive instinct in us wants to hang on to what is good for dear life and the tranquillity is so good and brings such a deep sense of security that the temptation to hang on is very great. But let it go. Accept each period of Centering Prayer as it comes, without asking for anything, having no expectations. In that way its fruits will grow faster. We always want to possess. That is why it is so hard to let go, why we want to reflect on moments of deep peace or union in order to remember how we got there and thus how to get back. But charity is non-possessive. It gives all back to God as fast as it comes. It keeps nothing for itself. The tendency to reflect is one of the hardest things to handle in deep prayer. We want to savor the moment of pure joy, pure experience, pure awareness. But if you can gradually train yourself to let the temptation to reflect go by,just like any thought, you will pass to a new level of freedom, a more refined joy. We are accustomed to think we do not experience something until we express it in a thought. It is difficult to be childlike, to enjoy what is happening and.forget it when it has passed--to savor the immediacy of reality. Reflection is one step back from experience. It is a photograph of reality. As soon as you start to reflect, the experience is over. Reflection on joy is an attempt to possess it. Then it is lost. This method of prayer is a t~-aining in self-surrender. It teaches us by our own experience and mistakes not to be possessive, but to let go. If in this prayer you can get over the inveterate habit of reflecting on what is going onnhave peace and not think about having peace--then you will have learned how to do it. Interior Purification There is a fifth kind of thought which arises in Centering Prayer. Any form of meditation or prayer that transcends thinking sets off the dynamic of interior purification. This dynamic is a kind of divine psycho-therapy. The experience facilitates the coming to consciousness of one's motivation Cultivating the Centering Prayer and evil tendencies, and sometimes enables the organism to release deep rooted tension in the form of thoughts. Generally, thoughts Which are the result of this process arise in the mind when one is most at peace, without one's knowing where they come from or why. They may introduce them-selves wih a certain force or even with an emotional charge. Once again, the best way to handle them is to return to the sacred word. If you can once grasp the fact that thoughts are not only inevitable, but necessary as part of a process of healing and growth initiated by.divine grace, you will be able to take a positive view of them. Instead of looking upon them with negative feelings as distractions, you see them in a broader perspective that includes both silence and thoughts--thoughts that you do not want or accept, but which, for the purpose of inward purification, are just as valuable as moments of profound tranquillity. Conclusion Take everything that happens during the periods of Centering Prayer peacefully and gratefully, without putting a judgment on anything, and just let the thoughts go by. It does not matter where they come from, as long as you let them go by. Don't worry about them. Don't fret about them. Don't judge the prayer on the basis of how many thoughts come. Simply follow the fundamental directive. When you are interested in a thought, either positively or negatively, return to the sacred word--and keep returning to it. This is fulfilling the Gospel precept to watch and pray. It is a waiting game to the nth degree. All through the Prayer of Centering your mind will be in and out of deep silencemlike a balloon floating in the air on a calm day. Just when it seems to be sinking and about to touch the earth, along comes a little zephyr from nowhere and up goes' the balloon. So it is with our consciousness. You should pick up the sacred word at whatever level you find it--a simple impulse of your will may be sufficient. Then you can go back into silence without delay. If you get angry--"O, I wish my mind would keep still!"--then you get thrown out farther. You must be non-judgmental about particular experiences of this prayer. The only way to judge it is by its long-range fruits: whether in daily life you enjoy greater awareness of the presence of God, greater peace, humility, and charity. Having come to deep silence, you see more clearly your capacity to relate to others at the deepest level, to pass beyond superficial appearances like social status, race, nationality, and personal characteristics. To know God in this way is to perceive a new dimension to all reality. The ripe fruit of this prayer !s to bring back into the humdrum routine of ordinary life, not just the thought of God, but the constant awareness of his presence beyond any concept. He Who is--the infinite, incomprehensible, ineffable Onemis the God of faith. In this prayer we are asking, "Who are you?"--and waiting for the answer. We Are No Longer Strangers. Ecumenism, the call of all Christians, is especially the apostolate of the Atonement Fathers who annually prepare special materials for the Week of Prayer for Christian Unity. along with their many other works. We present here two of the articles thus prepared which we deem of. special interest to religious. Contact: Rev. James J. Gardiner. S.A.; Graymoor Commu-nications: Graymoor/Garrison, NY 10524. Ecumenism- Source of Confusion or Renewal? Kenneth G. Stofft, S.A.* In 1889 a Southern Baptist pastor and editor proposed that "'representative men and competent scholars" from the churches come together to "con-sider the: differences of belief from the Bible standpoint." Thomas Tread-well Eaton was convinced that, even though scholars could not agree on all points, they could at least establish some agreement and clear the field of "much useless and cumbersome rubbish" impeding Christian reunion. This piea was taken up the following year by the Southern Baptist Convi~ntion in Fort Worth, Texas. Approvingly, the convention suggested that othe~ denominations appoint representatives to study together the biblical teaching on those points of doctrine and ecclesial government over which the churches were divided. At least, said the convention delegates, this concerted study could help achieve "a better understanding of the issues involved." In addition to the joint study, it was proposed that the *Father Stofft is Staff Officer in'ihe Office for Ecumenical and Interreligious Affairs of the Roman Catholic Archdiocese of Oklahoma City, Oklahoma. 16 We Are No Longer Strangers results of such deliberations "'be Widely published in all denominational papers, so that the Christian public may be thoroughly informed" and that "progress may be made toward true Christian union" (see Proceedings of the SBC, 1890, Atlanta, GA: Franklin Printing House, 1890, page 22). Even though the pleas of Eaton and the Southern Baptist Convention of 1890 were generally ignored by the churches and communities, the prin-ciples espoused were continually taken up by lone voices who attempted to keep the evangelical call for Christian unity before the ecclesiastical public--no matter how small that public became. The cali for '~a better understanding of the issues involved" in Christian divisions was reiterated by a small group of missionaries who ushered in the ecumenical movement at the turn of the century. The suggestion by Eaton that "competent scholars, . . consider the differences of belief from the Bible standpoint" Was recognized and officially affirmed by the Roman Catholic Church dur-ing the early part of the Second Vatican Council in 1963. The need to keep the Christian public "thoroughly informed., that progress may be made toward true Christian union" has been one of the major aims of the annual Week of Prayer for Christian Unity (January 18-25), as well as of the national and international dialogues between the churches and Christian communions. Because of the pioneering vision of men and women like Thomas Treadwell Eaton and the Southern Baptist Convention of 1890, the biblical call for "conversion" through Christian unity is gradually being realized before our eyes in the present decade of human and ecclesial history. But has this perennial call become the source of unwarranted confusion among the churches or a true renewal of mind and heart for the sake of mission? As each Church tradition has reluctantly or enthusiastically entered various stages of renewal (liturgical, scriptural, ministerial), Christians have also entered a period when confusion, rath+r than a clean perception of renewed life and ministry in .the Spirit, seems to have grasped them. It is sometimes difficult to distinguish between what is an historical accident or custom of Church life, and what is primary and essential to Christian belief and life. The ecumenical movement began with a di~dication to the scriptural mandate to witness to all nations concerning the saving work of God in Jesus Christ. However, the movement has grown in strength and credibility because, of its critical, historical eye toward the past and present, having firmly placed its precarious future within the will of the Father through prayer, patient study and continued shared ministry for the sake of the Gospel. The 1978 Week of Prayer for. Christian Unity (January 18-25) has for its theme: "We are strangers no longer" (Ep 2:12-22). In this passage from St. Paul's Letter to the Church at Ephesus, the apostle from Tarsus stresses the need for the Church to ground its faith in Christ Jesus, its foundation. Review,for Religious, Volume 37, 1978/1 Within the Church we are no longer strangers, because we form together the household of God, are saintly citizens, and rise up as the building whose foundation is the Risen One. Since we are no longer strangers to one another, nor to the Lord, we are presumably fellow saints who understand the issues having to do with our household. If this simple fact is not reflective of reality, or even close to our daily lives, then perhaps we are treading on dangerous ground and following the way leading to confusion, rather than renewal. Scholars of our various traditions and communities have attempted to examine both the truths we hold in common as followers of the Lord and the numerous differences in understanding these truths which characterize us as distinct "churches." These same scholars have passed on their research and findings to church officials for examination and dissemination to the wider community of the Church. We are requested to examine the results of these national and international dialogues and ask ourselves: Do these agreed statements re-flect our living faith? The first step toward Christian familiarity has been taken: to consider our differences in light of Scripture. The second step has been attempted: to publicize the progress of these dialogues through denominational media. The third step along the path to an intelligent process of education and renewal has not adequately been taken: to ask, is this our faith? The third step, however, presumes a great deal about church people and churches. It presumes we are familiar with the unique heritage we possess as part of the Church universal, with the inherited gifts we have as churches. Each church or Christian community has its own history but it also shares a common, history with others. Are we familiar-with the development of the Church and churches? Do we appreciate our differences as factors of his-tori~ al development? What binds the Southern Baptist churches to the Roman Catholic Church, for example? What has been the history of our development under the guidance of the Spirit and the pressures of world society? What separates and unites us as part of the household of God, fellow citizens of the saints? An examinatirn of such questions may help to reduce prejudice and confusion and may well achieve in the power of God a renewal, conversion of mind and heart for the sake of mission. A thorough renewal in the light of Scripture and history may aid the people of God in becoming more visibly the Church, in attaining "true Christian union" in close relationship with our. Savior and Lord, who is also our brother and the Son of Man. The historical period we are entering today is critical because it chal-lenges all of us to identify ourselves as "church" in relationship to one another and the Lord. Without educated lay people, religious educators and pastors, the challenge will be a major source of chaos. We must be familiar with our ecclesial history as both the source of our divisions and the oc-casion for our "reunion" in the Spirit for the sake of the Church's identity We Are No Longer Strangers I 19 and mission in the world. Who are we? Why are we who we are? Ecu-menically, we may be able to clear the field of "much useless and cum-bersome rubbish" impeding our "access to the Father" as "fellow citizens of the saints, and members of the household of God." Oo Ecumenical Worship: What Do We Say to the Father? Charles Faul, S.A.* ~n those first "spring-time" days of ecumenical dialogue that followed soon after the Second Vatican Council, I became involved with an interfaith discussion group in my hometown. We knew little about each other and the tone of our discussions, while friendly, was also a good deal defensive. Most of us, in the beginning, felt the need to defend the rituals and doctrines of our particular segment of Christianity. This was natural enough, since we had been raised to believe that our way came closest to what Christ had ordered for his Church. Due no doubt to the breath of God's Spirit;-we gradually came to understand each other better and moved toward the vision of the faith we held in common. Certainly,. some favored a Church centered on sacra-mental life and hierarchical order~ while others favored the primacy of Word and less structure,, but we also learned that words like "Father," "Lord," "Spirit," "Baptism" and "Gospel" had much the same meaning for all of us. Most important, we came to this understanding as we learned to pray with one another. When our lips spoke the words of faith that sprang from our hearts, the commonality of our beliefs became apparent to us all. Ten years or so have passed since that time, and the historians, liturgists and theologians of Western Christianity have Confirmed in their speeches and writings what we discovered in our grass-roots dialogue ~uring the 1960's: the faith that we share as Christians, whatever our denomination, *Brother Faul is a theological student atAtonement Seminary, Washington, DC. 20 / Review for Religious, Volume 37, 1978/1 is monumental. ,Our common bonds reach back to the faith of the Fathers of the early Church and to the New Testament. Our traditions vary, of course, but our willingness to rethink our positions has led to some remarkable convergences. The Roman Catholic Church, forexample, has centered much 6f its renewal on the need to rediscover the importance of the Word for liturgical and doctrinal formulations, while, at the same time, the more evangelical churches have developed an ever-increasing awareness of the importance of sacramental life and, in particular, the centrality of the Lord's Supper in the expression of Christian life and witness. Dialogue between the theo-logians of major church bodies has produced statements affirming one another's ministry and express.ing a common view of eucharist and church order. Truly it has been a remarkable decade, but what does all of this mean for the personal and congregational level? We live', work and celebrate not with theologians or liturgists, but with each other. Each of us is that most enigmatic of figures, "the average Christian." The average Christian, how-ever, is the Church of Christ in miniature. The summation of our faith is the faith of the Church, and our worship, its prayer. How then in our joint worship can we express this valuable new insight? The theme selected for this year's Week of Prayer for Christian Unity is~'No Longer Strangers" (Ep 2: 19). It describes the feeling, mentioned at the beginning, that is experienced by those who have come to know that Christians outside one's own tradition are not competitors, but rather brothers and sisters in the journey of God's Pilgrim People. The question, then, is how might our prayer reflect this point of view? First of all, we must understand that all Christian prayer is ecumenical, since we pray to the one Father, in the name of the Lord Jesus, through his Spirit. This is the basis of prayer for all Christians. Thus, whether we pray privately or in a body, with our own congregation or in an ecumenical - setting, we are praying with and for the Church of Christ. We, in fact. come to a deeper sense of the universality of Christ's Church. Second, at those times when we engage in specifically ecumenical wor-ship, that is, when Christians of various traditions come together to pray, we need to recognize the bonds which join us together. We all suffer fiom brokenness and division, not only as a Church, but also as individuals and communities. However, our hope is found in the redemption won for us by Christ, won for all of us, and in the grace of his Spirit poured out freely on each of us. This is the source of any healing that might stem from our common worship. We share the belief that the dying and rising of the Lord is the model of Christian life for each of us. We must die each day to sin, in order to rise, though the grace of God, to a new life. Realizing we need each other's prayer and support in order that God's action in our lives might be fruitful, we come to a deeper sense of the unity of Christ's Church. Ecumenical Worship: What Do We Say to the Father? Finally, when we examine the liturgical heritage of the Christian faith, we can find the practical elements of ecumenical worship. Christians can pray together, not only for eight days in January, but on any and every.day, using the sources common to Christian believers in every age, namely: I) the words of Scripture and the early church writers; 2) prayers of praise, thanksgiving and intercession; 3) the church creeds, especially those com-monly known as Apostle's and Nicene; and finally and most important, 4) The Lord's Prayer which is the model for all Christian prayer. None of these elements is the possession of any one denomination. They are the liturgical inheritance of all Christians. In their usage we come to a deeper Sense of the holiness and apostolic foundations of Christ's Church. In coming together to pray for Christian unity, one group might want to follow the formats suggested for Morning Prayer (Lauds) or Evening Prayer (Vespers) in the revised Roman, Anglican or Lutheran Prayer Books. Another group might wish to use a more flexible structure, such as has developed in the many prayer communities which have sprung up recently. It is not the format that matters, but rather the act of Christians praying together. We must remember that Christ did not organize a discussion group. Heprayed "that all may be one" (Jn 17:21). Mutual dialogue is vital to the future of ecumenism. We must discern, however, that the most important, fruitful dialogue is the exchange between God and the com-munity of believers in Christ Jesus. If we are able to worship together in "Spirit and in Truth" (Jn 4:24), we will have advanced the cause of Chris-tian unity, for we will have come not to lament our divisions, but rather to realize our need for one another as sisters and brothers, "no longer strangers." Integration and the Sacrament of Reconciliation Robert F. Morneau Father Morneau is a frequent contributor to these pages. He resides and teaches at Silver Lake College of the Holy Family; Manitowoc, WI 54220~ Integration is concerned with "putting it all together." This admirable quality is sometimes ascribed to actresses who excel in their art, to pro-fessional athletes who have reached the peak of performance, to persons who live healthy, balanced lives. How common or rare these people are is a matter of dispute. Perhaps most of us could identify, not so much with the integrated universal man of the Renaissance, but rather with the plight of poor Humpty-Dumpty. Like him, all the king's horses and all the king's men cannot quite get us put back together again. The fragmented life of Humpty-Dumpty is a universal image in that all people of every age have had to contend with the realities of division, alienation and anomie. These forces are strangers to no one, though the intensity and longevity of each varies from person to person. Lest we despair in the face of this disinte-grative factor of reality, we must also come to recognize that the process of healing is a significant power in life. The healing process mends and restores persons, relationships and the world. A realistic view of life de-mands that the dialectical nature of division and healing, sin and grace, sickness and health all be fully appreciated for what they are. Despite the fact of disintegration, the Christian vocation has as its goal both individual and communal wholeness: integration in love is God's call to mankind. Our trust and hope is grounded in the Spirit of love who unifies and heals all of life. This love, God's gift of himself to his people, draws us into an intimacy with him that is the core of Christian living. Like a fish in Integration and the Sacrament.of Reconciliation / 2~i water or like a bird in the air, the very existence of the Christian demands the presence of God's love. St. Paul's message to the Ephesians summa-rizes this so well: "To live through love in his Presence." God's love is the source of all integration; living outside that love results in the darkness and estrangement flowing from separation from the source of light and peace. Those who have traveled before us have expressed well the central role of God in human life: the psalmist prayed, "You are my God. My happiness lies in you alone" (Ps 16). Augustine also summarized the nature of true peace: "For thou hast made us for thyself and our hearts are restless till they rest in thee." The succinct call to integration comes from scripture: This is what Yahweh asks of you: only this, to act justly, to love tenderly and to walk humbly with your God (Mi 6:8). Though we smile at the slight understatement ("only this"), the prophet presents a vision of life that is radically simple. The complexity of intricate theologies, the score of duties and obligations, the multiplicity of laws all seem less threatening when we can summarize God's will in terms of being and becoming a just, loving and faithful person and people. These qualities reveal the interiority of integration. Justice leads to peace and oneness, whereas injustice, by withholding from others their proper due, causes division. Love unifies through affirmation and support, thus providing hope to the weary and discouraged, whereas apathy and indifference isolate and separate person from person. Faith, the intimacy of a personal relationship with Christ, is an integrative power shedding light and warmth on the spirit of man, while faithlessness terminates in the despair of meaninglessness. Justice, love and faith are seen as the ingredients of an integrated existence. . The sacrament of reconciliation aims at fostering the vocation common to all of us: to-be-one with God, with others, with the world and with ourselves. As with all the other sacraments, the sacrament of reconciliation makes present God's love and forgiveness in a special way. Through the encounter with Christ, the penitent is offered the grace of healing which helps to put back together again all the spiritual.humpty-dumpties of his-tory, and we are in that number. God's gracious love hurries to friend the deep split within the person which Paul Tillich describes so well: It is important to remember that we are not merely separated from each other. For we are also separated from ourselves. Man Against Himself is not merely the title of a book, but rather also indicates the rediscovery of an age-old insight. Man is split within himself. But the depth of our s.eparation lies in just the fact that we are not capable of a great and merciful divine love towards ourselves.1 1Paul Tillich, The Shaking of the Foundations (New York: Charles Scdbner's Sons, 1948), p. 158. ~4 / Review for Religious, Volume 37, 1978/1 It is in Jesus that this divine and merciful love touches our lives to mak~ us whole once again. Integration: Personal and Communal--The HHH Principle The historical pendulum swings violently fl'om one extreme to the other. One period will stress the uniqueness of the individual withoutgiving prop-er attention to the social nature of the person. The rugged individualism of American history is a case in point. Then the pendulum, having reached its one extreme, swings its reactionary way to the other pole. Collectivism and totalitarian ideologies arise to stress the social whole to, the exclusion of individual rights. The twentieth century's political and social theories of fascism and communism are examples of this one-sided mentality. The truth of the maiter lies in the middle: both the individual and the social facets of human existence must be recognized, protected and fostered. Their interdependence and interrelatedness are principles of in-tegral living. Oneness involves both the individual person and the com-munity. The new rites for celebrating the sacrament of reconciliation carefully protect both dimensions. This fact must be kept in mind through-out the following description of.integration. The themes and principles of ¯ integration applicable to the individual are also, by way of analogy, nec-essary for an understanding of communal integration. On the personal level, there are three major elements seeking integra-tion. Anatomically, each of us has a head, a heart, and hands (HHH). Symbolically, these parts of the human body represent the capacity to ¯ know, to feel and to act. In the field of education, the concern for growth of the whole person is spoken of in terms of developing the cognitive, affective and behavioral domains. On a community level, these elements might be described as common beliefs, common sentiments and a common life-style. In~ofar as there i~ harmony (congruence) among these various . components, there is a sense of integration and peace; when these elements contradict each other or are unrelated, the result will be one of varying degrees of conflict and tension. Looking more ~losely at the personal level, we can discover the inter-relationships among the various elements seeking integration. Through cognitive powers we search out the truth, often at a high cost: ¯. who has given up much that he loved and prized and could have retained, but that he loved honesty better than name, and Truth better than dear friends,2 The consequence of living in the truth, as St. John's gospel points out, is that it leads to freedom: the truth makes us free while ignorance en,slaves and issues in fears. We were born to see reality in its deepest dimensions 2John Henry Cardinal Newman, Apologia Pro Vita Sua (Boston: Houghton Mifflin Company, 1956), p. 1 I. Integration and the Sacrament of Reconciliation / 25 and to act on the knowledge discovered there. Carl Jung in his autobiog-raphy shares a universal principle that deals with the relationship between knowledge and action: It is equally a grave mistake to think that it is enough to gain the understanding of the images and that kn.owledge can here mak.e a halt. Insight into them must be converted ifito an ethical obligation.3 It is through the cognit.ive capacities of reason and intuition that insights emerge, concepts and principles are formulated, conclusions are drawn and life is lived. Our creeds, constitutions, journals and discoi~rses attempt to i-ecord our mental travels. Though our perceptions are always limited and our articulations fail to capture the fullness of the reality, yet the extent of our knowledge is amazingly vast. The affective domain, symbolized by the heart, takes us into a rich though complex area of life. Feelings, emotions,, urges, tendencies, and drives are terms attempting to describe some of the powrrful and ambig-uous movements of our affectivity. Here it is that joy and sorrow, panic and calm, anxiety and peace .are experienced in degrees which only our unique person can narrate. Because literature claims for her own the mat-ters of the heart, it has universal appeal. So often the literary genius speaks of the affective level: When your own heart's been broken it will be time for you to think of talking.4 "1 do not know at all," said Martin. "'i should have to be in your heart to know.''3 The relationship between the cognitive and affective domain is complex. During certain periods of life a dichotomy exists between the two. (One calculation measured the distance from head to heart to be two light years!) How many Christians. know intellectually that God loves them and is al-ways present to them and yet do not experience this truth in their hearts? Possession of an accurate and sound theology does not guarantee an ex-perience of the heart. With integration between intellectual Conviction and personal affectivity, the distance seems to vanish and there is a mutual support and affirmation. Emerson's insight is profound:. "Our intellectual ¯ and active powers increase with our affection.''~ Truth experienced af-fectively and affections experienced in truth enrich life.7 ~C. G. Jung, Memories, Dreams, Reflections. Recorded and edited by Aniela Jaffe. Translated from the German by Richard and Clara Winston (New York: Vintage Book, 1963), pp. 192-193. 4C. S. Lewis, The Great Divorce (New York: Macmillan Publishing Co., Inc., 1946), p. 97. 5The Best Known Works of Voltaire (New York: The Book Leagu~e, 1940), p. 142. 6"Friendship," Essays of Ralph Waldo Emerson (New York: The Book League of America, 1941), p. 65. 7Two comments might be made at this point. Newman's well-known distinction between real and notional knowledge explains the dichotomy in more academic terms. Secondly, in light of the importance of affectivity in human and spiritual living~ our educational institutions must more systematically attempt to educate the affective area of life as well as the intellectual. 26 / Review for Religious, Volume 37, 1978/1 The old line, "Do as I say, not as I do!" draws attention to the third ingredient in personal and communal life, behavior. The question arises: do the words that I speak and the actions I perform truly express what is in my mind and heart? Do I live out my beliefs and values? Disintegration is experienced when a discrepancy exists between what I know to be true intellectually and a life-style that contradicts this truth, or when a dis-crepancy arises between that life-style and what I am feeling at the gut level. Every day life provides examples of such discrepancies: to know that a certain substance (alcohol) is dangerous in certain quantities and yet con-tinue to drink; to prize physical fitness as an important value and yet never take tim~ to exercise; to yearn for intimacyowith a loving God and never take time for prayer. Integration is realized when we channel into behavior our limited time and energy in such a way that this behavior parallels our thinking and feeling. A single stream is formed, a stream that contains truth, beauty and goodness. Integration and the Sacrament of Reconciliation The new rite of the sacrament of reconciliation delineates four basic and essential components: contrition, confession, satisfaction and absolution. These four elements directly foster both personal and communal integra-tion. The sacrament is the means by which the Lord Jesus makes us whole, healing the division within each person and the communal fragmentation resulting from injustice and apathy. The new rite speaks to the head, the heart and the hands, to the whole person. ~ In the new ritual, contrition is described as "a profound change of the whole person by which one begins to consider, judge and arrange his life according to the holiness and love of God" (Ritual, ~6). This is a call to integration, to put our lives together with God's help and to continue to grow in his gracious love. This process of growth implies an openness to God's word which transforms and molds us. It means that, as a pilgrim people, our lives are always in process and stand in need of conversion. Minimal self-knowledge exposes the dark areas of our life where selfishness flourishes and superficial change predominates. The new rite speaks of contrition as something that goes down to the very depth of our person, radically touching our ideas, attitudes and conduct. Integration is only possible at this level. Though conversion is a gradual process involving grace, time and en-ergy, it is not meant to be piecemeal. God calls the whole, person, not just one aspect of life. This realization helps to protect the unity of the person and implies that what affects one area of life will affect, if not immediately at least eventually, every other area. The ritual spells out the process of conversion as it touches upon three components of integration explained earlier: 1) Consideration. We are challenged to use our cognitive abilities to consider how our personal and communal lives measure up to the holiness Integration and the Sacrament of Reconciliation / 27 and love of God. 2) Judgment. After deliberation, we draw conclusions about how to improve our response to God and his will, employing the richness of our affectivity to sustain and give dynamism to that response. 3) Arranging life. Authentic contrition means that our life-style, what we say~and how we say it, the kinds and quality of our relationships, the reaching out to others, must at certain points be adjusted and modified. This broad, panoramic view of contrition challenges both the inner and outer man. The sacrament of reconciliation calls the whole person to turn to the living and true God in hope and fidelity. Confession, the second main component in the new rite, "comes from true knowledge of self before God and from contrition for those sins" (Ritual, ~6). Our sacramental system, concerned as it is with the covenant relationship between God and man, is obviously person-centered. It in-volves our worship of the person of our gracious Father, a deep partic-ipation in the paschal mystery of our Lord Jesus, the giftedness of peace and joy flowing from the Spirit. The trinitarian God is the core of all the sacraments. The challenge is to come to an even deeper knowledge of the living God, and from this perspective, to achieve our true identity. The crucial role of the scriptures becomes obvious in this framework. In God's word we find the revelation of his love and forgiveness; we enter into the rich world of faith. Cognitively we discover the reality of God's love which is the truth that creates freedom. Experiential knowledge of this most central fact necessarily touches the deepest affections of the heart. We are stirred interiorly to respond with our whole lives to this gaze of love. The canticle of Mary is a confession of being loved: My soul proclaims the greatness of the Lord, my spirit rejoices in God my savior for he has looked with favor on his lowly servant,a True affective knowledge works its way into the behavioral domain. Our life becomes different; our words and deeds originate from the wellspring of God's mercy and goodness. The confessing of sins will thus involve the whole person: what we know, what we feel, what we have done and will do. Confessing both expresses and promotes integration. Satisfaction or the act of penance is the third important element in the new rite. In a special way satisfaction reaches beyond the notion of per-sonal integration to embrace the larger community. In doing the truth, in correcting injustices, in serving more deepiy, we implicitly call others to witness and experience the newly gained integration of our own lives. The Roman Ritual states: "true conversion is completed by acts of penance or satisfaction for the sins committed, by amendment of conduct, by repara-tion of injury., to restore order"'(Ritual, #6c). Integration implies and aLuke 1:46. 21~ / Review for Religious, Volume 37, 1978/1 necessitates order. Wholeness exists when things are in place just as frag-mentation is experienced in chaos. In a sense, sin is being "out of place." In Gibson's play The Miracle Worker, Annie Sullivan, the teacher of Helen Keller, speaks to herself in a mirror: '~Don't worry. They'll find you, you're not lost. Only out of place." The "hound of heaven" pursues us when we lose our way in the darkness of sin; in being captured by mercy and love, the Lord relocates us in the plan of the Father. For true satisfaction we must be aware and understand that the proper order of things has been broken (cognitive element); we must interiorly feel and be concerned about the anguish and restlessness caused by sin in our lives and the lives of those we touch (affective element); with God's. grace we must reconstruct the harmony shattered by our infidelity (behavorial element). This whole process of reconciliation is no abstract, nebulous role playing; it touches the core of our lives. It is based on fact and experience. Though somewhat overstated, Carl Jung's reflection that "in religious mat-ters only experience counted" does express the seriousness surrounding the sacrament of reconciliation. Satisfaction, the acting out of heartfelt sorrow in°experience, is a vital integrative force restoring that order that leads to justice and peace. Absolution is the fourth main element in the celebration of God's mercy. The new formula of absolution contains a wealth of theology, deserving in its own right a detailed explication. The minister, representing the Risen Lord and the Church, prays: God, the Father of mercies. through the death and resurrection of his Son,. has reconciled the world to himself and sent the Holy Spirit among us for the forgiveness of sins; through the ministry of the Church may God give you pardon and peace. And ! absolve you from your sins in the name of the Father, and of the Son, and of the Holy Spirit. Amen. The wholb person is drawn to respond to this majestic oration. The mind is nourished with the experience of a merciful God, with the marvel of the paschal mystery, with the fact of the instrumentality of the Church, with the knowledge that pardon and peace are gifts from God, with the under-standing that all three persons of the Trinity heal the sickness of the person. These insights liberate us from false fears and narrow slaveries, enlighten the darkness of our minds and enrich our faith, foster wisdom, allowing us to see what is truly essential and worthwhile. Our affectivity is also nour-ished by this prayer of absolution. Our heart is touched by the revelation of God's love and graciousness, by the joy of reconciliation, by the dis-pelling of anxiety and guilt, by the calmness of peace and pardon. The sacrament intends to soften the hardness of heart and to foster the gen-tleness that alone brings life. Full, active and conscious participation in Integration and the Sacrament of Reconciliation / 29 this encounter with the Risen Lord abets a richer, affective life. Integration proves itself in action and the prayer of absolution necessarily includes Christian living; it touches the transformation of our truths and feelings into words and deeds. The absolution formula provides an example of what forgiveness is, thus challenging us to forgive each other as God forgives us. We are called to participate in the death-resurrection of Christ in our daily lives, dying to our selfishness in being for others. Through the gift of the Spirit, we are empowered to enrich the world by sharing the Spirit's love, joy and peace. Our lives are different when we recognize experientially the price of our sins: the cross. The shadow of the cross calls us to repent and to believe. The prayer of absolution is a prayer leading us to authenticity. It provides the vision that harmonizes our visible life of daily conduct with the new mind and heart we have put on in Christ. Integration and the Holy Spirit The possibility of Christian integration is based on the gift of Spirit. The Risen Lord in union with the Father sends their Spirit into the world to complete the work of redemption. Through the sacrament of reconciliation this work of restoration takes on visibility and becomes efficacious in the lives of those who believe. The Spirit directs us in .our struggle toward oneness within ourselves and among all people. Within the framework of the HHH Principle, we can examine the role of the Spirit in the process of integration. The tradition of the Church points out that there are four gifts of the Spirit that aid the intellectual and faith growth of God's people: wisdom, knowledge, counsel and understanding. Through these "cognitive" gifts we contend with the ever-present forces of folly, ignorance, rashness and dullness of mind. God, coming to the aid of our finite minds, supplements our ability to grasp truth through the personal Light of his presence. The heart, often bruised and broken, also stands in need of special gifts. Through the Pentecost event, fortitude, piety and fear of the Lord are offered as powerfui nutrients enriching our affectivity. Thus we are enabled to stand firm in the face of fear, to struggle valiantly against hardness of heart and acedia, to deal honestly with the arrogance of pride seeking to remove God from the center of life. In the sacrament of reconciliation, these gifts are available with the coming of the Spirit. But discernment is a difficult task ih life. How do we know whether or not we are growing in the Lord? Are we really allowing the mind and heart of Christ to influence our lives? What are the signs of health and illness in our Christian lives? Through the writings of St. Paul, God has given us an evaluation system to aid us in testing the quality of Christian growth. In his letter to the Galatians, Paul spells out the evidence indicating the spirit of evil and the Spirit of God. If the signs of God's Spirit are present, we have some assurance that we are doing the will of the Father and that the gifts 30 / Review for Religious, Volume 37, 1978/1 of the Spirit are truly effective in our words and deeds. If the opposite signs are present, we are provided with some hard evidence that we are failing in our Christian responsibilities. Paul writes: But when you follow your own wrong inclinations your lives will produce these evil results: impure thoughts, eagerness for lustful pleasure, idolatry, hatred and fighting, jealousy and anger, constant effort to get the best for yourself, complaints and crit-icisms, the feeling that everyone else is wrong except those in your own little group~ and there will be wrong doctrine, envy, murder, drunkenness, wild parties, and all that sort of thing . But when the Holy Spirit controls our lives he will produce this kind of fruit in us: love, joy, peace, patience, kindness, goodness, faithfulness, gen-tleness and self-control? Conclusion The revision of the sacrament of reconciliation provides the contem-porary Church with a process and vision to bring about the oneness we all desire. Unity is something intrinsic to our lives. William Lynch beautifully expresses this need in every.person: What I want first to propose, as a sort of working point of discussion, is that the very deepest need the pe6ple have is the need for closenenss to, union with, things and persons and God. This principle underlies every need of man. It is not a luxury or a gimmick. It is fundamental, primitive; eternal and universal . Everybody knows, when it is put in his language, that real solitude is hell and that unity is peace)° The sacrament of reconciliation deals directly with that aspect of our life which obstructs and prohibits unity: the reality of sin. The great marvel is that God's love and mercy have conquered sin and death and through the sacrament of reconciliation bring us in touch with this victory of God. A schematic summary of this article might appear as follows: A. God's initiative: the call to justice love (lived out fully in the person of Jesus) faith B. Mankind's response: so much injustice / apathy / faithlessness (mystery of sin) C. Jesus came to reconcile all creation to the Father---continues to come in their Spirit to heal the whole person--to bring about integration Truth overcomes falsity Beauty overcomes ugliness Goodness overcomes evil Head Heart Hand Gifts of wisdom, knowledge, counsel understanding Gifts of piety, fortitude, fear of the Lord Signs: love, joy, peace, patience, kind-ness, goodness, faithfulness, gentleness, self-control. D. Result: Oneness with the Father through Christ in the Spirit. Wholeness, union, sanctity,' integration. gGalatians 5:19-23. ~°William F. Lynch, S.J. The Integrating Mind (New York: Sheed and Ward, 1962), pp. 134-135. Integration and the Sacrament of Reconciliation / 31 A growing appreciation of the depth and breadth of the sacrament of reconciliation is important if we are to fully enter into this great gift. The revised rite provides us with many advantages: the stress and variety of scripture, the personal touch with the face-to-face option, the emphasis on the communal nature of sin, the demand for authentic conversion, the joyful tone of celebrating God's mercy and love and not getting caught up in oneself. Our challenge is to understand as fully as possible the meaning of the sacrament and to experience its tremendous force in our personal and communal lives. .0 Now Available As A Reprint The "Active-Contemplative" Problem in Religious Life by David M. Knight Price: $.75 per copy, plus postage. Address: Review for Religious 612 Humboldt Building 539 North Grand St. Louis, Missouri 63103 To Make Good Again: A Selected Bibliography on Reconciliation Mary Colurnba Offerman, P,B.V.M. Sister Mary Columba, a librarian, has contributed other bibliographies to these pages. She resides at 2360 Carter Rd.: Dubuque, IA 52001. The word reconciliation evokes many meanings. Its primary meaning is "to make good again" or "to restore." The need of reconciliation pre-supposes that some harmony has been violated or disrupted. Many times man has broken his bond with G~d. Man must choose to be reconciled completely. God's plan for the return to complete harmony involves God himself, man, his neighbor and his community. When God created the universe everything was good. The psalmist tells us that every-thing existed in harmony, peace. Man misused his power to be steward over God's creation. The way to restore peace and unity with God, our neighbor and our world is through repentance, conversion and reconciliation. There are various levels of reconciliation. There is a reconciliation with God and a reconciliation with one's fellowman. Reconciliation for the Catholic Church entails the relationships of the Church with other churches. Reconciliation Within society is required when we have differ-ences due to race, nation, class, degrees of economic and social devel-opment. Every person's life is filled with numerous calls to reconciliation. Oppor-tunities arise daily when we can reconcile with .brothers, neighbors and those around us. Reconciliation begins at home. By turning towards God, our Father, we can become aware of how little we are without him, we can 32 To Make Good Aga. in: A Selected Bibliography on Reconciliation realize the worth of each individual and our own personal worth in his eyes and create situations that promote cooperation and sharing. We can ob-serve God's goodness in all the events of life. The recent Holy Year of 1975 offers opportunities for reflection on those things and happenings that direct us toward Christ and the eternal reward of heaven. We had many occasions to be more concerned with our interior or spiritual life, rather than with the exterior and materialistic things of life. That year of reconciliation called us to promote works of charity, to do penance and to perform works of piety. The Holy Year theme of renewa[ and reconciliation has been an in-vitation to respond to interior renewal in order to become better instru-ments of reconciliation with God, neighbor and the world. By developing a true spirit of joy, compassion and kindness and by using our creative instincts, our love for life and for our fellowmen will contribute to holier years to come. The Church expects much of the religious man and woman. Religious have been urged to reflect on their way of life as this was asked of them by Vatican Council II. We are reminded to persevere in faithfulness to prayer, becoming more perfect followers of Christ and a radiation of joy in carrying the crosses that cannot be separated from our state in life. On each religious community rests its future destiny. The living out of the vows from day to day frees us to be a sign of reconciliation. The ministries of the religious woman have taken many forms. Some are in education, others turn to .nursing and still others perform one of the ministries of service which has emerged recently. The ministry which is chosen will become a healing ministry if the religious is a person of rec-onciliation, deeply rooted in Christ and proclaims him as her Lord and Master. How do we make our ministry h service of reconciliation? By being a peacemaker among the students, parents' and those with whom we work, by being more prayerful, reflecting on the gospels and on spiritual' reading, by showing enthusiasm, uniting our sufferings to those of Christ, by consoling, developing ,a spirit of forgiveness, "to come away from each new grief without bitterness in continuing service, to see no one as an enemy and everyone as worthy of my service. Such are the realities of reconciliation. And they are reflected in thequiet dignity ofa fai.th-filled valiant woman.''1 In an article on teaching children about reconciliation, Rod Brownfield says, "If they come to appreciate more their own worth as friends of God, loved individually for their own lovable selves, if they come to see all the material world as gifts for their use and for their sharing, if they come to appreciate other human beings, as images of God loved by God; if they learn the spirit of awe and reverence for a generous Father; if they come to qennings, Sister Vivien, O.P., The Valiant Woman (New York: Alba House. 1974), p. 33. 34 / Review for Religious, Volume 37, 1978/1 want to mend what is broken and right what is wrong; if they can pray as they experience the good gifts about them; if they promote peace among themselves, their religion is a reality, reconciliation is going on and the kingdom of God is nearer.''z This could be our goal and we wou~d be striving to "make good again." Our relationship with God would be renewed or strengthened and all would be right with the world and our conscience. The following selected bibliography has been compiled to provide spiritual reading on the topic of "reconciliation." Methods, ideas, exhor-tations, reflections and worthwhile knowledge on "reconciliation" can be acquired from reading these books and periodicals. Thus Pope Paul's ad-monition "to make good again," to reconcile, to renew, will keep the religious woman in touch with her God, in touch with her Church, in touch with her world, her feliowmen and in touch with herself. BIBLIOGRAPHY Books Abbott, Walter, S.J., ed., The Documents of Vatican 11. New York: Herder and Herder, 1966. Bailey. J. Martin, From Wrecks to Reconciliation. New York: Friendship Press, 1969. Paper. Banks, Robert, ed,, Reconciliation and Hope. Grand Rapids: Eerdmans, 1974. Barry, David W., Ministry of Reconciliation. New York: Alba House, 1975, Paper. Basset, Bernard, S.J., Guilty. 0 Lord, Yes. 1 Still Go to Confession. Garden City, New York: Doubleday, 1975. Burghardt, Walter, J., S.J., Towards Reconci6ation. Washington, D.C.: United States Bishops Conference. 1974. Paper. Elliott, Ralph H., Reconciliation and the New Age. Valley Forge: Judson Press, 1973. Paper. Farrell, Edward, The Father Is Veo' Fond of Me. Denville, New Jersey: Dimension Books, 1975. Chapter 3. Surprised In the Spirit. Denville, New Jersey: Dimension Books, 1973. Chapter 2. Foley, Leonard, O.F.M., Your Confession: Using the New Rite. Cincinnati: St. Anthony Press, 1975. Paper. Guzie, Tad, What the Modern Catholic Believes About Confession. Chicago: The Thomas More Press, 1974. Paper. Hanson, Michael. O.M.I., and John Maronic'. O.M.I., The Pilgrim's Prayerbook (Holy Year Edition). Belleville, Illinois: Shrine of Our Lady of the Snows, 1974. Pages 25-32; 211-217; 237-287. Haring, Bernard, C.S.S.R., Prayer: The Integration of Faith and Life. Notre Dame, Indiana: Fides Publishers, 1975. Chapter 14. Harkness, Georgia, The Ministry of Reconciliation. New York: Abingdon Press, 1971. Paper. ZBrownfield, Rod. "'The Holy Year That Wasn't,'" The Catechist. IX, No. 3 (November, 1975). 9. To Make Good Again." A Selected Bibliography on Reconciliation / 35 Hellwig, Monika, The Meaning of the Sacraments. Dayton: Pflaum-Standard, 1972. Paper. Hessel, Dieter T., Reconciliation and Conflict: Church Controversy Over Social Involvement. Philadelphia: Westminster, 1969. Paper. Hinnebusch, Paul, O.P,.Friendship In the Lord. Notre Dame, Indiana: Ave Maria Press, 1974. Chapter 6. Praise God! Denville, New Jersey: Dimension Books, Inc., 1972. Chapter 6; Chapter 23. Hunter, Gordon. When the Walls Come Tumblin' Down. Waco, Texas: Word Books, 1974. Jennings, Sister Vivien, O.P., The Valiant Woman. New York: Alba House, 1974. Chapter I; Chapter 4; Chapter 7. Nelson, John, Dare to Reconcile: Seven Settings For Creating Community. New York: Friendship Press, 1969. Paper. Nouwen. Henri, With Open Hands. Notre Dame, Indiana: Ave Maria Press, 1972. O'Reilly, James, Reconciliation and Renewal. Chicago: Franciscan Herald Press, 1974. Powell, John, S.J. He Touched Me. Chicago: Argus Communications, 1974. Paper. Rabalais, Sister Maria, Come Be Reconciled; Youth Penance Resources. Paramus, New Jersey: Paulist Press, 1975. Schillebeeckx, Rev. Edward. O.P. Sacramental Reconciliation. (Concilium Series, Volume 6), New York: Seabury Press, 1971. Sisters of the Presentation, Witness to Love. Dubuque, iowa: Mount Loretto. 1977. Page 24. Stuhlmueller, Rev. Carroll, C.P., Reconciliation: A Biblical Call. Chicago: Franciscan Herald Press, 1975. Paper. Tibbetts, Orlando L., Reconciling Community. Valley Forge: Judson Press, 1969. Torrance, T., Theology In Reconciliation. Westminster, Maryland: Christian Classics, 1975. Van Kaam, Adrian, C.S.Sp., Spirituality and the Gentle Life. Denville, New Jersey: Di-mension Books, 1973. Periodicals Abeyasingha, N., "'Penance and the Holy Spirit." REVIEW FOR RELIGIOUS, May, 1974, 565-573. America, "'1975: Holy Year of Reconciliation," America, January 11, 1975, 2-6. Baumer, Fred, "'An Hour of Reconciliation," Liturgy. August/September, 1975, 227-231. Bernas, Rev. Casmir, O.C.S.O., "' Reconciliation In Paul,'" The Bible Today. December, 1973, 1395-1400. Brungs, Robert A., S.J., "'Reconciliation: Man-the-Maker and Man-the-Made," Theology Digest. Winter, 1974. 324-333. Bryce, Sister Mary Charles, O.S.B., "'Reconciliation Means Change," Modern Liturgy, February, 1977.8-10. Callahan, William R., "'Reconciliation," National Catholic Reporter, May 16, 1975. 7-8. Cranny, Rev. Titus, "'Renewal, Reconciliation and Christian Unity," Onr Sunday Visitor. January 12, 1975. I. Deutsch, Sister B., "Operation Fervor," Today's Catholic Teacher. February, 1975. 40. Du Charme, Jerome and Gall, "Introducing Young Children to the Experience of Recon-ciliation." Modern Liturgy. February, 1977, 12-13. Every, Robert L., O.P., "'Theology of Reconciliation." Emmanuel. October. 1974, 404-41 I. Fitzgerald, Frances, "'Vietnam Reconciliation," The Atlantic.June. 1974, 14-28. Galluzzi, Alessandro. "Reconciliation Is Main Motive For Holy Year," L'Osservatore Romano, June 28, 1973, 2. Hatton, Sister Vianny, "'The Communal Rite of Reconciliation," Folk Mass and Modern Liturgy, January, 1975, 12-14. Jolliffe. P,, "'Prayer and Christ's Reconciliation," The Way, January, 1975, 66-76. Review for Religious, Volume 37, 1978/1 Joyce, Sister F., "'Reconciliation and the Teacher," Today's Catholic Teacher. February, 1977, 14, Krol, J. Cardinal, "'Human Rights and Reconciliation," Dimension. Winter, 1974, 148-151. Lynch, J. A. "'Meditation On Reconciliation," Sisters Today, January, 1975, 273-280. Maly, Rev. Eugene H., "'Haggadah,'" The Bible Today. October, 1975, 484-489. Miffletori, Rev. Jack, "'Rites and Lefts of Reconciliation," Folk Mass and Modern Liturgy. January, ~975, 23-26. Mossi, Rev. John P. S.J. "'A Reconciliation Service," Folk Mass and Modern Liturgy, January, 1975, 28-29. "Reconciliation Sevices For Children," Folk Mass and Modern Liturgy. August?September, 1975.25-26, North, Robert, S.J., "Yore Kippur and the Jubilee Year of Reconciliation," Theology Digest, Winter, 1974, 346-59. Notebaart, Rev. James, "'Symbols of Reconciliation." Folk Mass and Modern Liturgy, Janu-ary, 1975, 6-8. Paul VI, "'The Duty of Reconciliation," L'Osservatore Romano. April 18, 1974, I I. __, "Essential Characters of the Holy Year, Central Theme Is Reconciliation." L'Os-servatore Romano. May 17, 1973, 3. __. "'Human Rights and Reconciliation: Statement of Pope Paul VI and the Fathers of the 1974 Synod of Bishops," The Pope Speaks. Winter, 1974, 216-220. __, "'Peace Depends On You, Too," The Pope Speaks. Winter, 1974, 352-354. __, "'Reconciliation With God," L'Osservatore Romano. November 8, 1973, I. __. "'Renewal and Reconciliation," L'Osservatore Romano. June 14, 1973, I. Purdy. William, "'Holy Year and Reconciliation." L'Osservatore Romano. July 26, 1973, 10. Russell, John F., O.Carm., "'Reconciliation a Reflective Expression," Spiritual Lift,. Summer, 1977, 67-72. Saulnier, Rev. William P., "'Reconciliation: Let It Begin With Me," Modern Litargy. February. 1977, 8-10. Schaeffler, Sister Janet, "'Reconciliation Is Growth." The Catechist. November, 1975, 10-11. Schall, James, V., S.J., "'On the Mosl Dangerous Virtue." REVIEW FOR REI,I~OUS, November, 1974, 1301-1308. Seelaus, Vilma, "'Contemplation/Reconciliation/Inner Freedom," Spiritual Life, Summer, 1974.99-105. Senior, Donald, C.P., "'Resurrection and Reconciliation," The Catechist. Winter, 1974, 346-360. Seromik, Gary, "'The Holy Year: Renewal and Reconciliation." The New Covenant, January, 1975, 6-7. Stuhlmueller, Rev. Carroll, C.P., "'Reconciliation With the Old Testament," The Bible Today, October, 1975, 473-484. Wenz, Jack. O.F.M., "'The Cost of Reconciliation: An Interview With Anthony Padovano," St. Anthony Messenger, December, 1974, 14-19. Winiarski, M. "'Reconciliation Assailed, Upheld," National Catholic Reporter, May 13, 1977, 12. Bird With a Broken Wing: Christian Mysticism and Ministry Mar~ Ellen Dougherty, S.S.N.D. Sister Mary Ellen is director of novices for the eastern province of her community, in an interprovincial novitiate in Hinsdale. For this purpose, she is on temporary leave of absence from Notre Dame College in Baltimore where she is associate professor of English. Her present address: 427 S. Clay St.; Hinsdale, IL 60521. In his book A Third Testament, Malcolm Muggeridge says of the con-troversial personality William Blake that he was "sane to the point of sublimity." Blake, considered by some of his contemporaries to be mad and by others to be a mystic, was an early Romhntic English poet and visual artist who reported ea~;y dialogues with the spirits of Socrates, Milton, and Voltaire. At the same time he had the simplicity to urge his readers: To see the Word in a Grain of Sand ¯ And Heaven in a Wild Flower Hold Infinity in the palm of your hand And Etei:nity in an hour. Indicating Blake's creativity and originality, Muggeridge narrates the following incident: On another occasion, he told a visitor he had a great rarity to show him. This turned out to be "a naked figure with a strong body and a short neck--with burning eyes which long for moisture, and a face worthy of a murderer, holding a bloody cup in its clawed, hands, out of which it ~seems ea~ger to drink." "But what is it?" his visitor asked. "It is a ghost, sir," Blake replied. "The ghost of a flea~a spiritualization the thing!" Whether Blake was mystical or mad (o.r both), debates about him do suggest some of the standard tensions about mysticism. In current society, 37 31~ / Review for Religious, Volume 37, 1978/1 sanity is one thing, sublimity another. Fleas do not have ghosts. As a result of lived history and the statements of Vatican II to religious, monastic traditions in most apostolic orders have diminished. There has been, concommitantly, an increasing emphasis on service. Many religious orders, at one time known for a single apostolic commitment, now embrace multiple commitments. Dress, daily orders, life-styles are frequently and often wisely subordinated to apostolates. There is a fresh and creative view of the needs of the Church. Ministry is a command. Any simple analysis of apostolic theology would indeed be simplistic. The practical effects are complex, and their reverberations are not totally without irony. For example, while contemplatives sometimes struggle to justify their existence to themselves, members of apostolic orders con-sistently apply for transfer to the cloister. Contemplative groups experi-ment with appropriate ways to expand a ministerial dimension, while apos-tolic religious seek credible ways to circumscribe activity with prayer. In this, there is more than just an intimation of the traditional contempla-tion- action dilemma. There are implicit questions about the authenticity of mysticism in this apostolic age. We return again to fleas and ghosts. Recently in the Chicago Tribune a cartoon entitled "The Now Society" featured a young man and woman seated casually at a cafe table. She is saying to him, "Oh sure, I've felt funny a couple of times, but I can't honestly say I've had a mystical experience." In popular concept, mysti-cism is often characterized by a withdrawal from reality. It is connected with everything from marijuana to sunsets. Even among serious thinkers, it is somewhat suspect as a way of prayer for a Christian, especially for apostolic religious. I have met more than one competent spiritual director who will not encourage directees of apostolic orders to contemplative prayer, even when they are so inclined, on the grounds that it is generally incompatible with their responsibilities. This, it seems to me, is a mis-understanding of contemplative prayer. In his book The Still Point William Johnston, S.J., speaks of Christian mysticism. He says: ¯ . . in the long process which precedes the canonization of a Christian saint, the Church never asks about the profundity of his enlightenment or the depths of his mysticism, but only about his practice of heroic charity; traditionally, mysticism is valued only as a means to something more imporlant--namely, the charity which is the center of the gospel message. When this charity expresses itself in mystical experience (that is, when the love of God becomes so violent that it drives the soul down into its very center in mystical darkness and existential abandonment of thought), then it is inestimably precious. On the other hand, he says, "Granted this . everyone must recognize that deep contemplative prayer is indeed a way (and perhaps the best way) to Christian charity . " The purpose of this article is not to describe the contemplative ex-perience that Father Johnston speaks of. There are numerous experts, Bird With a Broken Wing including Father Johnston, who do this well, namely Thomas Merton, and Evelyn Underhill, as well as more traditional writers like Tanqueray and Poulain, and, of course, saints like Theresa of Avila and John of the Cross. The purpose here is to suggest some of the practical effects of Christian mystical prayer, whether it is occurring in the life of a contemplative or an apostolic religious, to show that it is a way to the active "charity which is the center of the gospel message," to indicate that sanity and sublimity can coexist. Here, then, references to mysticism are meant to apply to the Christian tradition, not to other forms of mystical prayer. Mystical prayer as a way to ministry is verified if we look at the lives of those whose mysticism is judged by history and the Church to be authentic. If we focus not so much on their experiences in prayer as on the fruits of their experiences (their practices of heroic charity), we will see that they are concerned not with looking or sounding like mystics, or even with being mystics, but with acting out of their experiences, in accord with some call to service. St. Theresa of Avila, for example, steadily confirms this. As she grew in mystical graces, she grew in active service to the Church, and to her Order. One has only to read the works of St. Theresa to see that she is an assertive, energetic woman. Throughout her writings she integrates steadily emotional response with idea and daily experience. Unlike her companion mystic, St~ John of the Cross, whose prose is as austere as his message, and whose poetry is charged quietly with passion (and who, in his own life, apparently integrated the two), Theresa is never a writer of academic prose, or a poet. She is a narrator of the spiritual life whose warmth and intelli-gence fuse into an explication of mystical experience that is as loosely personal as it is loosely objective. She says in her autobiography ". sometimes love makes me foolish." In her prose we read of the pain, the joy, the humor of this foolish lover. We read, too, the history of mystical prayer as Theresa knew it, as well as the history of an active woman who believes firmly, as she tells us in the Interior Castle, that "what the Lord desires is works." Theresa's mission was to reform. And so she did. Theresa took the Carmelite habit at the Convent of the Incarnation in Avila at the age of twenty-one. It was approximately twenty years later that she experienced her first visions and locutions (after, as she tells us, going for the first fourteen years as a religious unable to pray without a book). In her early forties, then, she experiences mystical graces with some regu-larity. It is interesting to note that it is at this same time that she first engages in discussion about the reform of her order. It is at the age of forty-seven that she establishes the daring (and some might say devious) foundation of the convent of St. Joseph in Avila, a beginning that was to launch significant reform in religious life in the Church. At the age of fifty she completes the final version of her autobiography (written, as most of her works were, under obedience), and she begins The Way of Perfection. Both of these 40 / Review for Religious, Volume 37, 1978/1 works, especially the second, reflect a woman of deep contemplative prayer, and the recipient of significant, mystical graces. 'They lack, how-ever, the clarity and totality about the mystical life that is evidenced in The Interior Castle. It would seem fair to assume that between the composition of The Way of'Perfection and The Interior Castle Theresa's own experi-ences in prayer matured and expanded, so that clarity and totality were possible. The latter work is a portrait of a mystic Who has experiential knowledge ofeverything from the prayer of quiet to. the spiritual marriage, and who is thus able to order her observations in readable fashion. It is in this~work that she tells us, quite practically, that."perfection consists not in consolations but in the increase of love," and that "love exists not in the extent~of our .happiness but in the firmness of our determination to try to please God." It is here thb.t she. reminds us that "God's will is that no bounds should be set to his works." Theresa, herself, during these years, set no bounds. It was at this time, the interim betwee.n, these written works, that the bulk Of her endeavors for. reform occurs. In The Interior Castle Theresa says, '.'When I think of myself, ! feel like a bird with a broken wing . " Nevertheless, before her death at the age of sixty seven, this bird with the broken wing was responsible for the foundation of more than a dozen Reform convents; she served several terms .as prioress; she acted unofficially as spiritual director for many priests and sisters (for women in those days the role had to be unofficial); she was the author of several solid volumes on the spiritual life. And she was a mystic. One could do a similar, profile of St. John of the Cross, to the same effect. He died at the age of forty-nine, after a full life as a 6ontemplative. A prolific and profound writer, he is better known as mystic than he is as theologian, reformer, spiritual director and confessor, administrator. And yet it was these tasks that consumed his energies, that accounted for his imprisonment, poor health, and untimely death. An"accomplished poet ,whose lyrics reveal the mysterious rhythm of his spirit, he was also a writer 6f practical pros~e. He was capable of mystical poetry that was ap-propriately elusive and at the same time concrete: When the breeze blew from the turret Parting his hair He wounded my neck, With his gentle hand . He was also the author of stark precepts: "Endeavor to be inclined always not to the easiest, but to the most difficult; not to the most .delightful, but to the harshest; not to the most gratifying, but to the less pleasan,t; . desire to enter into complete nudity, emptiness, and poverty" . .I.n poetry and precept, he, too, knew that what the Lord desires is works. ¯ St. Ignatius of Loyola, another man of action~ demonstrated, too, the compatibility between mysticism and ministry. Unlike the Carmelites Bird With a Broken Wing / 111 Theresa and John whose actions seemed to flow from their mysticism, Ignatius' mystical experience, it seems to me, emerged from his action. In all three of these saints, there was, nevertheless, a mutuality between prayer and service. On a more contemporary scene we have Thomas Mer-ton who~e last years, and last books, suggest, too, a proportionate growth between contemplation and outward reach. The point seems evident. An authentic mystical experience does not begin and end in itself, nor does it begin and end in self and God. While a genuine encounter of this sort will, as St. Theresa tells us in the sixth mansion of The Interior Castle, create an ambivalence (on the one hand, the soul seeks much solitude; on the other "it would like to plunge right into the heart of the world . ") the final option is usually for service. In the seventh mansion, the ultimate of the mystical life, St. Theresa says of mystics, '~They have now ari unusually strong desire to serve Him . So what they desire.now is not merely not to die [the "delectable pain" of the sixth mansion was accompanied by a desire for death, and thus union] but to live for a great many years and to suffer the severest trials, if by so doing they can become the means whereby the Lord is praised." To "become the means" is perhaps what Christian mysticism is all about. Itis what prayer is all about. Whatever methods God chooses to use in cultivating us as his ~means is not the issue. Whether our prayer is like the songs of Blake on his deathbed ("They're not mine, you know. They're not-mine,''~ he said, implying, again, a current of mystical grace), or whether our prayer is the solid, structured meditation of prelude and point does not matter. Whether we are contemplatives seeking to clarify our service, or apostolic religious trying t.o deepen our action by prayer, perhaps does ri'ot matter either. It seems as erroneoog to say that all mysticism is an evasion of reality as.it is to say that we are all c~alled to be. mystics. Service is no more a contradiction in the life of a Christian mystic than mysticism is in ¯ the life Of an apo.stolic religious. History defies such.myths. It seems clear that while Christian mysticism ~s alw_ays characterized by service, Christian service need not be rooted in mysticism. It seems, clear, too, then, that the most practical of us in. the Church today have nothing to fear from an increase of Christian mysticism. That would mean, in effect, a fear of an ¯ increase of charity. In the contemporary drama "The Belle 6f Amherst," Julie Harris re-cords sensitively the insight of another poet, Emily Dickinson (no less eccentric than Blake)as she listens intently to a.warbler on a bush. Emily asks, "Why are y~ou singing, when there is no one here to listen?" The. warbler replies, "I was born to sing." With this, Ern, ily is affirmed as a poet. Watching the bird in flight, she says, "I, too, was born to sing.'" And so it is with each of us, whether we sing (or pray) as warbler or poet. Ministry in the Church and a Structural Concern for Justice Francis X. Meehan Father Meehan is Associate Professor of Moral Theology at St. Charles Borromeo Seminary; Overbrook; Philadelphia, PA 19151. Much has been written recently about theologies of social concern. This article is not an effort to review those theologies. Rather it aims simply to point out some very mainstream considerations on social justice as it per-tains to the Church. Its original context was an ecumenical gathering of Church leaders, and this revision attempts to keep a focus on those social insights that are by now practically consensus teaching. In any consideration of the Church and social justice one must start by citing both the clear problem and the challenge. The problem surely is that we have not been as outstanding as we should have been. Barbara Ward in a booklet written for the Vatican Commission Justice and Peace speaks of guests who are invited to the banquet but have other things to do. She then touches upon the key problem for Christians in developed societies; namely, the problem of not being exposed in any concrete way to massive poverty and of therefore not developing a prophetic voice. She says: In this general climate of indifference, the Christian does not yet stand out as prophet or catalyst. All too many of us aresimply relatively fortunate citizens who., are not exposed to the massive, growing miseries at the base of the world society. We are proving, if proof were needed, that it is very difficult for wealthy societies, like families or individuals, to get through the eye of the needle (The Angry Seventies, p. 61). 42 Ministry in the Church and a Structural Concern for Justice The Challenge Barbara Ward as an economist devoted to human life has given an example of single-mindedness. Throughout her wril~ing she remains hope-ful. She knows well the challenge yet she sees no reason why the Christian community cannot be a worldwide "catalyst of energy, devotion and re-form." She articulates the challenge in a way that sets the focus of this paper: ¯ . . if, then, with courage and persistence and the energy of true hope, Christian citizens are ready in season and out of season, to lobby legislators, rally voters, instruct fellow citizens, worry the indifferent, encourage the active and create a new kind of justice and world responsibility in the Church and in the nations, the world may be saved from the evident wrath to come (pp. 62-63). Notice she asks for a new kind of justice and world responsibility in the Church. Thus she speaks not merely of giving food to a hungry man, but of "lobbying legislators" and "rallying voters." If we take a look at official Church teachings over a long range, we can see in this past one hundred .years one broad and obvious evolution. It is a movement that is very well summarized in that key article of the Pastoral Constitution: The Church in the Modern World, that underscored social concern: Profound and rapid changes make it l~articularly urgent that no one, ignoring the trend of events or drugged by laziness, content himself with a merely individualistic mo-rality. It grows increasingly true that the obligations of justice and love are fulfilled only if each person . . . promotes and assists the public and private institutions dedicated to bettering the conditions of human life (n. 30). It is fitting that such words should be in a document concerned with the Church's relation with the world. For here, too, there is an evolution of awareness. The Church's moral concern gradually becomes, in the social documents of the last century, not only a concern over individual salvation, but also over the collec.tive future. She recognizes that certain structures of history are man-made and that Christians therefore must have a respon-sibility not only for individual men, but also for structures of history. The Church must not be worldly, but she is in the world and has a responsibility for the world. Perhaps such an evolution could be understood by pointing to one man's autobiography as a metaphor. I think the life of Thomas Merton capsulizes a whole movement of the Church. This journey of the Church is symbolized so very aptly by Merton's monastic journey. It has often struck me that his own evolution as a monk said something to us about a model of holiness in the Church of our day. A recent thesis by Sister Elena Maltis makes this point more systematically.~ She cites Merton writing, in his early work, Waters of Siloe: ~"Thomas Merton: Symbol and Synthesis of Contemporary Catholicism." Critic, Spring, 1977, pp. 26 ff. 44 / Review for Religious, Volume 37, 1978/1 It [monastic life] takes a man above the terrors and sorrows of modern life as well as above its passing satisfactions. It elevates life to a superhuman level to the peace of the spiritual stratosphere where the storms of human existence become a distant echo and do not disturb the center of the soul--no matter how much they may rage in the senses and the feelings (p. 28). Then she cites the later MertOn who, in his workFaith and Violence, writes with different images of the monastic life: My :own peculiar task in my Church and in my world has been that of the solitary explorer who [instead of jumping on all the latest bandwagons.at once] is bound to search the existential depths of faith in its silences, its ambiguities, and in those certainties which lie deeper than the bottom of anxiety. It is a. kind of submarine life in which faith sometimes mysteriously takes on the aspect of doubt.when, in fact, one has to doubt and reject conventional and superstitious surrogates that have taken the place of faith. (p. 30). Notice holy Mertonno longer conceives of himself as above and beyond the world. He is not in a stratosphere above the terrors and sorrows of modern life, but now, at the bottom of things where the phrase "submarine life" becomes a dominant image. His very spirituality of the 1940's does not cease, but in the 1960's it is a spirituality that takes integrally within itself the role of social criticism. He sums up who we are in the Church today when he says~: That I should have been born in 1915, that I should be the contemporary of Auschwitz; Hiroshima, Viet Nam and the Watts riots, are things about which 1 was not first consulted. Yet they are also events in which, whether I like it or not; I am deeply and personally involved (Contemplation in the World of Action, p. 145). What is central here is not only that a man's spiritual journey should lead him to the welfare of our fellow humans. Indeed this is true of all the saints. But what is central is that now such a spiritual journey leads also to a structural concern for others. Merton is implicated in the world's move-ment. He is, and we are, and the Church is, not only helping others socially in the world as a static theatre, but taking responsibility for the very move-ment of the world itself, for the very milieu of humankind. And the point of this article is that such an hwareness is now flowering in the Church and we ought not to miss it or take it for granted. Perhaps a concrete example will help us see more clearly. In 1830 a French pastor of good will may have courageously preached to factory owners that they must give their wo~kers a living wage. But what he could little understand was what Peter Berger and Thomas Luckman called the "social construc-tion of reality." In other wqrds, reali.ty had been constructed by humans themselves in such a way that ifa converted factory owner did pay a living wage, he would go out of business because of the competition. What was needed was--as we know today--a new construction of reality, namely some empowerment of the workingman through unionization. NotKze that such a new reality had to be created not only to allow workers to achieve . Ministry in the Church and a Structural Concern for Justice / 45 just wages, but also to allow an employer to pay a just wage while remaining competitive. Such an element of structural justice was recognized by Leo XIII when he said in Rerum Novarum that even though someone made an agreement, such an agreement (contract) could be invalid because of the unequal bar-gaining positions. In Leo's teaching we see the beginnings of an awareness in the Church of the meaning of a structural reality in morality. Justice is denied not only by the individually greedy man, but through the inheritance of circumstances embedded in social systems. Application to Ministry In the last eighty years such an insight has developed richly in Church teaching. John XXIII in Mater et Magistra and Paul VI in Populorum Progressio applied the teachings to inequalities inherent in relations with the Third World. There have even been some high points of pastoral ap-plication in the Church. For example it remains the glory of the American Church that she (unlike some of her European sister-Churches) did by and large keep faith with the immigrant workers in her midst. Yet while the insight is old enough to trace to even before Leo, it nevertheless remains a new insight in need of fresh application in many areas of social concern. Most of all it calls for fresh application in the Church's ministry. Ministry must concern itself not only over individual conversion, not only over healing hearts, but also over healing structures. Otherwise the healed heart will be unable to inscribe its fruit of justice on the world itself. In Reinhold Niebuhr's classic terms, "moral man" ~will remain powerless and ineffectual in an "immoral society." The word structure is not always an easy term to understand, It has many meanings in many contexts. A helpful articulation of a meaning sufficient for our purposes here is one given in the statement of the Appa-lachian Bishops. They speak of how the forces of corporate giants become perverted, and destructive growth patterns develop.The principle of ~'max-imization of profit" becomes an idolatrous power. Then they give a clear understanding of what an evil structure does: This power overwhelms the good intentions of noble people, it forces them to com-pete brutally with one another. It pushes people into "conspicuous consumption" and planned obsolescence. It delivers up control to a tiny minority whose values then shape our social structures. Then they point out how difficult it is for good individuals to change things when structures militate against change. We know that there are many sincere business people, zealous reporters, truthful teachers, honest law enforcement officers, dedicated public officials, hard working lawyers and legislators, who try to do a good job. But we know too that, the Way things are set up, it's hard for good people to do a good job. Review for Religious, Volume 37, 1978/1 Such an insight by the bishops into structural evil corresponds to con-temporary insights into scriptural understandings of the powers of evil. The simple phrase, ~'. the way things are set up, it's hard for good people to do a good job," is a perfect way to describe what theologians today mean by "'the situation of sin." So the power of evil becomes autonomous and embeds itself into structures. These structures entrap us. They tend not to draw good from us but to draw out our worst--sometimes despite good will to the contrary. We have what some see here as one perspective on the original-sin tradition in the Church. Obviously, then, the work of redemp-tion, in which Jesus has given his Body the Church a certain share, must include a healing of this history of sin. Thus the very baptismal function of induction into a saving community implies a ministerial work to heal struc-tures. The Domain of Gospel Ministry and Arthur Simon's Parable The foregoing ushers into focus a problem, namely, how can work for structures remain a gospel work and not merely become a social-secular work. Arthur Simon, the founder and leader of Bread for the World, a Christian Citizens Movement for world food resources, tells a parable that helps us understand this problem of placing work for structures into min-istry. The parable is basically this: Once there was a farming town that could be reached by a narrow road with a bad curve in it. There were frequent accidents on the road especially at the curve, and the preacher would preach to the people of the town to make sure they were Good Samaritans. And so they were, as they would pick the people up on the road, for this was a religious work. One day someone, suggested they buy an ambulance to get the accident victims to the town hospital more quickly. The preacher preached and the people gave, for this was a religious work. Then one day a councilman suggested that the town authorize building a wider road and taking out the dangerous curve. Now it happened that the mayor had a farm market right at the curve on the ~oad and he was quite against taking out the curve. Someone asked the preacher to say a word to the mayor and the congregation next Sunday about it. But the preacher and most of the people figured they had better stay out of politics; so next Sunday the preacher preached on the Good Samaritan Gospel and en-couraged the people to continue their fine work of picking up the accident victims. The parable illustrates what Paul Ricoeur says about man's new aware-ness, namely an awareness of being in relationship with others in structured ways, i.e. not merely as "neighbor" but as socius. Father Chenu, the French Dominican, calls it the.new way of charity. He says that man has always been social, but he adds: Today, not accidentally but structurally the collective event lends scope and intensity to the social dimension--human love treads these lasting paths, these organizations Ministry in the Church and a Structural Concern for Justice / 47 of distributive justice, and these administrative systems (in G. Cottier et al., eds., Eglise et pauvret~, 1965, p. 174). The problem then is very real. When is ministry for life religious and gospel, and when does it become secular? What work for life is natural and what is supernatural? What is gospel and what is humanism? The questions are age-old. And without presuming that the Church today has completely solved the problem, I do think a good part of the answer is already within the Church's official grasp and official teaching. In official meetings and synods, papal and episcopal teachings have addressed the problem and have given us enough of a theological answer to go on. Let us just cite chosen, illustrative texts from the Catholic context. First, the Constitution on the Church in the Modern World has many comments on the subject. But one celebrated sentence is as follows: While we are warned that it profits a man nothing if he gain the whole world and lose himself, the expectation of a new ean.h must not weaken but rather stimulate our concern for cultivating this one . Earthly progress must be carefully distinguished from the growth of Christ's kingdom. Nevertheless, to the extent that the former can contribute to the better ordering of human society, it is of vital concern to the kingdom of God (n. 39). The World Synod of Bishops of 1971 and 1974 both dealt with the problem. The famous statement of 1971 said this: Action on behalf of justice and participation in the transformation of the world fully appear to us as a constitutive dimension of the preaching of the gospel, or, in other words, of the Church's mission for the redemption of the human race and its liberation from every oppressive situation. And in 1974 Pope Paul after citing the danger of losing the religious di-mension of our mission says this: There is no opposition or separation, therefore, but a complementary relationship between evangelization and human progress. While distinct and subordinate one to the other, each calls for the other by reason of their convergence towards the same end: the salvation of man. The continuity of the two Synods is sharply manifested in the Human Rights document of the '74 Synod. There the Bishops used a theology of the Divine Image and taught that the "integral development of persons" makes clearer in man the divine image. Then they say: Hence, she [the Church] believes firmly that the promotion of human rights is required by the gospel and is central to her ministry. Summarizing this brief set of quotes we can say that healing structures of irreverence for life and of injustice is part of the ministry of the Church because such healing is "of vital concern to the kingdom of God" (Gaudium et Spas), "a constitutive dimension of preaching the Gospel" (Synod '71), "required by the gospel arid central to the Church's ministry" (Synod '74). 41~ / Re~iew for Religious, Volume 37, 1978/1 Why take time to cite these examples of official documentation? First, awareness that such insights are now mainstream official teachings will keep us from being intimidated by those who would accuse us of humanism or of becoming social agencies. ' But more than that: it is to underscore that the concern for structural justice and the concern to place the struggle for structural justice within the mission of the Church is not merely a concern of a Daniel Berrigan, of a Helder Camara, or of a Latin American theologi~an, but rather it is official and central teaching within the Church. Most of all it is a matter of rejoicing that such an insight is found not only in official teaching, but is making its way into the popular religious psyche of our.people. At the Eucharistic Congress, when people struggled to touch Mother Theresa, they were struggling to touch, in this case, not someone known for mystic gifts such as Padre Pio, but someone known for simply picking men up offthe sti'eets of Calcutta. But more than that, the people also welcomed Dom Helder Camara. And those who knew his history, knew that his life has been a different struggle from that of Mother Theresa. Dom Helder symbolizes .not just an enormous interpersonal love for the weak, but also the struggle for justice against systems of dependence and exploitation. Dom Helder in the midst of his talk at the Philadelphia Civic Center walked over, picked up and embraced Mother Theresa. I like to think this embrace was more than a kinship of courageous people. Rather I see a symbol of two forms of ministries-in-the-Church meeting and embracing. And in a way, Dom Hel~ler's emphasis is a struggle that poses the most important challenge to Church leaders. His work is less clear, more risky, more apt to provoke misunderstanding even among one's own people, and yet all the more urgent today. The Problem of .Ambiguiiy Yet this ministry .that attempts to heal structures has a special problem connected with it. I would term it the problem of ambiguity. Many Church leaders can agree that gospel includes work for human life and human rights--even structural work. But they rightly fear choosing certain con-crete options that commit the Church to one economic or political view that may riot be the only valid Christian view. The point of Paul Ramsey'.s work Who Speaks for the Church? was to purify us of easy assumptions that the charism of leadership will lead us to right decisions in the complex area of socio-economic and political affairs. So there is a special need for a humility and tentativeness that, in the words of Paul VI, "will rid action of all inflexibility and sectarianism" (Coming Eightidth n. 48). We do not wish to preach our own ideology, but Christ crucified. So we seek to avoid easy partnership. This is a common caution perhaps needed today. But I would like to accent another side to the issue that sometimes Ministry in the Church and a Structural Concern for Justice goes unaccented. Namely, that not always what appears to be neutral ground is really neutral. And sometimes when the Church refi'ains from taking sides in an issue, for fear of partisanship, she sometimes, willy-nilly, by not taking a side has taken a side. Another way of saying it is simply that sometimes our silence speaks loudly. This may not be an everyday occa-sion, but it does happen that situations become radicalized to the point where there just is not ample neutral ground in which a large institution can find room. Historical examples may be easiest here. In the Germany of th~ 1930's was there a political neutral ground? Can we not at least in hindsight recognize that what looked like neutral ground was not so neutral? There was a personal heroism of many priests, ministers and bishops, yet in the episcopal statements of the German hierarchy (in the words of Gordon Zahn) there was "not even a hint of any question, of whether or not the Hitler war effort met the conditions set for a 'just war' " (cited in Paul Hanley Furfey, The Morality Gap, p. 13). Another example. In the bombings of Hamburg of July-August, 1943, the dead numbered 30,000. The raids on Dresden of February, 1945 killed some 135,000. On March 9 and 10 the raids over a four mile residential district of Tokyo are estimated to have killed 84,000. On August 6 and 9 the bombings of Hiroshima and Nagasaki killed an estimated 68,000 and 38,000 respectively. My point here is that the killing of noncombatants was even at that time, clearly recognized as evil. Yet one can find no significant corporate criticism of these actions. Moreover, despite Pius XlI's pleas to statesmen for a negotiated peace, no official Catholic spokesmen gave sustained'protest against the allied policy of unconditional surrender--an omission John Courtney Murray called a "classic example" of a failure to apply moral principles. ¯ A third example concerns racism and segregation in this country. It could be summed up in a symbol. The symbol is contained in the words of Leander Perez, political boss of Plaquemines Parish in New Orleans. He was, you may remember, the man excommunicated for his opposition to the integration of the parochial schools (a courageous act .ot~ Archbishop Rum-mel). But Perez' comment was "How come we could have slaves, separate schools and churches for these Negroes for ages and ages and now all of a sudden it's a sin?" (see Paul Hanley Furfey, The Morality Gap). The point in all of these questions is not historical Monday morning quarterbacking. Indeed even at the time of these incidents there were clear teachings already in the mainstream of Catholic thought--teachings that were not applied. The point is that the Church took stances that at the time m. ay have seemed to be stances of moderation or may have seemed to be prudent neutral ground. But now we know they were not, Rather they appear to have been examples of an immigrant Church so anxious to be " established that it became absorbed in the zeitgeist of the times, and so lost its prophetic voice. 50 / Review for Religious, Volume 37, 1978/1 The main point is this: we may be right in our anxiety that the Church not be pulled into partisan blocs, in our anxiety not to provoke undue division in the Church by too quickly identifying one social option as the gospel option. But we must be careful not to allow this anxiety to bring us to a silence that really is an unwitting speaking in behalf of the status quo. There is a corollary to this problem. It concerns the matter of com-petefice. Often times it is stated that the Church or a churchman cannot speak on an issue because it is so complex and specialized. Surely we must be careful of easy and abrupt position-taking in the complex areas of so-ciooeconomics and international politics. But the deeper question must always be asked. Namely why is it that at times we choose certain areas in which to be competent, to research care-fully and to locate manpower and resources and other areas in which we do not? We must always ask ourselves what might be our cultural and theo-logical biases that predispose us to give certain questions a priority. Too many good Germans said they could not protest because, after all, they really did not know enough. Dualisms That Lead to Neglect Sometimes a certain idea about ministry can lead a man of good will to neglect a certain gospel reverence for life. For example, I am sure that the chaplains of institutions in which recent press releases have exposed cruel treatment would be men of good will. But if they observed some of the same things newspaper reporters saw, and if they did not complain in any effec-tive way, we must ask how did they conceive their ministry? What kind of dualisms between soul and body, between spiritual and physical, between creation and redemption must have been going on in their understanding of ministry? Has speaking in behalf of ill-treated mental patients, ill-treated children, ill-treated elderly in profit:making nursing homes, ill-treated pris-oners, ill-treated h