Suchergebnisse

Issue 51.2 of the Review for Religious, March/April 1992. ; Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University, by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-535-3048. Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Correspondence about the "Canonical Counsel" department: Elizabeth McDonough OP ¯ 5001 Eastern Avenue ¯ P.O. Box 29260 ~,¥ashington, D.C. 20017. I}OSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Second-class postage paid at St. Louis, Missouri, and additional offices. SUBSCRIPTION RATES Single copy $5.00 includes surface mailing costs. One-year subscription $15.00 plus mailing costs. Two-year subscription $28.00 plus mailing costs. See inside back cover for subscription information and mailing costs. ©1992 Review for Religious for religious Editor Associate Editors Canonical Counsel Editor Assistant Editors Advisory Board David L. Fleming SJ Philip C. Fischer SJ Michael G. Harter sJ Elizabeth McDonough OP Jean Read Mary Ann Foppe David J. Hassel SJ Mary Margaret Johanning SSND Iris Ann Ledden SSND Se;in Sammon FMS Wendy Wright PhD Suzanne Zuercher OSB Christian Heritages and Contemporary Living MARCH / APRIL1992 ¯ VOLUMES1 ¯ NUMBER2 contents 166 182 191 2O6 217 229 236 ministry and ministries The Spiritual Exercises as a Foundation for Educational Ministry Walter J. Burghardt SJ reflects on the vision and values given to educational ministry when it is permeated by the spirituality of Ignatius Loyola's Spiritual Exercises. Going the Distance, Sustaining the Gift Melannie Svoboda SND suggests some concrete ways that people can joyfully exercise their ministry over the long haul. Newman's Living the Oratory Charism Halbert G. Weidner CO explains the Oratory foundation of Philip Neri in order to highlight values significant to John Henry Newman's life. theology and spirituality The Resurrection Kernel Dennis Billy CSSR outlines the basic principle of the doctrine of the resurrection in order to show its influence in our way of living. The Fragile Connection between Prayer and Suffering Matthias Neuman OSB speaks from his own experience of how human suffering affects our prayer. To Choose Jesus for My Heaven Donald Macdonald SMM finds Julian of Norwich's insights into the maternal love of Jesus expressed in the Blessed Sacrament. religious life and renewal Seeing in the Dark Janet Ruffing RSM finds light in John of the Cross's description of the Dark Night for understanding the current turmoil in reli-gious life. 162 Review for Religious 249 260 267 Memories of the Future Thomas McKenna CM shows how eschatology as a style of thinking provides understanding for the renewal efforts in reli-gious life. Integrating Postmodernity and Tradition Reid Perkins OP encourages the greater use of narratives in reli-gious life to connect us to the tradition and at the same time to help us overcome the obliviousness of postmodern life. Religious-Life Issues in a Time of Transition John A. Grindel CM and Sean Peters CSJ summarize the results of various studies of U.S. religious life funded by the Lilly Endowment and point to issues still to be dealt with. living religiously 276 Cultivating Uselessness Rose Hoover RC proposes that in the very experience of useless-ness and foolishness lies the gift of religious life to a pragmatic society. 282 Therapy for Religious: The Troublesome Triangle Joyce Harris OSC offers some suggestions for a collaborative rela-tionship among therapist, the individual religious, and the com-munity and its representative. 289 294 Prenovitiate: Theory and Practice Anthony Steel SSG believes a prenovitiate program can help meet the challenges of contemporary cultural attitudes toward religious life and outlines the plan for his community. report U.S. Hispanic Catholics: Trends and Works 1991 Kenneth Davis OFM Conv reviews the various events and writ-ings in the Catholic Hispanic experience. departments 164 Prisms 303 Canonical Counseh Hermits and Virgins 309 Book Reviews March-April 1992 163 prisms Teilhard de Chardin in The Divine Milieu observes that the larger half of our lives is made up of what happens to us. His observation comes home to us each year as we celebrate the great high holy days of Christianity-- Holy Thursday, Good Friday, Holy Saturday, and Easter Sunday. Paradoxically Jesus accomplishes the work of redemption, his life's purpose, in what happens to him in his suffering, death, and resurrection. We enter into this paradox by our celebration of these days. We cannot change history, we cannot undo what has happened. Our celebration allows us in our own time to enter into what happened to Jesus and to be with him, to stand alongside, to feel com-passion- as helplessly as we listen to someone tell of being tortured by a totalitarian regime or as we sit at the bedside of a dying loved one. No activity of ours changes the event; compassionate presence is the difficult but precious gift we can give. Of course it is also our privilege to share in some-one's joy and happiness, as we do when we celebrate the res-urrection victory of Jesus. Despite the fact that so many of us are spectator-sports people, whether in the stadium or in front of the TV set, we are not comfortable being spectators of an evil we can-not eliminate and sometimes even of a happiness which lit-tle touches our lives. We may find other people's parties empty of fun for ourselves, and we may dread visiting a neighbor in the hospital.We would rather not drive through derelict inner-city neighborhoods, we would brush past the homeless person sleeping over heating grates in our down-towns, or we would switch TV channels if the images of starving Sudanese children with distended stomachs are too graphic. The problems seem too large for our efforts to make a difference. Our activity and our emotions seem 164 Review for Religious frozen. Even though we are members of the Body of Christ, we often choose not to see and not to hear. When hostages return exuberantly to waiting families, when a comatose girl revives to the joy of her parents, when government agencies extend unemployment benefits for those hurting in a reces-sion economy, how often do we feel a thrill and utter a prayer of thanks to God? Too often we keep ourselves emotionally distant even from the joys of others around us, probably because they just "happen" and leave us personally unaffected. St. Paul could state, by analogy with our human bodies, that if one member suffers all the members suffer with it; if one member is honored, all the members share its joy. The Easter events challenge us always in what we do and in what happens to us. If God is truly the God of our life, then we find the opportunity of meeting God both in what we set out to do and in what happens to us. Jesus' crucifixion confronts the activist in each of us to question our judgment about our most valued "work." All of our dyings become not the entropy of exhaustive waste, but graced moments of freedom to embrace another givenness of life from our God of life. When St. Paul challenged death--"Where is your sting?"--he did not close his eyes to the evils and losses which all the forms of dying represent. He trumpeted the Easter message that the Christ-redemption event changes not only our attitude but also our ability to value the whole of our life--its successes and accomplishments, its apparent waste matter of sin and failure. As Gospel models, Mary Magdalene (who may have confused sex and love) and Peter (who has grabbed for success and lied for survival) are the first among the evangelizers of this new creation event. Pope John Paul's appeal for a new evangelization takes form in us by our renewed attempt to integrate the active and passive aspects of our daily life. By living faith-lives as "other Christs" we make a dif-ference in what we do and in what we suffer. The call to a new evan-gelization invites us to explore further the struggles of justice and poverty and human living both at our doorstep and in our larger world. Making a difference often seems like planting seeds and hav-ing to wait for things to happen. Easter faith stirs us up in hope, moves us out in action, and integrates us in a compassionate patience. This Easter may the risen Lord embrace us anew with the grace of his passion for life. David L. Fleming sJ March-April 1992 165 WALTER J. BURGHARDT The Spiritual Exercises as a Foundation for Educational Ministry ministry and ministries To speak of basing an educational ministry on the Spiritual Exercises is something of a paradox, an apparent contra-diction. Two things simply do not seem to fit. Are not the Spiritual Exercises of St. Ignatius Loyola an experience of the spirit, a thirty-day or eight-day retreat centered on the movement of the Christian soul to heaven, conducted in solitude, far from hustle and bustle, and preferably in silence? And is not a university or college a citadel of the intellect, where the stress is on knowledge, on books, where minds meet in constant conflict, where ideas clash, where noise is in the air, where silence is reserved for a corner of the library? I am not saying that the Spiritual Exercises and the groves of academe are interchangeable terms, that a col-lege or university is a retreat experience, that the class-room is a chapel, that learning is worship. My thesis is that the Spiritual Exercises can be, indeed should be, an exciting foundation for education Jesuit-style. More specif-ically, I see the Spiritual Exercises as a process of conver-sion which in an educational institution aims at altering in students, faculty, and staff (1) their world of learning, the Walter J. Burghardt SJ is director of the Woodstock Theo-logical Center Project Preaching the ffust Word. This article retains the flavor of its original oral presentation made at Creighton University in Omaha, Nebraska, in April 1991. Father Burghardt's address is Manresa-on-Severn; P.O. Box 9; Annapolis, Maryland 21404. 166 Review for Religious life of the mind; (2) their world of loving, their human and reli-gious imagination and affection; (3) their world of living, the life of social realities. Let me explain what I mean in each of these three cases. First, the Spiritual Exercises should alter your world of learn-ing, that is, the life of your mind. You see, basic to the life of the mind, at the root of a university's existence, is a momentous mono-syllable: Why? Why study art and the arts, physical science or political science, law or business or medicine? Now Ignatius does not ask that question in those terms. But "spiritual exercises" he defines as "every way of preparing and disposing" ourselves to remove "all disordered attachments and, after their removal, of seeking and finding God's will in the way we direct our lives.''1 And there definitely are disordered approaches to the life of the mind, strange reasons why some go to college or university or professional school. I am not thinking of the more superficial reasons--college as a four-year Hammer dance2 interrupted by class. I am thinking of an approach to business education guided by a powerful principle: what makes the world go round is economics, and what makes the economy work is greed, the almighty dollar. I am thinking of gifted music and drama students whose aim is fame, the lust for applause, even the TV laugh machine. I am thinking of political-science students whose primary purpose is political power, the thrill in manipulating other men and women. A heart-rending example in this area is Lee Atwater, the manager of George Bush's 1988 presidential campaign who almost single-handedly turned the tide against Dukakis. Not long before his death at forty from a brain tumor on 29 March, this gifted man~ with an incredible instinct for the jugular made this poignant confession: The '80s were about acquiring--acquiring wealth, power, prestige. I know, I acquired more wealth, power and pres-tige than most. But you can acquire all you want and still feel empty. It took a deadly illness to put me eye to eye with that truth, but it is a truth that the country, caught up in its ruthless ambitions and moral decay, can learn on my dime.3 Not that money, fame, power are immoral in themselves; they are not. Without money a university would have little to offer to anyone. Fame makes it easier for the deprived to know you, to beg for the crumbs that fall from your table. Political power makes March-April 1992 167 Burghardt ¯ The Exercises for Educational Ministry possible not only a Persian Gulf war but legislated housing for the poor. Ignatius forces on the retreatant that insistent mono-syllable: Why? Even more radically, the Spiritual Exercises can keep you from segregating learning into a pigeonhole of its own, divorced from the thrust of the spirit towards God. I do not mean that all of learning becomes a religious enterprise. Vatican II made that quite clear. With Vatican I, it distinguished "'two orders of knowl-edge' which are distinct," declared that "the Church does not indeed forbid that 'when the human arts and sciences are practiced they use their own principles and their proper method, each in its own domain.'" In consequence, the council "affirms the legiti-mate autonomy of human culture and especially of the sciences.''4 My point is, the life of the mind is perilously impoverished if knowledge does not lead to wonder. Not sheer questioning: I wonder if Israel should continue populating the West Bank. In the grasp of wonder I marvel: I am surprised, amazed, delighted, enraptured. It is MaW pregnant by God's Spirit: "My spirit finds delight in God my Savior" (Lk 1:47). It is Magdalen about to touch her risen Jesus: "Master!" (Jn 20:16). It is doubting Thomas discovering his God in the wounds of Jesus. It is Michelangelo striking his sculptured Moses: "Speak!" It is Alexander Fleming fascinated by the very first antibiotic, America thrilling to the first footsteps on the moon. It is Mother Teresa cradling a naked retarded child in the rubble of West Beirut, a crippled old man in the excrement of Calcutta. It is the wonder of a first kiss. Such, sooner or later, should be your reaction to the life of learning, such the wonder that should permeate the life of your mind. Not a new methodology for biology or psychology; simply awe in the presence of a fascinating four-letter reality: life. The multifaceted, myriad miracle of life. Amazement at what breadths and depths there are to being alive--from the architectural artistry of the ant and the grace of a loping panther, through the blind-ing speed of a white marlin and the majestic flight of the bald eagle, to the beating heart of a unique fetus, the inspired imagery of Shakespeare, the fantastic forty-eight measures of Tchaikovsky's "Nutcracker," the transforming insight of Einstein. With such wonder you may hope to touch the pinnacle of knowledge. For, as philosopher Jacques Maritain discovered, the height of human knowing is not conceptual; it is experiential. Man or woman feels God. Yes, feels" God. 168 Review for Religious Am I ignoring Ignatius? Have I been distracted from his Spiritual Exercises? Quite the contrary. The Spiritual Exercises are an adventure in experience, in wonder. With all the power of your mental faculties, you enter the kingdom of contemplation--what contemplative William McNamara called % long loving look at the real." The real: all there is--the things of God, the people of God, God's very self. And the high purpose of all this? To be struck, surprised, stunned by the wonder of it all--from the ecstasy of Eden unspoiled, through sin's rape of the earth and earth's dwellers, to the unique love of God-in-our-flesh pinned to a cross, and our rebirth in his rising from the rock. The net effect? Ignatius's final contemplation, the acme of the Exercises: Learning to Love Like God. Here you touch the heart of Ignatius, his awareness of the ceaseless presence of Christ to our earth--now. "Consider," he counsels, "how [Christ] labors for me in all creatures.''s Not a vague, ultrapious generality. Christ behaves like a worker, a laborer, in each and every creature of his creation. How is it that the Rockies still rise in breathtaking splendor, Venus shines brighter than any star, and oil gushes from the fields of Nebraska? Because a risen Christ gives them being. Not once for all; continuously, day after day. How is it that forsythia can herald the approach of spring, corn turn into hot buttered popcorn for your theater, giant red-woods stalk the California sky? Because an imaginative Christ gives them life. How is it that your Irish setter can smell the game beyond your ken, gulls scavenge your ocean, the shad ascend the waters? Because a sensitive Christ gives them senses. How is it that you, this wondrous wedding of molecules and spirit, can shape an idea or send a skyscraper soaring, unveil mystery in a microscope or telescope, join with another--man or woman or God--in deathless oneness? Because Christ labors in you to give you intelligence and love--intelligence that mimics the mind of God, love that stems from a cross on the outskirts of Jerusalem. A thing of beauty and a joy for ever, this life of the mind. But only if the arts and sciences, if professions like law and medicine and business, that legitimately engross you open you to the still richer reality that surrounds you, invades you, transcends you, gives fresh life to the mind you treasure so rightly, the mind you The life of the mind is perilously impoverished if knowledge does not lead to wonder. March-April 1992 169 Burghardt ¯ The Exercises for Educational Ministry accept so lightly. Ignatius's Spiritual Exercises are not the only "way to go." But for openers in two senses--a beginning and an opening--as a basis, a foundation, for the life of the mind, the Spiritual Exercises are an experience difficult to exceed. Second, the Spiritual Exercises should alter your world of loving, that is, your human and religious imagination and affec-tion. Basic to this affirmation is a realization: The life of the human spirit is not circumscribed by reason, by your ability to grasp ideas, to draw conclusions from facts and premises. If your intellectual existence is simply a model of Cartesian clarity, you are limping along on one leg. What is the lamentable lacuna? Imagination. What is this strange creature we call imagination?6 To begin with, what is imagination not? It is not the same thing as fantasy. Fantasy has come to mean the grotesque, the bizarre. That is fan-tastic which is unreal, irrational, wild, unrestrained. We speak of "pure fantasy": It has no connection with reality. It is imagination run wild, on the loose, unbridled, uncontained.7 What is it, then? Imagination is the capacity we have "to make the material an image of the immaterial or spiritual.''8 It is a cre-ative power. You find it in Rembrandt's self-portraits, in Beethoven's Fifth Symphony, in the odor of a new rose or the flavor of an old wine. You find it in dramatists like Aeschylus and Shakespeare, in poets from Sappho to Gerard Manley Hopkins, in storytellers like C.S. Lewis and Stephen King. Now, when I say "capacity," I do not mean a "faculty" like intellect or will. I mean rather a posture of my whole person towards my experience.9 It is a way of seeing. It is, as with Castaneda, looking for the holes in the world or listening to the space between sounds. It is a breaking through the obvious, the surface, the superficial, to the reality beneath and beyond. It is the world of wonder and intuition, of amazement and delight, of fes-tivity and play. How does imagination come to expression? Let me focus on specifically religious imagination. I sketch five ways. 1. A vision. I mean "the emergence either in dreams, trance, or ecstasy, of a pattern of images, words, or dreamlike dramas which are experienced then, and upon later reflection, as having revelatory significance." 10 Examples? Isaiah's vision of the Lord in the temple (Is 6); Moses and Elijah appearing to Jesus and the disciples on the Mount of Transfiguration (Mt 17:1-9); Joan of Arc's "voices"; St. Margaret Mary's vision of the Sacred Heart. 170 Review for Religious 2. Ritual. The form of ritual is action--public, dramatic, pat-terned. A group enacts the presence of the sacred and partici-pates in that presence, usually through some combination of dance, chant, sacrifice, or sacrament.11 3. Story. I mean a narrative, a constellation of images, that recounts incidents or events. As Sallie TeSelle put it, "We all love a good story because of the basic nar-rative quality of human experience: in a sense any story is about ourselves, and a good story is good precisely because somehow it rings true to human life . We recognize our pilgrimage from here to there in a good story.''12 For the religious imagina-tion, three types of stories are particularly impor-tant: parable, allegory, and myth; the parables of Jesus, Lewis's "Chronicles of Narnia," and the Creation myth.13 4. The fine arts. I mean painting and poetry, sculpture and architecture, music, dancing, and dra-matic art. I mean da Vinci and John Donne, the "PietY" and Chartres, Beethoven's "Missa Solemnis," David whirling and skipping before the Ark of the Covenant, the mystery dramas of the Middle Ages. I mean films. 5. Symbol. What symbol means is not easy to say, for even within theology it does not have a univocal sense. Let me define it, with Avery Dulles, as "an externally perceived sign that works mysteriously on the human consciousness so as to suggest more than it can clearly describe or define." 14 Not every sign is a sym-bol. A mere indicator ("This way to the art museum") is not a symbol. "The symbol is a sign pregnant with a depth of meaning which is evoked rather than explicitly stated.''is It might be an artifact, a person, an event, words, a story--parable, allegory, myth. The importance of symbols, of imagination, in a university? I make three points. First, imagination is not at odds with knowl-edge; imagination is a form of cognition. In Whitehead's words, "Imagination is not to be divorced from the facts; it is a way of illuminating the facts.''16 True, it is not a process of reasoning; it is not abstract thought, conceptual analysis, rational demonstra-tion, syllogistic proof. Notre Dame of Paris is not a thesis in the-ology; Lewis's famous trilogy does not demonstrate the origin of evil; Hopkins is not analyzing God's image in us when he sings Imagination is not at odds with knowledge; imagination is a form of cognition. Marcb-April 1992 171 Burghardt ¯ The Exercises for Educational Ministry that "Christ plays in ten thousand places, / Lovely in limbs, and lovely in eyes not his / To the Father through the features of men's faces.''17 And still, imaging and imagining is a work of our intellectual nature; through it our spirit reaches the true, the beautiful, and the good. Second, imagination does not so much teach as evoke; it calls something forth from you. And so it is often ambiguous; the image can be understood in different ways. Do you remember the reporters who asked Martha Graham, "Miss Graham, what does your dance mean?" She replied: "Darlings, if I could tell you, I would not have danced it!" Something is lost when we move from imagining to thinking, from art to conceptual clarity. Not that imagination is arbitrary, that "Swan Lake" or the Infancy Narrative or "Hamlet" or the Transfiguration is whatever anyone wants to make of it, my gut feeling. Hostile to a valid imagina-tion is "the cult of imagination for itself alone; vision, phantasy, ecstasy for their own sakes; creativity, spontaneity on their own, without roots, without tradition, without discipline.''1~ Amos Wilder was right: "Inebriation is no substitute for paideia.''19 And still it is true, the image is more open-ended than the con-cept, less confining, less imprisoning. The image evokes our own imagining. Third, religion itself is a system of symbols. As sociologist Andrew Greeley saw, "religion was symbol and story long before it became theology and philosophy and., the poetry of religion was not inferior to its prose but rather anterior to it and, in terms of the whole human person, in some ways superior to it.''2° Biblical revelation is highly symbolic. Skim the Hebrew Scriptures: a burning bush, the miracles of the Exodus, the theo-phanies of Sinai, the "still small voice" heard by Elijah, the visions of the prophets and seers. Scan the New Testament: the circum-stances surrounding Jesus' conception and birth, the descent of the Spirit in the form of a dove, the transfiguration, Calvary, the res-urrection. Take key themes like the kingdom of God, its expres-sion in Jesus' proverbial sayings, in the Lord's Prayer, in the Gospel parables. The kingdom is not a clear concept with a uni-vocal significance. It is a symbol that "can represent or evoke a whole range or series of conceptions or ideas.''21 Turn from Scripture to the Catholic-Protestant problematic. Greeley's research persuades him that "the fundamental differ-ences between Catholicism and Protestantism are not doctrinal or 172 Review for Religious ethical" but "differing sets of symbols.''22 Take the central symbol: God.23 The classical literature of the Catholic tradition assumes a God who is present in the world, disclosing Himself in and through creation. The world and all its events, objects, and people tend to be somewhat like God. The Protestant classics, on the other hand, assume a God who is radically absent from the world and who discloses Herself only on rare occasions (especially in Jesus Christ and Him cruci-fied). The world and all its events, objects, and people tend to be radically different from God.24 Even more concretely, Greeley insists, their different images of God account for different religious behavior between Catholics and Protestants. In the Protestant imagination God is perceived as distant (father, judge, king, master); in the Catholic imagination God is perceived as present (mother, lover, friend, spouse).2s Another crucial example: two approaches to human society shaped by different imaginative pictures. The Catholic tends to see society as a "sacrament" of God, a set of ordered relationships, governed by both justice and love, that reveal, however imperfectly, the presence of God. Society is "natural" and "good," therefore, for humans and their natural response to God is social. The Protestant, on the other hand, tends to see human society as "God-for-saken" and therefore unnatural and oppressive. The indi-vidual stands over against society and not integrated into it. The human becomes fully human only when he is able to break away from social oppression and relate to the absent God as a completely free individual.26 A final example from Greeley's sociological research: The image that most sharply distinguishes the Catholic tradition from other Christian traditions is Mary the mother of Jesus. No one else has Madonna statues in church. MaW is essen-tial to Catholicism, not perhaps on the level of doctrine but surely on the level of imagination, because she more than any other image blatantly confirms the sacramental instinct: the whole of creation and all its processes, especially its lifegiving and life-nurturing processes, reveal the lurking and passionate love of God.27 Once again, have I been distracted from Ignatius and his Spiritual Exercises? Not really. The Exercises, for all their appeal to the Christian intelligence, are not a head trip. They are first and foremost an experience. An experience of Catholic symbols: Adam and Eve and Eden, angels and Satan, hellfire, a virgin and a crib, March-April 1992 173 Burghardt ¯ The Exercises for Educational Ministry The events of Jesus" earthly existence must be seen as a 'today." Egypt and Jerusalem, the transfiguration, bread and wine, blood and water from the side of Christ, nail marks in risen hands, an ascension into heaven. But the experience is not cold reason. Take the experience of sin's devastating impact on angels and humans, sin's ravishing of God's good earth. When you go through the Spiritual Exercises, you do not simply define sin, recall a traditional definition: any thought, word, or action against God's law. Your senses get into the act: you smell sin's stench. Even more importantly, you see sin's cost, image it, weep over it; for sin's cost is a cross, the pierced hands of a God-man. The God-man. The Exercises are a constant contemplation--contemplation of Christ. Never abstract theology, though theology informs it all. In Bethlehem's cave you are a servant; you not only listen to Mary and Joseph, you "smell the infinite flagrance and taste the infinite sweetness of the divinity.''28 You flee with that unique family into Egypt, feel what it means to be a refugee in the Middle East. In a decisive meditation you not only contrast "two standards," two scenarios for orienting your life. The standards take flesh in two persons: in a Satan who inspires "horror and terror," who makes you lust for riches, for honor, for pride; and in a living Christ who attracts you to poverty, insults, and humil-ity.: 9 It is not only Jesus who is tempted in the wilderness; you wrestle with your personal devils, sweat through the temptations that jolted Jesus: Use your powers, your gifts, your possessions just for your own fantastic self, for the sweet smell of success. Like the sinful woman, you wash our Lord's feet with your tears, feel your sins forgiven because you too have "loved much" (Lk 7:47). And so into Christ's passion, which you no longer study with scholarly detachment, comparing different traditions, reconcil-ing inconsistencies. Ignatius wants you to feel: grief and shame indeed, "because the Lord is going to his suffering for [your] sins,''3° but even, if possible, the kiss that betrayed him, the nails that held him fast. And finally, joy in the risen Christ. Not sim-ply a sense of relief; rather your whole being bursting with new life, his life, as you share his rising with his Mother, try to touch him with Magdalen, munch seafood with him and the Eleven. This is not simply your own picture show, on a level with 174 Review for Religious Kevin Costner "Dancing with !/Volves.''31 Ignatius playing with your capacity to imagine is attempting something terribly signif-icant psychologically and spiritually. This "application of the senses" goes back to a medieval tradition that reached Ignatius through a book he read while convalescing from cannon wounds back at Loyola.32 The unknown Franciscan author had written: If you wish to draw profit from these meditations., make everything that the Lord Jesus said and did present to your-self, just as though you were hearing it with your ears and seeing it with your eyes . And even when it is related in the past tense you should contemplate it all as though pres-ent today. VChy is this highly significant for an intelligent spirituality? Because you are no longer looking at the life of Christ sheerly as history, something that took place in the past. The events of Jesus' earthly existence must be seen as a "today," the historical hap-penings drawn into your own world here and now. That is how you achieve not abstract knowledge but what the medievals called "familiarity with Christ," an understanding that takes hold not only of discursive reasoning but of the whole person. Imagination leads to love--a direct experience of love. Ignatius films in living color what Aquinas phrased in attractive abstraction: There are two ways of desiring knowledge. One way is to desire it as a perfection of one's self; and that is the way philosophers desire it. The other way is to desire it not [merely] as a perfection of one's self but because through this knowledge the one we love becomes present to us; and that is the way saints desire it.34 Third, the Spiritual Exercises should alter your world of liv-ing, that is, the life of social realities. Here three facets call for clarification: social realities, the Exercises, and you. What do I mean by social realities? I mean the life of a soci-ety, the life that moves beyond the individual in isolation to com-munity, people interacting, impacting one on another, human persons depending on one another. How do the Spiritual Exercises touch social realities? After all, did not Ignatius himself describe the Exercises as "every way of preparing and disposing" ourselves to remove "all disordered attachments and, after their removal, of seeking and finding God's will in the way we direct our lives"?3s This sounds rather indi-vidualistic, does it not? Or, at best, quite vague. March-April 1992 175 Burghardt ¯ The Exercises for Educational Ministry I am aware that in 1975 the 32nd General Congregation of Jesuits declared, "The mission of the Society of Jesus today is the service of faith, of which the promotion of justice is an absolute requirement.''36 And it went on to assert a bit later: Every sector of our educational works should be subjected to constant review, so that they will not only continue to form young people and adults able and willing to build a more just social order, but do so ever more effectively. Especially should we help form our Christian students as "men [and women]-for-others" in a mature faith and in per-sonal attachment to Jesus Christ, persons whose lively faith impels them to seek and find Christ in the service of their fellow men [and women]. Thus we shall contribute to form-ing persons who will themselves multiply the work of world-wide education.-~7 But our specific question remains: Granted that our colleges should prepare women and men to construct a more just social order, how do the Spiritual Exercises lay a foundation for the social-justice component of Jesuit education? Almost a half century ago, a young Jesuit who had not yet taken his final vows in the Society was asked by his provincial to direct the annual eight-day retreat for the Jesuit theology stu-dents at Alma in California. In the course of the retreat, director Father George H. Dunne reflected on a number of social issues. Dealing with the Sermon on the Mount, for example, and the two great commandments, he "talked about poverty, peace, war, not in the abstract but in the concrete." He "talked about anti- Semitism, Hitler's holocaust, racial segregation, the rat-infested tenements in New York, the exploitation of migrant farm work-ers, the Spanish Civil War, the anguish of the world's poor . -38 Not long after, he received a letter from the representative of the Jesuit superior general for the American provinces during World War II. Father Zacheus J. Maher charged Father Dunne with substituting for the Spiritual Exercises a series of "brilliant talks on social subjects." "Such subjects," he declared, "have no place in the Spiritual Exercises.''> Let us make an admission: Our neighbor, the wider society, is not explicit in the text of the Exercises.4° Not surprising; for the Exercises "are addressed to individuals, and they seek to enable a person to have the interior freedom to serve God . -41 But if you delve more deeply, you discover how profoundly social, societal, the Exercises are. 176 Review for Religious You see, the Ignatian meditations point you ceaselessly to Christ, to the Christ of the Gospels, in that way to absorb the mind of Christ. And so you focus on the programmatic scene in Nazareth's synagogue, where Jesus makes his own the announce-ment in Isaiah: "The Spirit of the Lord is upon me, for he has anointed me. He has sent me to preach good news to the poor, to proclaim release for pris-oners and sight for the blind, to set at liberty those who are oppressed, and to proclaim the Lord's year of favor" (Lk 4:1 8-1 9).42 Through the Exercises that program ceases to be pecu-liarly Jesus'; it becomes your own. What Second Isaiah announced to the people of his day Jesus announces to the poor and impris-oned, the blind and deprived of his day. And this is what Christians in the mold of Ignatius announce to the downtrodden of their day. With Ignatius in the final Contemplation for Learning to Love Like God, you ponder profoundly how Christ "labors for [you] in all creatures on the face of the earth, that is, he behaves like one who labors. In the heav-ens, the elements, the plants, the fruits, the cattle, [man and woman], he gives being, conserves them in existence, confers life and sensation, and so on.''43 And you ask to labor with Christ as he ceaselessly creates, recreates, redeems a fallen world. Last Easter a Catholic professor of history ended his regular column in a diocesan newspaper with two puzzling sentences: "When Jesus rose from the dead, he did not go about lecturing on the social problems of his day. Instead he manifested himself in glory to his disciples in a manner that empowered them to go forth as his courageous emissaries.''44 But neither did the risen Jesus go about celebrating the Eucharist and fingering his rosary. And what did he empower them to go forth to do? To baptize indeed; to preach what he preached. But did he not preach loving your sisters and brothers as Jesus loved you? Does such loving have nothing to do with war on the womb or war in the Middle East? Nothing to do with inhuman poverty or child abuse? Nothing to do with racism or the rape of the earth? What you should experience through the Exercises is that by God's design and initiative human existence is fundamentally social, societal:4s we are "we" before we are "I" and "thou." This By God's design and initiative human existence is fundamentally social, societal. March-April 1992 177 Burghardt ¯ The Exercises for Educational Ministry is central in Christian revelation and of primary importance for our contemporary culture of individualism, where we think first of self and then how we can join with others in community--as though community did not precede the individual genetically, psychically, socially, and spiritually.46 Even Catholic social teach-ing frequently fails to position this fact front and center, because it lays down as primary in its social ethics the "dignity of the human person, who is made to the image of God." From there the teaching argues to the God-invested rights of the individual which other individuals and institutions must respect. This misses the point of the Genesis story (on which it is often based) that the "Adam" who is given such dignity is not an individual but "the hmnan," our whole race in personification.47 How does all this touch us? Very simply, a university or col-lege ought to be not only the seedbed of learning and imagination; it should be the boot camp of our societal existence. The Jesuit educational ideal is not the intellectual mole who lives almost entirely underground, surfaces occasionally for fresh air and a Big Mac, burrows back down to the earthworms before people can distract him. No. A college is where young men and women who may one day profoundly influence America's way of life touch, some for the first time, the ruptures that sever us from our earth, from our sisters and brothers, from our very selves. Not simply in an antiseptic classroom, for all its high importance for under-standing. Even more importantly, experience of rupture: experi-ence not only of ecology but of an earth irreparably ravaged, not only abstract poverty but the stomach-bloated poor, not only the words "child abuse" but the vacant stare of the child abused, not only a book on racism but the hopelessness or hatred in human hearts. To yearn for such experience, I know no better introduc-tion than experiencing the Christ of the Spiritual Exercises, the conversion consequent on seeing Christ more clearly, loving him more dearly. Can you get a 4.0, be learned, a scholar, without such a con-version? Undoubtedly. Can you make megabucks in business or law, in medicine or government without such a conversion? Undoubtedly. Can you marry well, raise two and a half children, treat them to an Ivy school education without such a conversion? Undoubtedly. Can you be deliriously happy without such a con-version? Undoubtedly. Can you live an integrated human and Christian existence without such a conversion? I doubt it. 178 Review for Religious Notes i Spiritual Exercises 1; translation partially mine. 2 Reference to a type of dancing currently in high favor with the young and involving amazing hyperactivity. 3 Thomas B. Edsall, "GOP Battler Lee Atwater Dies at 40," Washington Post, 30 March 1991, 1 and 7. 4 Second Vatican Council, Pastoral Constitution on the Church in the Modern World, no. 59. s Spiritual Exercises 236. For Christ as the "creator and Lord" of this contemplation, see Hugo Rahner SJ, Ignatius the Theologian (New York: Herder and Herder, 1968 / San Francisco: Ignatius Press, 1991), p. 134. 6 Here I am drawing largely, but not entirely, on material in nay book Preaching: The Art and the Craft (New York/Mahwah: Paulist, 1987), pp. 19-25. 7 I am aware that fantasy does not have to mean the bizarre; I am speaking of a com~non current usage. The development was concisely expressed in l/Vebster's New International Dictionary of the English Language (2nd ed. unabridged; Springfield, Mass.: Merriam, 1958), p. 918: "From the conception of fantasy as the faculty of mentally reproducing sensible objects, the meaning appears to have developed into: first, false or delu-sive mental creation; and second, any senselike representation in the mind, equivalent to the less strict use of imagination and fancy. Later fan-tasy acquired, also, a somewhat distinctive usage, taking over the sense of whimsical, grotesque, or bizarre image making. This latter sense, however, did not attach itself to the variant phantasy, which is used for visionary or phantasmic imagination." See also Urban T. Hohnes III, Ministry and Imagination (New York: Seabury, 1976), pp. 100-103. ~ Holmes, ibid, pp. 97-98. Here Holmes is a&nittedly borrowing from Owen Barfield, Saving the Appearances: A Study in Idolatry (New York: Harcourt, Brace & World, n.d.). 9 See Holmes, ibid, p. 88. 10 Theodore W. Jennings Jr., Introduction to Theology: An Invitation to Reflection upon the Christian Mythos (Philadelphia: Fortress, 1976), p. 49. 1~ See ibid, p. 52. 12 Sallie M. TeSelle, cited by Holmes, Ministry and Imagination, p. 166, from the Journal of the American Academy of Religion 42 (1974): 635. ~3 Lest the reader be unduly disturbed, myth is not opposed to fact or to fancy. Its raw material tnay he fact or it may be fancy; in either case it intends "to narrate the fundamental structure of human being in the world. By the concreteness of its imagery, the universality of its intention, its narrative or stoW form, the myth evokes the identification and par-ticipation of those for whom it functions as revelatory" (Jennings, Introduction to Theology, pp. 51-52). ~4 Avery Dulles SJ, "The Symbolic Structure of Revelation," March-April 1992 179 Burghardt ¯ The Exercises for Educational Ministry Theological Studies 41 (1980): 55-56. Dulles studies the five dominant approaches to revelation: the propositional, historical, mystical, dialecti-cal, and symbolic--with greatest stress on the symbolic. He asks how in each theory revelation is mediated and what kind of truth it has. He con-cludes that in Christ the five aspects coalesce in a kind of unity, but insists that the first four are reconciled and held in unity through the symbolic facet. ~s Ibid, p. 56. 16 A. N. Whitehead, The Aims of Education and Other Essays (New York: Macmillan, 1929), p. 139. 17 Gerard Manley Hopkins, "As kingfishers catch fire. ," Poem 57 in W. H. Gardner and N.H. Mackenzie, eds., The Poems of Gerard Manley Hopkins (London: Oxford University, 1970), p. 90. ~ Amos Niven Wilder, Theopoetic: Theology and the Religious Imagination (Philadelphia: Fortress, 1976), p. 57. ~') Ibid, p. 67. ~,0 Andrew M. Greeley, The Catholic Myth: The Behavior and Beliefs of American Catholics (New York: Scribner's, 1990), p. 37. 21 Norman Perrin, Jesus and the Language of the Kingdom (Philadelphia: Fortress, 1976), p. 33. ~2 Greeley, The Catholic ~Vlyth, p. 44. 23 Here Greeley (p. 45) admits his dependence on David Tracy's The Analogical Imagination (New York: Crossroad, 1981). 24 Greeley, The C)ttholic Myth, p. 45. ~5 See ibid, p. 55. 26 Ibid, p. 45. Hcre, too, Greeley is indebted to David Tracy. Note Greeley's warning to his readers that the word "tend" is "used advisedly. Zero-sum relationships do not exist in the world of the preconscious" (ibid). -,7 Ibid, p. 253. See p. 254: "I argue., that the obvious functional role of Mary the mother of Jesus in the Catholic tradition is to reflect the mother love of God." For detailed presentation of the origins and func-tion of the Mary symbol, see Greeley's The Mary Myth (New York: Seabury, 1977). 2~ Spiritual Exercises 124; text from Louis J. Puhl sJ, The Spiritual Exercises of St. Ignatius (Chicago: Loyola University, 195 I), p. 55. 29 Spiritual Exercises 140, 146 (Puhl, pp. 60, 62). 30 Spiritual Exercises 193 (Puhl, p. 81). 31 A current fihn that made off with a number of Academy awards. 3~ The book was Meditationes vitae Christi, long attributed to St. Bonaventure but actually composed by an unknown Franciscan of the fourteenth century; see Rahner, Ignatius the Theologian (n. 5 above), pp. 192-193. Quoted from Rahner, ibid, p. 193. 180 Review for Religious 34 1 have not been able as yet to document this text. 3s Spiritual Exercises 1 ; translation partially mine. 36 Documents of the Thirty-second General Congregatio,z of the Society of Jesus, 2 December 1974--7 March 1975 I, 4 (Washington, D.C.: Jesuit Conference, [1975]), p. 17. 37 Ibid, I, 4, pp. 35-36. 38 King's Pawn: The Memoirs of George H. Dunue, s.J. (Chicago: Loyola University, 1990), p. 70. 39 Ibid, pp. 69, 70. q0 See useful material in Dean Brackley SJ, "Downward Mobility: Social Implications of St. Ignatius's Two Standards," Studies in the Spirituality of Jesuits 20, no. 4 (January 1988): 53; also in Thomas E. Clark SJ, "Ignatian Spirituality and Societal Consciousness," ibid, 7, no. 4 (September 1975): 127-150. 4~ Brackley, "Downward Mobility," p. 12. 42 On this episode see Joseph A. Fitzmyer SJ, The Gospel according to Luke (I-IX) (Garden City, N.Y.: Doubleday, 1981), p. 529: "Luke had deliberately put this story [4:16-30] at the beginning of the public min-istry to encapsulate the entire ministry of Jesus and the reaction to it." 43 Spiritual Exercises 236; translation partially mine. 44james Hitchcock in St. Louis Review, 29 March 1991, p. 11. 4s See Clarke (n. 40 above), pp. 128-129, for the advantages of the adjective "societal" over "social" in reference to apostolate and ministry. "Social" efforts "seek immediately and personally to alleviate the misery of those individuals who are deprived." "Societal" activity "concerns itself immediately with the healing and transformation of those human struc-tures, institutions, processes, and environments which draw persons into misery or make it difficult for them to emerge from it." 46 See Matthew Lamb, "The Social and Political Dimensions of Lonergan's Theology," in Vernon Gregson, ed., The Desires of the Human Heart (New York/Mahwah: Paulist, 1988), p. 270. 471 owe this paragraph to notes of James L. Connor sJ, director of the Woodstock Theological Center, Washington, D.C., prepared for the inau-gural retreat of my project Preaching the Just Word, an effort to move the preaching of social-justice issues more effectively into the Catholic pul-pits of the United States. March-April 1992 181 MELANNIE SVOBODA Going the Distance, Sustaining the Gift an one of her newspaper columns, Ellen Goodman describes pheno~nenon called "compassion fatigue." This occurs when people who are normally sensitive and generous get "tired of caring." Most Americans, Goodman maintains, are very caring in emergencies. She writes: "We are great at performing the one-night stands for causes. Christmas dinner for the poor, collec-tions for victims of fire or flood or famine." But if the emergency situation becomes chronic, many of us find it difficult to sustain our initial level of concern. When compassion fatigue sets in, says Goodman, "A gift can begin to feel like an obligation, generosity can turn into resentment, and sympathy can turn hard." I think Goodman's article has definite implications for those of us involved in ministry in the church. Let us face it: most of us are in ministry not for a one-night stand. We are in it for years, maybe even for life. The problems we deal with every day--igno-rance, poverty, injustice, sickness, violence--will not go away overnight--or even in a matter of a few years. So the question we have to ask ourselves is: How do we keep our compassion alive over the long haul? How do we fan the flame of enthusiasm for a lifetime of service in the church? Before I suggest some ways of doing this, I would like to say a few words about why. For everything I say is based on the premise Melannie Svoboda SND, with whom our readers are well acquainted, resides at Notre Dame Academy; Route One, Box 197; Middleburg, Virginia 22117. 182 Review for Religious that coinpassion and enthusiasm are essential for ministry in the church. Without them, ministry is at best a mere show and at worst a perversion of the very Gospel we claim to proclaim. To illustrate this fact, I tried to come up with an image of ministry as compassionate, generous, and enthusiastic--and not something performed out of a sense of obligation and even with resentment. The image I came up with may appear an unlikely one: feeding chickens! But let me explain. Feeding Chickens I was born and raised on a small goose farm in Willoughby Hills, Ohio. That rural "initial formation" continues to influence my outlook on life. On our farm we had hundreds of white Emden geese. It was my father and brothers who had the job of feeding them. But we also had a couple dozen chickens, and the task of feeding them usually fell to my mother, my sister, or me. Now what is the connection between feeding chickens and ministering in today's church? Simple. The way I see it, there are three essential elements to proper chicken feeding (and, I might add, to proper church ministry). First, there is the feed itself--the corn, the mash, whatever. The feed is the gift we bring to the chickens. More than that, it is their source of nourishment, of life itself. Without too much of a stretch of the imagination, we can say that the chicken feed is the "good news" we bring each day to our chickens. The second element of chicken feeding involves calling the chickens. We have to get their attention, alert them to the feed we have for them. But a good chicken feeder goes beyond merely calling the chickens. He or she establishes a relationship with them. The feeder talks to the chickens, even thanking them for the fine eggs they have been laying. For a good chicken feeder (like a good church minister) is always aware of being a receiver as well as a giver. The third element of chicken feeding (and of ministry) is the actual broadcasting of the feed. How does an experienced chicken feeder broadcast the feed? Eagerly, generously, unsparingly. Now that is an image of ministry at its best, ministry with compassion and enthusiasm. Ministry at its worst would be the person who sets out to feed the chickens grumbling and mum-bling the whole way to the chicken coop. "I have got to feed those March-April 1992 183 Svoboda ¯ Going the Distance stupid chickens--again. I just fed them yesterday. They're never satisfied. All they do is eat, eat, eat. What good are they, any-way?" Such a feeder might not even call the chickens, thinking: "If I don't call them, maybe they won't come, and then I won't have to feed them." But, of course, the chickens do come, called or uncalled. And how does this kind of feeder broadcast the feed? Perhaps sparingly: "A kernel for you, a kernel for you . " Or angrily, throwing handfuls of feed down on the ground in dis-gust. Or hastily, dumping the whole pail of feed in one spot, just to get the job over with. That is an image of ministry when compassion fatigue has set in. I maintain that ministering in such a way is a contradiction of the Gospel. For we are called to proclaim the good news, not the "ho-hum" news, not the "halfway decent" news. We are called to love the people to whom we minister, not "put up with" them or view them as a nuisance. If we can no longer minister with gen-uine compassion or with vibrant enthusiasm, then maybe we should not be ministering. Years ago I had a Scripture teacher who made this point very clear. He said that on a given day we might wake up crabby, dis-couraged, depressed, mad at the whole world and every human being in it. On such a morning, maybe we should call the office, the school, or the parish and say in all honesty and humility, "I won't be in. I cannot in conscience represent the Gospel today." The suggestion, though perhaps a little extreme, does make a salient point: an anti-sign to the Gospel is probably worse than no sign at all. In other words, if our words, attitude, and whole bear-ing contradict the Good News we represent, then maybe we should not be representing it. Compassion and enthusiasm are requisites for effective min-istry. What, then, are some ways we can "go the distance" and "sustain our gift" of ministering? There are, no doubt, many ways. Here, I suggest four. Retaining the Big Picture The first way is to retain the big picture. Sometimes we lose enthusiasm for our ministry because our perspective becomes too narrow, our vision myopic. We lose sight of the big picture and get enmeshed in the near at hand, the petty, the nitty-gritty. In his book The Art of Choosing, Carlos ~Galles SJ reminds us how impor- 184 Review for Reli~4ous rant it is in life to have a sense of direction. He describes "a lovely little habit" that Ignatius had of stopping himself physically in the middle of a hall and asking himself, "Where am I going? And what for?" That habit was one way Ignatius had of connecting a seemingly insignificant action--going to the dining room to eat, heading for chapel to pray, or walking down the hall to a meet-ing-- with the bigger picture of ministering to God's people. The practice is a good one: regularly and consciously to make ourselves see our daily small actions as part of a greater whole. Recently I watched an artist painting a large mural of a sunrise. I noticed how frequently she stepped back from her work to gain a broader perspective. Then she would step forward, add a few more strokes with the paint roller, and step back again for another look. We must do the same thing in our ministry. Sometimes God seems to provide us with opportunities to do this: after a suc-cessful activity, after an apparent failure, at the time of a transfer or change in ministry, or during a serious illness. But we can also do this more regularly: during an annual retreat or a monthly day of recollection, in the morning before we begin our day, or in the evening before we crawl (or fall) into bed. The habit of ask-ing "Where am I going (or where have I been today) and what for?" will put us in touch with the real zvhat and v:hatfor of our ministry, thus enabling us to catch at least a glimpse of how our "daily chores" fit into the big picture of God's grand design. Seeing Babies A second way of retaining our compassion and enthusiasm I call: seeing babies and not diapers. A priest told me once that a young mother came to him very discouraged and worn out. "I'm sick and tired of changing diapers," she cried. The priest thought for a moment and then gently suggested, "Next time don't change the diaper. Change the baby." He was not being "celibately sar-castic." He was pointing out to her a lesson in perspective. We have to see the tasks we do in relation to the individual human beings for whom we do them. During a retreat another priest told this true stoW. A teenage boy was seriously injured in a car accident. When the parish priest was notified, he immediately went to the hospital to see the boy. When the priest walked in, the boy said, "Father, if you've come here for God's sake, then for God's sake, get out! But if you have March-April 1992 185 Svoboda ¯ Going the Distance come here because you think I am worth it, then please stay." The priest stayed. Maybe for too long we overemphasized "All for the greater honor and glory of God." That phrase certainly encapsulates a marvelous truth, but, like most truths, even that one needs another truth to balance it. In our ministry we do not bypass the human beings we serve. We do not overlook them. We do not use them to win God's favor. We must remember, we minister not to parishes, schools, hospitals, or dioceses. We minister to individ-ual human beings--to Vera, Frank, Carlos, Heather--and each of them is worth it. Getting Support A third way we sustain our gift of ministry is: We get sup-port. The venerable tradition of rugged individualism that helped found this great nation will not "cut it" in ministry. The truth is, we cannot "go it alone." Fortunately, our contemporary times, with its emphasis on support groups, reminds us of this truth. I came to appreciate the importance of support groups when I became a flee-lance writer. Before that I had been a full-time high school teacher for many years. As a teacher I had a built-in support group: the other teachers on the faculty. But when I seri-ously began to write as part of my ministry, I suddenly felt terri-bly isolated and alone. It became difficult for me to sit in front of my typewriter (and later tny computer) for two or three hours a day and write, for I would recall working for hours on a piece only to have it fizzle into nothingness. Or I would send out arti-cles and stories enthusiastically only to have them lost, mutilated, or rejected. Finally I knew I needed support in my ministry--and more than the occasional acceptance letter offers. So I attended some writers' conferences and hooked up with a few other people who write for publication. I rely on these friends for the under-standing and encouragement that only a fellow writer can give. In his book The Four Loves, C.S. Lewis writes beautifully about the origin of a friendship. He says a friendship originates when two people, often engaged in a common task, disclose some-thing of their inner selves to each other. They turn to each other in amazement and say, "You, too?" We in church ministry need to experience that "you-too?-ness" with others who are engaged in the same or similar ministry. 186 Review for Religious Being More than a Minister A fourth way we can go the distance in our ministry is to be more than a minister. We probably all agree that we are more than we do, and that we are far more valuable than what we pro-duce. But an effective minister does more than give intellectual assent to that truth. He or she makes decisions based on it. He or she takes time to be more than a minister, knowing how pathetic it is if a minister's identity is restricted to a particular job or title. There is always a danger of turning even church work into an end in itself. Workaholism is alive and well in most business organizations and (we have to admit with sadness) also in our church. The problem is, workaholism, though a real addiction, looks a lot like dedication. If a minister in the church is addicted to alcohol or gambling or food or sex, chances are someone (or someones) sooner or later will intervene to help that person. But if a minister is addicted to work~staying up all hours of the night, never taking time for a break or vacation, never socializing with people in a nonwork setting--we sometimes let him or her go on. Or even worse, we praise that person, thus encouraging the addiction. In this regard, we should recall that the primary biblical image of heaven is not an office, not a school, not a parish. It is a party, a banquet. If all we do our whole life is work, work, work, chances are we are going to feel extremely out of place in heaven. We will not know what to do, how to let go, how to have fun. No, we ministers should learn how to be party people while we are still here on earth--even as we minister. We work hard, yes, knowing full well that our ministry cannot always be restricted to certain office hours. But we also know how to get away, how to enjoy people and have fun. The Cross, the Cost So far we have looked at four ways to help prevent compas-sion fatigue in our ministry. But there is one more word I wish to say about compassion fatigue: sometimes it is the cross we bear, the cost we pay. Our fatigue is not always a sign that we are doing something wrong. Sometimes it is a sign that we are doing some-thing right. Our periodic fatigue and occasional discouragement put us in touch with our limits. And experiencing our limits is vital to effective ministry. Otherwise we run the risk of living in March-April 1992 187 Svoboda ¯ Going the Distance illusion, of beginning to think that we are responsible for the good we do or that we are the "good news" we proclaim--and not Jesus. Our ministry, in order to be authentic, must cost us some-thing-- in time, in energy, in love. I am reminded of that seem-ingly insignificant incident in the story of David at the end of the second book of Samuel. David, nearing the end of his life, goes to a man named Araunah and asks to buy his threshing place in order to build an altar there for the Lord. Araunah tells David, "Take it, Your Majesty." And he offers to give several oxen, too, all free of charge. But David refuses to accept Araunah's gifts. He insists on paying for everything, saying, "I will not offer the Lord my God sacrifices that have cost me nothing." At times we all get weary in our ministry. Our fatigue, loneliness, or discouragement are part of the cost of our love and service of others, part of the sacrifice we make regularly to God for the privilege of serving in the church. The Ministry of Jesus How does all of this relate to the person of Jesus? How did he remain loving and alive throughout his ministry? First of all, Jesus had the big picture. He possessed an amazingly expansive view of reality. He looked at a crude fisherman and saw a great leader. He observed the birds in the air and comprehended God's provident care. He beheld a sinful woman and recognized her as a woman who loved much. Jesus was always ready to adjust his perspective, to align it ever more closely with that of the Father. Nowhere is that more clearly seen than in Gethsemane. Jesus' initial reaction to his impending crucifixion was "Please let this pass!" But by let-ting go of his limited perspective, he could say, "Your will be done"; in other words, "I embrace your point of view." Jesus saw babies and not diapers. That is, he focused on indi-vidual people and not on the immense task he had to perform. The Gospels show Jesus speaking to large crowds, of course, but more often they show him relating to individuals: the twelve apos-tles, the man with a withered hand, a centurion, a demoniac, Simon's mother-in-law, a particular deaf man, a grieving widow, an epileptic, Jairus, Nicodemus, Mary and Martha, and so forth. The clear impression is that Jesus ministered to individuals. Even more important, individuals were his legacy. Jesus did not leave 188 Review for Relig4ous behind a spiral notebook on how to run a church. He did not write a curriculum nor even one encyclical. Instead, he left behind people--individuals--whose lives he touched and radically altered. Maybe we have to ask ourselves: How do we measure the effectiveness of our ministry? By the number of reports we fill out? By the neatness of our office? By the thick-ness of our files? Or by the individuals we have ministered to and with--and those we have allowed to minister to us? Jesus liked support groups. In fact, he even started one: the apostles. He also went outside that group for the kind of support that those dozen men could not give him. He seemed to need and appreciate the feminine encouragement of a Mary and a Martha, the unique devotion of a Mary Magdalene. The Gospels show Jesus enioying people. He was not always preaching or teaching or giving workshops. He was relaxing in the company of his friends and colleagues. Even in his darkest hour in Gethsemane, he did not "go it alone." He took part of his support group with him: Peter, James, and John. They disappointed him, yes, as people sometimes disappoint us, too. But Jesus understood their weakness and forgave them, knowing his ultimate support group was the Father and the Spirit. Lastly, Jesus was more than a minister, much more. Van Gogh supposedly said, "If you want to know God, love many things." One reason Jesus was so close to God was because he loved so many things, so many varied aspects of life. Jesus was perhaps a carpenter. What can we deduce from that simple fact? He had a "good eye," a highly developed aesthetic sense. He had a steady hand and knew and appreciated wood. Jesus was a storyteller, too, and a fine one. His "Good Samaritan" and "Prodigal Son" are masterpieces. 0nly a person in touch with the core of life could have spun such magnificent yarns. Jesus was well acquainted with other components of life: bread baking, barbecuing, wine making, and farming, to name but a few. He was keenly aware of the political situation of his times. He was in touch with the prejudices of his day as well as the hopes and dreams of his people. He was something of a naturalist, too, sen-sitive to the changing seasons and to the flora and fauna of his Our ministry, in order to be authentic, must cost us something.- in time, in energy, in love. March-April 1992 189 Svoboda ¯ Going the Distance immediate environment. Little wonder Jesus was so effective as a minister--for he was so much more than one. He was a person fascinated by life, and thus he became a source of fascination--and salvation--for others. Yes, Van Gogh said it: "If you want to know God, love many things." But Jesus lived it, leaving an example for all of us who would follow in his footsteps: "If you want to minister, love many things!" The Long-Distance Runner When I taught high school in Raleigh, North Carolina, in the late 70s, I had a senior girl who was a top-ranking long-dis-tance runner. Julie taught me that there is a world of difference between the sprinter and the long-distance runner. The training and techinques are vastly different. The sprinter's goal is near, often clearly visible. He or she relies on a quick burst of energy to reach that goal within a matter of seconds. Because the dis-tance is so short, the sprinter runs side by side, neck and neck, with other runners who provide an impetus for the sprinter to run hard and fast. Not so with the long-distance runner. This runner's goal is miles away, not even visible. He or she must take steps all along the way to conserve energy for the long haul. Pacing becoInes critical. Although the runners in a marathon start out together, toward the end of the race they often find themselves running alone and forced to rely on deep inner resources and not the near-ness of fellow runners to keep them going to the end. The image of the long-distance runner is an appropriate one for those of us engaged in ministry. For most of us are in ministry for the long haul. We do not want our loving service to deterio-rate into a stoic sense of duty, but to remain a joyful gift. We do not want resentment to contaminate our pool of selfless giving. Instead we want our generosity to be alive and well, our com-passion tender and strong. And we wish to carry our enthusiasm for the Good News all the way to the finish line. Thank God, we do not run alone: God, our God, goes with us--the whole distance. 190 Review for Religious HALBERT WEIDNER Newman's Living the Oratory Charism As the biographical approach to writers and thinkers pro-liferates, so does the controversy over its historical worth. I am taking a biographical approach to John Henry Newman with some trepidation because of the length of his life, his great contributions to thought, and the complexities of the issues. Still I am encouraged in the enterprise by Newman him-self, who insisted on the validity of personal influence in the pur-suit of truth) I intend in this essay first to introduce readers to the Oratory of St. Philip Neri, which Newman brought to England, and then to discuss the Oratory as important for understanding certain values in Newman's life. Newman arrived at these values and maintained them at some personal cost. That cost represents for this author, another Oratorian, the personal drama of grace and conversion of a founding father among English-speaking Oratories. The Nature of an Oratory of St. Philip Neri The first thing that should be said about an Oratory is what it is not. It is not a religious order. There are no vows, no oaths, no promises of any kind public or private. There is no Rule. You will see a Rule mentioned in the time of Newman, but actually what you have are constitutions representing the practice of the Roman house in the latter part of the sixteenth century.2 Philip Neri was a reluctant founder who refused to write a Rule or con-stitutions. Halbert Weidner CO sends these reflections from the Spiritual Life Center; 2717 Pamoa Road; Honolulu, Hawaii 96822. March-April 1992 191 This irregular founder lived from 1515 until 1595, coming to Rome as a young Florentine in 1533. He was not ordained until he was thirty-six years old. He had been a student, a hermit and mystic, and a member of a reforming confraternity which served sick pilgrims, that is, the poor who became ill while visit-ing Rome. He lived in a set of apartments with other priests as part of a complex named San Girolamo della Carit~. It was in a prayer room at this church that the crowd who could no longer fit into Philip's rooms began to gather daily at the siesta hour for prayer. It was this afternoon gathering of laity which was the first Oratory.3 Perhaps the best description of St. Philip's intent is given by Newman himself in The Idea of a University: He [Philip Neri] was raised up to do a work ahnost peculiar in the church--not to be a Jerome Savonarola, though Philip had a true devotion towards him and a tender mem-ory of his Florentine house; not to be a St. Charles, though in his beaming countenance Philip had recognized the aure-ole of a saint; not to be a St. Ignatius, wrestling with the foe, though Philip was termed the Society~ bell of call, so many subjects did he send to it; not to be a St. Francis Xavier, though Philip had longed to shed his blood for Christ in India with him; not to be a St. Caietan, or hunter of souls, for Philip preferred, as he expressed it, tranquilly to cast in his net to gain them; he preferred to yield to the stream, and direct the current, which he could not stop, of science, literature, art, and fashion, and to sweeten and to sanctify what God had made very good and man had spoilt.4 Those who gathered around Philip found a mystic, a reformer, and a humanist, but they did not find him in a cloister or in any religious order. They found him in his rooms with the doors wide open to the public and surrounded by laity. This is why the Oratory is first and foremost secular. It was this laity that formed the original gathering for prayer in a place of prayer (that is, an oratory) and these same laypersons who preached, led prayers, sang in the vernacular, and studied together each afternoon under Philip's guidance. The Congregation of the Oratory is a secondary group of secular priests and laity which gathered around Philip as the Oratory became less of a movement and more of an institu-tion. But before this, Philip carried on the ministry of prayer and reflection from 1551 until 1575, more or less activating the laity as the leaders. It was in 1575 that a secondary group of priests and brothers had gathered sufficiently to be formally organized 192 Review for Religious with papal approval. But this Congregation was without any con-stitutions and was still primarily organized for the initial group of laity,s Constitutions for the Congregation were not finished until 1612, seventeen years after Philip's death. Later the institution of the congregation became more clericalized as not only the pri-mary group of laity disappeared, but even the brothers were no longer accepted, leaving a congregation of secular priests who lived together in community. While the Oratory is unique within Roman Catholicism, its values represent a mind-set present among many reformers of the early sixteenth century. This reforming spirit is symbolized by the values St. Jerome came to represent within a church loaded down with religious orders heavy on structure and low in spirit. Erasmus had noted that, in the days of St. Jerome, "the profession of a monk consisted in no more than the practice of the original, free, purely Christian life.''6 The summary of Erasmus's thinking about the ideal religious given us in Eugene Rice's St. Jerome in the Renaissance could also be a description of the spirit animating the early Oratory of St. Philip: Monks then were men who wished only to live with willing friends in liberty of spirit close to the teachings of the Gospel. Their lives were sweetly leisured. No ceremonies or man-made regulations fettered them. No single dress was prescribed. No deference was paid to total abstinence. They studied, they fasted, and sang psalms as the spirit moved them. They took no vows.7 This being said, we can note some positive elements in the Congregation of the Oratory: A. It is a center of prayer by nature. The classical form that this prayer takes dates back to the more intimate group that gath-ered in the evening around Philip. This amounts to about a half hour of silent prayer or meditation concluded with vocal prayers. The two-hour prayer sessions led by and for the laity at the time of St. Philip have been the casualty of time. Likewise the primary group of laity called the Oratory has also passed away except for a remnant often called "the Little Oratory." This name is quite ironic since what has become "little" was in fact the biggest and the first of the founder's works, not to say the very reason behind it all. Except for a directive to somehow maintain the secular or "Little Oratory," the ministry of the Congregation is otherwise unspecified and unspecialized. Each house tends to the work at 21/larch-April992 193 The life of an Oratory is said to be built on a deep regard for "well-known faces.' hand, and assignments tend to reflect the talents of the members. Philip Neri was against centralization and so put on its own every house that wished to follow on his general pattern. He believed that duplication was impossible and that each situation called for its own approach. B. Face-to-face association is essential to the Oratory. In a phrase going back to the community's origins, the life of an Oratory is said to be built on a deep regard for "well-known faces.''8 There were no fears to be engendered in an Oratory over friendships, and such a pol-icy militated against large sizes and the anomaly of "communities" of religious who have to resort to books with mem-bers' pictures for help in identification. C. Relative permanence is an ideal even though there are no vows or any-thing else holding a person to an Oratory. Perseverance is a fundamental aspect of the house spirituality and is often prayed for aloud at community prayer. Note that members cannot be transferred from one house to another and that, if they leave a house to go voluntarily to another that has freely accepted them, they must usually transfer membership as well. This means that problems with and among members must be worked out within the house since, obviously, transference cannot be the solution. Dismissal from a house is a rare and difficult pro-cedure. D. Small numbers, then, are the consequence of Oratorian living. The Constitutions of the Congregation go so far as to say that the power of an Oratory resides in such a small membership. Large numbers would weaken a house, which is supposed to be built on interpersonal relationships. When Newman wrote The Present Position of Catholics in England, he was addressing the men of the secular or Little Oratory. Towards the end, he applies this Oratorian principle of strength despite small numbers when he tells them: Your strength lies in your God and your conscience; there-fore it lies not in your number. It lies not in your number any more than in intrigue, or combination, or worldly wisdom. God saves whether by many or by few; you are to aim at 194 Review for Religious showing forth His light, at diffusing "the sweet odor of His knowledge in every place": numbers would not secure this. On the contrary, the more you grew, the more you might be thrown back into yourselves, by the increased animosity and jealousy of your enemies. You are enabled in some mea-sure to mix with them while you are few; you might be thrown back upon yourselves, when you became many? The Oratory, then, exists to embody the ideal of koinonia, liv-ing together as a fruit of the Holy Spirit and a sign of God's rule. The Oratory is very conscious that only the Spirit can keep it together faithful to the charism and that a life of prayer and open-ness is the only way to persevere with any kind of fruitfulness. Community in this context is not a utility, but an end, the pres-ence of each person's final destiny in the communion of saints somehow present now. E. The Oratory is collegial to a unique degree. All major pol-icy decisions are made by the entire congregation of members who have finished six years. Personnel and financial decisions on a smaller scale are decided by a deputed congregation elected by the membership. The provost is the title of the "superior" who holds the office as first among equals. He is chiefly an adminis-trator and his authority rests in moral persuasion. His only clear power is that of proposal since neither the general congregation nor the smaller deputed congregation can discuss or vote on any-thing without this proposal. Since the provost serves only three years, any provost resisting the majority can only hold out for a certain time. E The Congregation of the Oratory is also juridically pon-tifical. Today each house is now part of a very loose confederation, but each is still a complete pontifical congregation. Each superior is a major superior. In Newman's time there was no confederation at all, and so each house was directly involved with the Roman Curia. This gives each small house a double relationship. They are rooted in their diocese and have a special relationship to the local church and the bishop on one hand, and yet on the other look to the Holy See for the preservation of the charism. We shall see how each of the elements of the Oratory Congregation played a role in the life of Newman. Newman and the Oratory I have chosen five aspects of Newman's life where I believe the March-April 1992 195 Oratorian charism was arrived at and purchased at some cost to him. These are: (1) the elasticity of the Oratory and Newman which was tested in his assumption of the rectorship of the Irish Catholic University, (2) the choice he had between a university apostolate and the Oratory during the Irish Catholic University founding, (3) the promotion of the laity in fields rightly theirs that had been co-opted by clericalism, (4) the resistance to foreign cultural aspects of Roman Catholicism in favor of an indigenous English religious life, (5) fidelity to community life in one place and one people. 1. The Elasticity of the Charism I have said that each Oratory has a great deal of elasticity to it as the congregation has no specific work to which its members are bound. This elasticity is from time to time tested within an individual Oratory, and Newman's assumption of the rectorship of a yet-to-be-founded university in Dublin was a very grave exper-iment in just how flexible an Oratory can be. But the flexibility had a true Oratorian origin. First, it was the result of consultation with both Birmingham and the not-yet-independent London house. Father Faber's letter indicates that the London community thought it good for the congregation that Newman assume the rectorship rather than anything less demand-ing, but less powerful.~° Secondly, it took a papal brief confirm-ing the arrangement before the attempt was made to do the impossible, that is, allow Newman to bilocate as provost in Birmingham and rector in Dublin.11 Thirdly, it was specifically for the purpose of starting a Dublin Oratory, and Newman's build-ing plans indicate he gave priority to the Oratory in that the uni-versity church built there was for the sake of a potential foundation.12 But Newman knew how precarious it was for an Oratorian to be away from his house. In a letter to Ambrose St. John he says, "I trust we shall have an Oratory in Dublin--which is the only thing I can bribe St. Philip with for coming here.''13 That it was a disaster emotionally for Newman and a serious drain on the Birmingham Oratory does not make it any less Oratorian for all that. Because of its lack of structure, it is typical of an Oratory to try to do too much rather than too little. It is easy enough to document other Oratories trying to stretch too thin. Thus we have the Oratory of Goa, India, sending Joseph Vaz to Sri Lanka at a time of persecution and in the clothing of a Hindu 196 Review for Religious holy man. There he labors with other Oratorians scattered around the countryside more like clerks regular than sons of St. Philip.14 My own Oratory in South Carolina had members scattered throughout the state during half of its history and only recently and with great difficulty has been able to return all of the mem-bers to a community life.Is During the time of St. Philip, the Oratory took on dependent missions for a while until St. Philip and the community abruptly called a halt to this development.Is So it is Oratorian to push the Oratory to the extreme and perhaps beyond. It is also Oratorian to eventually return to saner limits and the grace of a life closer to the original charism. 2. The Preference for Obscurity If Newman's acceptance of the rectorship pushed the Oratorian charism beyond limits, his fidelity to an Oratorian voca-tion is demonstrated by his resistance to a classic temptation against the life to which he believed God called him. The asceti-cism of the Oratory is a rigorous egalitarianism. Each member has one vote and all are equal and most aspects of the life are governed by the majority when not regulated by the constitu-tions. It was not uncommon among the best and brightest of St. Philip's followers to leave the Oratory, usually under papal "obe-dience," for higher positions in the church. That St. Philip him-self managed to escape or refuse such offers does not seem to be a grace extended to many of his followers. One of St. Philip's aphorisms was "love to be unknown,''17 but it is a hard saying. And it was a grace extended to Newman. Simply put, when presented with a full-time rectorship of the Irish university, Newman chose the small, obscure Oratory of Birmingham, England.I8 He was consistently resistant to any compromise on this point even though the choice seemed impenetrably obscure to both friends and foes. This disregard for the existence, rights, and potential of the Birmingham Oratory was one of Newman's great crosses. Newman complained, "Me they wish to use--me they wish to detach in every way from my own Fathers.''19 Separating an Oratorian from his community has not always been difficult, and there is evidence to indicate that some of these peo-ple thought they were doing Newman a favor by trying to detach him from the Oratory. Another fear of Newman's was the bad effect an absent provost would have on attracting new members to the Birmingham Oratory. This made the arrangement with the March-April 1992 197 university and Archbishop Cullen finally untenable.2° From inside the Oratory, the sacrifice of an outside position seems to be the heart of a vocation that embraces the asceticism of simply being one among many. 3. Maintaining the Preference for Laity The University episode also exemplifies another Oratorian principle, the importance of laicity to church and Oratory. As I have said, in the nineteenth century much of the lay character of the Oratory was atrophied. Only the little Oratory existed in some places and in some forms. Within some of the Congregations there were lay members or "brothers," for want of a better word, but as in most societies defined as congregations of priests, these brothers had no vote and seniority depended on holy orders first and seminary status second; only third came the brothers, who followed the youngest seminarians. But at a time when brothers in clerical communities of priests were treated as second-class members and even much like servants, Newman wrote to the act-ing superior of Birmingham the following directive: I am somewhat pained, my dear Edward, to hear you speak of us as 'Gentlemen--' We are not Gentlemen in con-tradistinction to the Brothers--they are Gentlemen too, by which 1 mean, not only a Catholic, but a polished refined Catholic. The Brothers are our equals . The Father is above the Brothers sacerdotally--but in the Oratory they are equal2~ This is indeed the spirit of St. Philip, whose esteem for the lay members of the congregation as well as of the religious orders was well known. But making this point about equality is still a struggle today within the congregations. In my opinion, if you ask many Oratorians what the Oratory is, they will simply say that it is a community of priests, without communicating at all the possibility of full lay membership and, since the Second Vatican Council, full voting rights. Newman's second contribution as an Oratorian to laicity was his emphasis on the secular Oratory or the Oratory as a lay move-ment. The revival of the secular or Little Oratory was "more important than anything else," at least in his own eyes. He real-ized that this was not a burning isst.e among the other Oratories, but he himself believed that, if the secular Oratory was not estab-lished, then the Congregation of the Oratory should be consid- 198 Review for Religious ered a faih~re.22 It was, as I said, for the secular Oratory that Newman wrote the lectures now called The Present Position of Catholics, and it is this volume I would call Newman's literary con-tribution to laicity. Perhaps Newman would agree with me, as he believed it in his old age to be his "best written book.''23 It is at any rate, in the opinion of Ian Ker, a popular, even Dickens-like piece of wit and rhetoric introducing the grander themes later developed in his explorations of the nature of a university.24 And, finally, it must be noted that for Newman laity meant men and women. Women had not been his-torically part of the secular Oratory, and so he petitioned Rome for a secular Oratory for women. Even though it did not develop, the rescript obtained estab-lished a new precedent.2s It was this regard for laity as essential to the religious enterprise of the Oratory that informs Newman's Idea of a University, where laicity is central to the educational enterprise. In my reckoning, this is his third contribution to laicity, but probably the best-known outside the Oratory. Newman believed that it was his struggle to appoint a lay vice-rector, to define the university as the province of the laity, and to develop self-moti-vated students with a minimum of authority which led to the ruin of the project.26 It was such "dreadful jealousy of the laity," Newman also believed, which led to the rejection of another planned Oratory at another university, this time no less than Oxford itself.27 Secularity and laicity, principles at the heart of the Oratory of St. Philip Neri, made it impossible for Newman to spread the congregation when both such principles were feared and rejected by church officials who felt the church to be under siege. That the ability to act and to be respectful of church author-ity were compatible seems to be exemplified in the life of the very independent personality Philip Neri. But, when Newman wished to prove the principle by anecdote, he very cleverly chose the most authoritarian of religious societies, the Jesuits, to make his point: "Nothing great or living can be done except when men are self governed and independent: this is quite consistent with a full maintenance of ecclesiastical supremacy. St. Francis Xavier wrote Regard for the laity as essential to the religious enterprise of the Oratory informs Newman's Idea of a University. March-April 1992 199 to St. Ignatius on his knees; but who will say that St. Francis was not a real center of action?''-'s 4. Preference for the Local Culture Around an Oratory Besides preserving laicity, Newman desired also to preserve English culture within the Roman Catholic Church. St. Philip Neri's emphasis on autonomous houses or congregations was rooted in his belief that each locale had its own culture and that the needs of the place had to be met through this culture. There could be nothing more contrary to the spirit of the Oratory than for any of the congregations to see themselves as the importers of foreign customs. The Italian devotionalism of such an Oratorian figure as the famous Father Frederick Faber of London was really a misguided attempt to re-create not only another culture but also another time. Ironically, the culture and time chosen by Faber was the Baroque era--when the Oratory was spreading through Europe, but a century later than Philip's own time and work. The extravagances of Faber and some other members of the London Oratory would not have been as effective as they were without the backing of the Dublin Review (seen to be the voice of London's Archbishop Manning)29 and W.G. Ward. When Newman had a chance to defend Roman Catholicism against some charges of his old Anglican friend E.B. Pusey, there was also the possibility of distancing that same Catholicism from the foreign enthusiasm of converts like Manning, Ward, and Faber. Newman could declare: "I prefer English habits of belief and devotion to foreign, from the same causes, and by the same right, which jus-tifies foreigners in preferring their own. In following those of my people, I show less singularity, and create less disturbance than if I made a flourish with what is novel and exotic.''3° "What is novel and exotic" to many English Catholics was for the London Oratory the true renewal of Catholicism and of the Congregation of the Oratory at the same time. Father Bernard Dalgairns left the Birmingham Oratory for the London house with a condemnation of Newman and his fellow members who had adopted a position paper which has been called an "Apologia pro vita sua--Oratoriana." 3~ Newman had insisted earlier that an Oratory is "the representative of no distant or foreign interest, but lives a~nong and is contented with its own people.''~-~ The con-troversy with Dalgairns assisted the Birmingham house in defin-ing itself against the London clai~n to be normative)3 200 Review for Religious Birmingham did not issue a counterclaim as the true measure of Oratorian life, but it did insist that its own very English adap-tation to education and culture in its own time and place was cer-tainly an authentic version of Oratorian life. The Idea of a University, with its marvelous panegyric of St. Philip Neri, is the public version of these private Oratory position papers which were worked on at the same time. In short, the Birmingham com-munity saw the idea of the Oratory and the idea of the university as complementary and consistent with each other. That authority within another Oratory, authority in the English Catholic hier-archy, and authority in Rome saw this as dangerous eventually prevented Newman from a university ministry and the founding of two Oratories, the one in Dublin, the other in Oxford. If he had not been thwarted--we can ask not only what effect this would have had on the Catholic Church's presence in higher education, but also what kind of model the Oratory would have become for that presence. ~. Fidelity to One Place and Community If Newman's devotion to the Oratory as a humanistic Christian community making the best of its own time and place cost him considerable loss of influence, it also explains why Newman was always hoisted between the limitations of the local hierarchy and Roman authority. As small as an Oratory usually is, it is nevertheless a community of pontifical right. But, because the members never move out of this small community, it is inti-mately involved in the local church and becomes specially related to the bishop. This arrangement was meant to allow the Oratory to serve both worlds best, but it also means that the Oratory is vulnerable to the worst of both. And it was the worst that Newman often had to suffer. Suffering at the hands of both local officials and Curial bureaucrats was the fate of the Oratory's founder, St. Philip Neri, but it took Newman some time to realize that such was his own unavoidable fate.34 In 1856 he could be sanguine about Roman love of an English house of St. Philip ("Be sure," he wrote, "that, if we are really doing work, Rome will never be hard on us, even if we are informal, imprudent, or arbitrary").35 By the 1860s he had suffered enough to be afraid of Rome calling him to the Curia for trial of his opinions and judgments. He was so afraid that he considered such a prospect as the threat of death.36 The March-April 1992 201 bishop of Birmingham was of no help in the face of Roman threats. Newinan wrote privately in 1867 that Ullathorne "wishes to be kind to me, but to stand well with people at Rome super-sedes in his mind every other wish. So he is a coward.''37 We can be considerably grateful that the insight into the abuses of church power led him to write in 1877 the great preface to the ¼"a Media in which he developed a theology of abuses in the church. He asks us to contemplate the implications of Matthew 13 and to choose the complexities and shortcomings of a world church rather than the narrow confines and perfection of a sect. That is, for the sake of Catholicity, we must realize that sanctity will not always be an equally prominent mark of the church.3s Conclusion The burden of this short paper has been to indicate some areas where Newman cannot be completely understood without a direct reference to the Oratory of St. Philip Neri. I would say several areas have been directly touched on. First, there is the mystery Why Birmingham? Why would such a talented person remain faithful to this city when he had been born in London and had adopted Oxford and its university? If living in Birmingham is of any consequence in understanding the mystery of Newman, then only the Oratory suffices for an explanation. Newman consciously rejected the London option because his absence from Birmingham would have been the death of a community wishing to live around him.39 And it is within the mystery of a providence that settled the Oratory in Birmingham that we have the mystery of Newman's fidelity to St. Philip, a fidelity which certainly shaped the field of Newman's activities which we have now inherited. Secondly, knowing the Oratory helps us understand how Newman was able to function as pastor and theologian. He had no official standing in a seminary or a university, and his membership in the Oratory cut him off from preferments in the diocese. Yet, despite the fragility of the Oratory and Newman's vulnerability to his enemies with real power bases, he was able to accomplish much. As a pastor he was perpetually available to a local people, and as a teacher he could, in the Congregation, exercise his tal-ents and find reinforcement of his values. Thirdly, the prophetic stands which he brought to the Roman 202 Review for Religious Catholic Church found a congenial place within the tradition of Philip Neri and the Oratory. Laicity, education, and culture were not feared in the Oratory, but promoted. Certainly the Oratory could accommodate the interests of such a person as Newman, and this I think says a lot for the Oratory. Finally, the Oratory provided an emotional complementarity for Newman. Newman had written that he had "never liked a large Oratory. Twelve working priests has been the limit of my ambition. One cannot love many at one time; one cannot really have many friends.''4° The rather intimate expression of this is found in the well-known conclusion to the Apologia, but I would beg an indulgence to cite a lesser-known example found in Meriol Trevor's Life. Late in life some parishioners brought Newman a portrait of himself as a gift to the Birmingham Oratory. Newman replied to them in these words: You ask for my blessing and I bless you with all my heart, as I desire to be blessed myself. Each one of us has his own individuality, his separate history, his antecedents and his future, his duties, his responsibilities, his solemn trial, and his eternity. May God's grace, His love, His peace rest on all of you, united as you are in the Oratory of St. Philip, on old and young, on confessors and penitents, on teachers and taught, on living and dead. Apart from that grace, that love, that peace, nothing is stable, all things have an end; but the earth will last its time, and while the earth lasts, Holy Church will last, and while the Church lasts, may the Oratory of Birmingham last also, amid the fortunes of many generations one and the same, faithful to St Philip, strong in the protection of our Lady and all Saints, not losing as time goes on its sympathy with its first fathers, whatever may be the burden and interests of its own day, as we in turn now stretch forth our hands with love and awe towards those, our unborn successors, whom on earth we shall never kFIow.41 From the Oratory of Birmingham, England, Newman gives a blessing because he believed his life as an Oratorian was itself a blessing. For this reason the Oratory might merit a considera-tion when we think of Newman and what it cost him to be a Catholic and what it was like for him to rejoice as an old man after a long time not only in the Catholic Church but in the Oratory of St. Philip Neri. March-April 1992 203 Notes ~ NewInan's classical exposition of this is found in University Sermons, vol. 5, pp. 75-98, and elucidated very well by Stephen Dessain in The Spirituality offfobn Henry Newman (Minneapolis, 1977), pp. 31-55. But see this theme repeated in an Oratorian context in Newman's Oratory Paper No. 6 in Placid Murray, Newman the Oratorian (Leominster, England, 1968), pp. 215-216. -' For the documentation of the constitutional development of the Congregation, see Antonius Cistellini CO, Collectanea Vetustorum ac Fundamentalium Documentorum Congregationis Oratorii Sancti Philippi Nerii (Brescia, 1982). ~ The more detailed history of this development can be found in Louis Ponnelle and Louis Border, St. Philip Neri and the Roman Society of His Times (London, 1932), pp. 166-173. 4 Idea, Discourse 9, no. 9. ~ Ponnelle and Bordet, pp. 287-381. 6 Erasmus, Ep. 164, in Opus epistolarum Des. Erasmii Roterodami, ed. P. S. Allen, H.M. Allen, and H.W. Garrod (Oxford, 1906-08), quoted in Eugene Rice Jr., Saint Jerome in the Renaissance (Baltimore, 1985), p. 133. 7 Rice, p. 133. 8 The 1969 Constitutions of the Congregation read in no. 15: "The Congregation follows the primitive Christian community that its char-acteristic power consists not in the multitude of its members, but rather in mutual knowledge--so that there may be a regard for the well-known faces--and in the true bond of love, by which those of the same family may be bound together through the practice of daily customs." See Newman the Oratorian, p. 329, for Newman's familiarity with the con-cept of well-known faces or countenances. ~ Prepos., p. 388. ~o Autobiographical Vt~ritings (AI/V), p. 281. 11AW, p. 286. ~2 Ian Ker, John Henry Newman (Oxford, 1988), p. 433. 13 Letters and Diaries (LD), vol. 14, p. 377. ~4 See S.G. Perera SJ, Life of the Venerable Father Joseph Uaz, Apostle of Ceylon (Galle, 1953). Newman indicates a long-standing knowledge of this special case in a letter written in 1867. ~s There is no history written of this first of the Oratories in the United States, and the archives of the house are very sketchy. There is no written rationale of the house for the scattering of the members, but some effort was made to rotate them back to Rock Hill if they were some distance away. There is an article describing the Rock Hill house written by Edward YVahl, one of the earlier members, in Oratorium, Ann. III, S.I-N. 1, Ian-Iun. 1972, pp. 23-32. ~' Ponnelle and Bordet, pp. 471-474. 204 Review for Religious 17 E A. Agnelli, The Excellencies of the Congregation of the Oratory of St. Philip Neri (Venice, 1825), translated and abridged by F.A. Antrobus, London 1881, chapter 1, section V. is LD, vol. 18, pp. 478,483. 19 LD, vol. 17, p. 447. '-OLD, vol. 18, pp. 114-115. z1 LD, vol. 16, p. 267. 22 LD, vol. 14, p. 274. ,~3 LD, vol. 26, p. 115. 24 Ker, pp. 365-372. 25 LD, vol. 17, p. 137. See Newman the Oratorian, p. 311, for his appre-ciation of the Oratory and women. 26 A~17~ p. 327. 27 LD, vol. 21, p. 327. 28LD, vol. 21, p. 331. ~'9 Ker, p. 579. 3o DiffT, ii, pp. 20-21. 31 Placid Murphy calls these papers another apologia (Newman the Oratoria~l, p. 299). -~'~ Newman the Oratorian, p. 196. 33 Newman the Oratorian, p. 358. 34 The 1848 paper in Newman the Oratorian lists the persecutions Philip suffered (see p. 163). In 1862 he can compare his troubles to the founder's (see AW, pp. 256-257). 35 LD, vol. 17, p. 151. 36 LD, vol. 20, pp. 445-448. ~7 LD, vol. 23, p. 296. 38 See R. Bergeron, LesAbus de L'~glise d'apr& Newman (Paris, 1971), and the annotated edition of Newman's ~a Media (Oxford, 1990), ed. H.D. Weidner. 39 LD, vol. 13, pp. 51-52. 40 Newman the Oratorian. p. 387. 4~ Meriol Trevor, Newman, Light in I:Vinter (New York, 1962), p. 582. March-April 1992 205 DENNIS J. BILLY The Resurrection Kernel theology and spirituality Is there a fundamental principle of the resurrection? The answer to this question depends on the way in which one understands the relationship of history to the reality of the risen Christ. This relationship, in turn, depends on the stance one takes towards the possibility of a transhistorical event and the type of impact it would have on the continuities and discontinuities of historical change. However understood, the impact itself would have vast ramifications for the whole of theology. Resurrection: Distinguishing Idea from Reality At the outset, it may be helpful to distinguish between resurrection (1) as a particular item in the history of ideas and (2) as the reality experienced among the earliest fol-lowers of Christ. The former may be separated from the viewpoint of faith, compared with other ideas about the nature of the afterlife, and evaluated on a rational basis for its various strengths and weaknesses as a viable expla-nation of the nature of life after death. As a transhistori-cal event with historical consequences, the latter is intricately bound to the faith of the primitive Christian community and cannot be studied in such a detached, ana- Dennis J. Billy CSSR continues his reflections on various cen-tral tenets of our faith and their relationship to the vowed life of religious. His address is Accademia Alfonsiana; Via Merulana, 31; C.P. 2458; 00100 Rome, Italy. 206 Review for Religious lyrical manner. Any effort to formulate a fundamental principle of the resurrection must be careful to take both sides of this dis-tinction into account. The Idea of Resurrection. A well-grounded discussion of an idea should begin with an attempt to identify its most distinctive char-acteristics. With respect to its general mean-ing, one could accurately describe the term "resurrection" as a belief common among Christians that, at some point after death, an individual is transformed by the power of the Divinity on every level of his or her anthro-pological makeup--the corporeal, the psy-chological, the spiritual, and the social--and thus raised to a higher level of human exis-tence in a way that always remains in funda-mental continuity with his or her historical, earthly life. The most distinctive marks in this short yet exact account of the idea of resurrection include: (1) personal life after death, (2) in a The idea of resurrection alone safeguards the inviolate dignity of each human being on every level of existence. transformed state, (3) embracing all the anthropological factors of human existence, and (4) in a way continuous with an individual's concrete, earthly life. Each of these elements is essential to the idea of resurrection as it is used in this essay and as it exists in the major Christian traditions. These characteristics also set the idea of resurrection apart from the related idea of bodily resuscitation (for example, the raising of Lazarus, Jn 11:44), as well as from the other major philosophical and religious explanations of the nature of life in the hereafter (for example, the immortality of the soul, reincar-nation, nirvana). When these are compared, the idea of resur-rection distinguishes itselfi (1) from bodily resuscitation, in its emphasis on a transformed existence in life after death; (2) from the immortality of the soul, in its inclusion of all of humanity's anthropological factors in the nature of that existence; (3) from reincarnation, in its rupture of the cycle of time and its insistence on the fundamental continuity of life in the hereafter with a per-son's earthly existence; and (4) from nirvana, in its avowal that final beatitude does not involve the extinction of individual con-sciousness. The greatest strength of the idea of resurrection is March-April 1992 207 that, of all of the ideas about the nature of life after death, it alone safeguards the inviolate dignity of each human being on every level of his or her existence. That is to say that it alone keeps human nature eternally intact while, at the same time, saving the individual from ultimate personal extinction. Its greatest weak-ness is that, in representing the fulfillment of one of the deepest and most profound hopes of the human heart, it seems almost too good to be true, an attractive but highly unlikely possibility. For this reason, of all the ideas of life in the hereafter, resurrec-tion is the one most difficult to accept on the simple basis of faith. The Reality of the Resurrection. Rooted in the hopes of Jewish apoc-alypticism during the centuries just prior to the appearance of Christ, and promulgated during Jesus' own lifetime by the reli-gious elite known as the Pharisees, the idea of resurrection devel-oped to its present form as a result of theological reflection on the nature of the Christ event, most especially in the primitive Christian community's interpretation of the meaning of the apos-tolic experience of the risen Lord. This reflection is intimately tied to the trust that community placed in the validity of the apos-tolic witness and to the experience of faith upon which it rested. It is also the context within which one may speak of the resur-rection not as an idea, but as a reality and a hope. \Vhat precisely happened on the first Easter morning remains shrouded by the subjective awareness of the earliest followers of Jesus. That awareness probably ran the gamut of several emo-tional states--from depression and fear, to suspicion and isola-tion, to incipient faith and the lingering yearning for the retrieval of lost expectations--and most likely varied in each of the persons involved. That is not to say that the event had no basis outside the experience of Jesus' followers, but only that there is no way to determine what it is with any accuracy. It is for this reason that, down through the centuries, the Easter event remains primarily an experience of faith in the lives of Jesus' followers. A distinction must still be made, however, between the faith of those who witnessed the Easter event personally and those whose faith relies on the testimony of the apostles. The procla-mation of the church rests upon the eyewitness accounts of the apostles, that is, on those who made the startling claim to have experienced for themselves the reality of the risen Lord. Their experience of faith remains qualitatively different from that of 208 Review for Religious the believer in the pew, for they claim to have experienced a real-ity outside of themselves, rooted in the objective order, distinct from their own subjectivity, and identified with the person of their Master, Jesus of Nazareth. Without the unprecedented bold-ness and resiliency of these claims, the Christian project would have nothing distinctive in its message and probably would never have gotten off the ground. These apostolic claims emerge from one of two possibilities: the experience of the risen Christ was with or without a basis in the person of Jesus in the external order. That is to say that the experience of the apostles corresponds to a reality outside of themselves or remains entirely subjective in all respects. If the former is true, then the further question must be asked regarding the nature of this basis in the external order. If the latter be true, then the only conclusion to be drawn is that the apostles suffered from self-delusion, that their testimony is false, as is the religion to which it gave rise. The fact that neither of these possibilities can be proven highlights the underlying quality of faith inherent in the conclusions of both the believer and non-believer alike. Still more can be said about the position of the believer. If the apostolic experience of the risen Christ does have an external basis in the person of Jesus, then this affirmation, when combined with the idea of resurrection developed earlier in this essay, nec-essarily points to an event of singular historical significance. Indeed, this event could be measured by the instruments of his-torical observation only by its effects (for example, a missing body) and, for this reason, must be placed in a category unique to itself and understood as a transhistorical event with historical conse-quences. This is so precisely because the risen Christ, existing in a transformed state but in a way continuous with his earthly life, does not lead "a historical existence" in the way in which the phrase is commonly used. That is to say that space and time no longer set the limits for his physical existence. In his resurrected state, Christ is the Alpha and the Omega, a singular dimension unique unto himself, who recapitulates, both now and forever, all The Easter event remains primarily an experience of faith in the lives of lesus" followers. March-April 1992 209 of creation within himself, into the love of the Father and the joy of their Spirit. The Resurrection Kernel From all that has been said, a sound formulation of the fun-damental principle of the resurrection (the resurrection kernel) would consist in the affirmation of faith that the idea of resur-rection has become a reality in the risen Christ. This reality is rooted in the transhistorical nature of the Christ event, whose historical consequences linger even to this day in the ongoing proclamation of the church. Based on the testimony of its apos-tolic forebears, the church has, in its ministry down through the centuries, kept alive for humanity the fervent hope that the deep-est yearnings of the human heart will one day be fully realized. That is to say that the transformation wrought by God in Christ promises to extend itself to all who are incorporated into his body, the church. In this respect, a sharing in the life of the risen Lord may be looked upon as the ultimate destiny of all of humankind and will be impeded only by a stubborn individual or corporate persistence in the life of sin. Given the above formulation, a number of important obser-vations arise: (1) To affirm that an idea has become a reality is to utilize the well-known philosophical distinction between the internal (that is, subjective) and external (that is, objective) orders. The limitations of this distinction are well known, and care must be taken not to stretch the analogy beyond its avowed usefulness. Indeed, special care must be taken not to project the concerns of the so-called critical problem back to a time before its signifi-cance was entirely known. (2) God the Father is the primary agent in bringing about this realization in Christ. Since idea and reality are intimately connected in the Divinity's vision of itself, the resurrection of Christ may be viewed as a providential movement on the part of the Father to bring the plan of redemption in accord with the working of the Divine Mind, that is, the Logos. In this respect, Christ's resurrection is that event which, touching upon history but transcending time, initiates the ultimate return of all created things back to God. (3) This view of Christ's resurrection also sheds light upon 210 Review for Religious the development in the early church of the doctrine of the incar-nation. If it is true that, in Christ's resurrection, flesh has been divinized and lifted up into the reality of the Word, it follows that, at some point prior to this momentous occasion, the Word itself had descended into the reality of human flesh and had become a human person. Putting aside for the moment the vari-ous intricacies involved in discussing the Christological contro-versies in the early centuries of the church, it seems quite appropriate to say that the doctrines of Christ's incarnation and resurrection form two aspects of a single salvific event which, if one were to borrow the Neoplatonic exitus/reditus structure adopted by Aquinas, represents the recreatio,z of all things going out of (exitus) and going back (reditus) to God. It is in this sense that all things are recapitulated in Christ, the New Adam. (4) As described above, the resurrection is not merely the state of Christ's postmortem existence, but an intricate part of the whole process of redemption. If Christ's exitu} from the Father reaches its furthest extension in his passion and death on the cross (described in the Creed as his descent into hell), his reditus is ush-ered in by the events of Easter morning, and his Spirit is the prin-ciple by which all things continue to be gathered into his body and thus into the presence of the Father. (5) As a transhistorical event with historical consequences, the resurrection of Christ exists outside of but in relation to the realm of historical inquiry. In this regard, it lies beyond the realm of scientific investigation and can be affirmed only through faith in the testimony of those claiming to have actually experienced Jesus after his death. That is not to say that the apostles did not experience outside of themselves in the exter-nal order, but only that the basis for their experience cannot be verified. (6) Indeed, probably the only historical consequence of mea-surable scientific value would have been the disappearance of Jesus' body at the actual moment of his resurrection. Since the precise whereabouts of the body was a point of contention even in the initial aftermath of the Easter proclamation (Mt 28:13), one must conclude that, although its disappearance could have been verified, if not scientifically, then at least through pagan eyewitness accounts, it obviously was not. (7) On all other points, the detached observer would not be able to separate the subjective experience of the apostles from March-April 1992 211 the reality of the risen Christ. There would, in other words, have been no way of determining whether or not they were actually experiencing anything beyond their own intensified inner aware-ness. The singularity of this experience would be expected if a transhistorical event were to occur and be experienced in its his-torical consequences. (8) To the extent that it is not based on direct experience but on the testimony of others, the faith of the church is qualitatively different from the faith of the apostles. Not only does it point to the conviction of those who claimed to have experienced the risen Lord, but, in one respect, it is even a purer experience of faith: "Happy are those who have not seen and yet believe" (Jn 20:29). (9) Belief in the risen Christ keeps alive in people the hope that, after death, their lives will not end, but merely change. Because of Christ's resurrection, they look forward to a trans-formed existence in the hereafter, one in continuity with their own lives on earth. Sustained by a believer's prayerful response to the contetnporary challenges of Christian discipleship, this hope forms the basis upon which life in the resurrection is anticipated even in the present. (10) Through their participation in the ministry and life of the church, people receive a foretaste of this transformed exis-tence, especially when they partake of the sacraments around the table of the Lord. It was at the Eucharist where Jesus' disciples recognized him in the breaking of the bread (Lk 24:30). It is there where Christians, even to this day, gather to do the same. This is especially true for those who dedicate their lives to Christ through the following of the evangelical counsels. Religious and the Resurrection In their vows of poverty, chastity, and obedience, religious strive to center their lives upon the reality of the risen Christ. They seek to do so by virtue of their firtn conviction that they are called to share in the life of the resurrection by making the idea of the vows a lived reality in their day-to-day existence. Christ, who exhibited both before and after his resurrection a life dedicated to the Father through the eschatological signs of the evangelical counsels, asks religious to do the same. The strength to do so comes from Christ and is mediated by his Spirit through his church and its ministry of the sacraments. While such dedi- 212 Review for Religious cation is never fully realized in the present, religious are called to imitate Christ throughout their entire lives. It is for this reason that, at the end of their earthly lives, they hope to share in the full-ness of his transformed existence. In their vowed life in common, religious pledge to give them-selves over entirely to the life of the risen Lord. In their vow of poverty, they seek both physical and spiritual detachment from material goods, doing so not out of a suspicion about the fundamental good-ness of creation, but from the convic-tion that it too will undergo a transformation in the fullness of Christ's kingdom. In their vow of chastity, they promise to forgo the goods of marriage, children, and sexual pleasure, thereby accepting Christ's Gospel declaration that there will be neither husband nor wife in the life to come (Lk 20:35) and that, even in the realm of relationships, all who abide in him will live a trans-formed existence. In their vow of obe-dience, they promise to accept the will of their superiors as a manifestation of God's plan for their lives, thus hoping to estab-lish within themselves a continual movement of accord between their own wills and that of the their risen Lord. Finally, in their communal existence, they hold each other accountable for the way of life they have chosen and seek to reflect in their mutual relations that dignity and care appropriate to those who are called to be members of Christ's body. By means of their individual and communal dedication to the evangelical counsels, it is clear that religious seek, even in this present life, a deeper share in the life of the resurrection. Through their vowed life in community, religious thus provide a faithful witness for themselves, the rest of the church, and the entire world that the idea of resurrection has not only been made a reality in Christ but that it is striving, at this very moment, to be realized in the lives of those who believe. In this respect, their witness affirms the movement of Christ's Spirit in the life of the church and provides a foretaste of the life to come. That is not to say that religious embody this charismatic dimension of the church better or more faithfully than any of the other vocations within the Belief in the risen Christ keeps alive in people the hope that, after death, their lives will not end, but merely change. March-April 1992 213 church (for example: single, married, priestly states), but only that their way of life is especially suited to it. Of its very nature, the religious life forIns a part of the charismatic dimension of the church. Indeed, to the extent that religious communities do not manifest to both others and themselves the gentle yet challenging presence of the Spirit, they fall short of the explicit nature of their call to center their lives entirely around the reality of the risen Christ. He it was who first imparted the Holy Spirit to his body, the church. He it is who continues to do so even to the present day. Through their faithfulness to the vows, lived in community and in the Spirit, religious seek mainly to nourish their relation-ship with the risen Christ. This personal relationship to the Lord motivates all of their activity for the establishment of God's king-dom; it is also what draws others to follow their particular way of life. Indeed, the care with which they tend this relationship is itself a sign that the reality of Christ's resurrection is meant for all to share and experience in all its fullness. In this respect, reli-gious must be ever conscious that their vowed life in common has little meaning if it is separated from life in the Spirit of the risen Christ and seen as an end in itself. To be sure, there is noth-ing sadder in the life of the church than to see individual reli-gious and, at times, entire communities lose sight of the meaning of their vocation. When people of such great promise and poten-tial compromise themselves and begin to believe that the Spirit is no longer active in their lives and that things will never change for the better, when men and women, who are called to be signs of hope, begin to believe in the voices of hopelessness, then the time is ripe for a prophet to arise within their midst to challenge them to come back to the Lord and to live the life to which they have been called. At the same time, there is nothing more joyful in the life of the church than to see men and women who, out of love for their Lord, renounce the very things for which they most actually strive during their sojourn on earth. To live in poverty, without children or spouse, and without full personal liberty provides oth-ers with the constantly needed reminder that the fullness of riches, family life, and freedom is ultimately found only in one's rela-tionship to him whom the apostles acclaimed to be truly risen. 214 Review for Religious Conclusion This essay has sought to outline the basic, underlying principle of the Christian doctrine of the resurrection. It has done so, on the one hand, by describing in as precise detail as possible the mean-ing of the idea of resurrection as under-stood in the church's teaching and, on the other hand, by looking into some of the fundamental presuppositions regarding the resurrection of Christ as experienced by his earliest followers. Bringing these two currents of inquiry together, the funda-mental principle of the resurrection (the resurrection kernel) was described as the affirmation of faith that the idea of resur-rection has become a reality in the risen Christ. Seen as a transhistorical event with historical consequences, the acclaimed res-urrection of Jesus of Nazareth lies, for all practical purposes, beyond the scope of scientific verification and remains inti- Through their faithfulness to the vows, lived in community and in the Spirit, religious seek mainly to nourish their relationship with the risen Christ. mately tied to the internal, subjective event of faith to which it gave life. That is not to say that Jesus' resurrection has no ground in the external order, but only that it ultimately lies beyond the scope of controlled observation. In this respect, the faith experi-ence of those who experienced the risen Lord is qualitatively dif-ferent from that of those whose faith rests upon their testimony. Blessed precisely because they believe without seeing, today's believers share in the hope of their own transformed existence which, through their experience of the Spirit in the church com-munity of the faithful, may be experienced even now in the quiet anticipation of the fullness of a reality yet to come. They bring their hearts' deepest yearning for the fullest presence of the risen Christ to the table of the Lord, where they are blessed with a glimpse of

Issue 35.2 of the Review for Religious, 1976. ; REVIEW FOR RELIGIOUS IS edited by faculty members of St Louis Umvers~ty, the editorial offices being located at 612 Humboldt Building, 539 North Grand Boule-vard; St. Louis, Missouri 63103. It is owned by the Missouri Province Educational Institute; St. Louis, Missouri. Published bimonthly and copyright (~) 1976 by REVIEW FOR RELIGIOUS. Composed, printed, and manufactured in U.S.A. Second class postage paid at St. Louis, Missouri. Single copies: $2.00. Subscription U.S.A. and Canada: $7.00 a year; $13.00 for two years; other countries, $8.00 a year, $15.00 for two years. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money order payable to REVIEW FOR RELIGIOUS in U.S.A. currency only. Pay no money to persons claiming to represent REVIEW FOR RELIGIOUS. Change of address requests should include former address. Daniel F. X. Meenan, S.J. Everett A. Diederich, S.J. Joseph F. Gallen, S.J. Jean Read Editor Associate Editor Questions and Answers Editor Assistant Editor March 1976 Volume 35 Number 2 Renewals, new subscriptions, and changes of address should be sent to Review for Religious; P.O. Box 6070; Duluth, Minnesota 55802. Correspondence with the editor and the associate editor together with manuscripts and books for review should be sent to Review for Religious; 612 Humboldt Building; 539 North Grand Boulevard; St. Louis, Missouri 63103. Questions for answering should be sent to Joseph F. Gallen, S.J.; St. Joseph's College; City Avenue at 54th Street; Philadelphia, Pennsyl-vania 19131. Mary, Model of the Church Paul VI December 8, 1975, marked not only the solemnity of the Immaculate Conception but also the tenth anniversary of the conclusion of the Second Vatican Council. This is the text of the Pope's homily in St. Peter's on that occasion.* Venerable Brothers and Beloved Sons! and all of you, special guests at this pious ceremony, Teachers, Research workers and Students of the Pontifical Roman Universities, you P~upils in our seminaries, you Members of the Ecclesiastical and Religious Colleges of the City, or associhtes of the Secular Institutes. And you, beloved Daughters in Christ, Religious, Novices, Probationers and Pupils of the Houses of formation for women in Rome. And then you, too, our Roman faithful, and you pilgrims of the Holy Year and visitors to this holy City. And finally you (we wish to gather everyone in the multiple value of the rite we are celebrating), you, we say, former members and protagonists 'of the Second Ecumenical Vatican Council, convened here to commemo-rate with us the tenth anniversary, which falls today, of those great ec-clesiastical sessions! Listen to us, all of you! and let us invite you to a moment of contem-plation, spiritual and almost visual, as if the appearance of her whose ex-traordinary feast we are celebrating today were present in the background of this Basilica, as if-hovering in the unique splendour, proper to herself (even if reflected from the divine source of light); and we were to see her with the prophetic eyes of the evangelist of the Apocalypse: *Abstracted from Osservatore Romano, 12/18/75, pp. 6-7. 161 162 / Review [or Religious, Volume 35, 1976/2 Behold! "A great portent appeared in heaven, a woman clothed with the sun, with the moon under her feet, and on her head a crown of twelve stars" (Apoc 12, 1; cf. Cant 6, 4 ft.). What is it? Who is it? We are amazed and absorbed by the Bible vision; and in our dazzled astonishment we lose the sense of reality. We do not forgo expressing as best we can the value of that mysterious image; and without continuing, for the present, with the scene in the Apocalypse, we are satisfied to know the double name that has been superimposed on that heavenly figure by the masters of Holy Scripture, as if exclaiming, in an-swer to our anxious curiosity: it is Mary, it is Mary, that Woman clothed with the sun, with the moon under her feet, and the mysterious crown of stars on her head! It is the Church, it is the Church! the scholars inform us, studying the secrets of the figurative and symbolical language of the world of the Apocalypse. Perhaps they are right. As for us, we are happy to honour Mary and the Church, the first the Mother of Christ in the flesh; the second the .Mother of his Mystical Body, and she herself part of that Mystical Body. All Brothers and Sons! For a moment let us fix our thought, dazzled and happy, on the first meaning of the bewildering vision; and let us say to ourselves, with the intention of celebrating the mystery of the Immaculate Conception: that is what Mary is like! Her aspect is heavenly and tri-umphal~ but if closely observed, it is that of a Woman "humble and lofty more than a creature" (Par 33, 2). So humble, in fact, that she banishes all our respectful trepidation (cf. Lk 1, 48), and almost invites us to see in her a beloved Sister. At the very moment that we dare to address to her a trusting word, no other words come to our lips than those of the Gospel: Blessed art thou! (Lk 1, 45 and 48). Yes, blessed! And for how many reasons! One among the many we are celebrating today, and we would like to put it at the peak of our devotion to Mary: her Immaculate Conception! That is, God's preferential thought for this creature of his; the intention to 'see in her again the original innocence of a being conceived "in the. image and likeness" of himself, God (Gen 1, 26-27), not disturbed, not contaminated by any stain, by any imperfection, as are all the children Of Eve, all mankind, except Christ and except her, the Blessed Virgin. An idea; a divine dream] a masterpiece of human beauty, not sought in the formal model only, but realized in the intrinsic and incomparable capacity of ex-pressing the Spirit in the flesh, the divine likenes~ in the human countenance, invisible Beauty in the physical figure. Mary, All Beauty Tota pulchra es, Maria.t You are beauty, real, pure, holy beauty, oh Mary! This should be the real and ideal image of the Blessed Virgin, re-flected, luminous and illuminating, in Our individual souls, today, oh Faith- Mary, Model o] the Church / 163 ful; as the synthesis of our admiration and devotion to the Blessed Virgin, whose feast, eminently theological and eminently ecclesial, we are celebrat-ing. Theological, because we deduce it from revelation and from the most vigilant and loving reflection, with which the most candid and virginal piety dared, certainly with her assistance, to fix an enraptured and exPloring gaze on her pure, humble face, the perfect face of sacred and human beauty~ Ecclesial, because from being a mirror of divine perfection, speculum iusti-tiae, she offers herself to us as a mirror of human perfection, in which the Church, venerating the Blessed Virgin, "joyfully contemplates, as in a faultless model (it is the Council speaking; Sacr. Cone., n. 103), that which she herself wholly desires and hopes to be"; a nuptial beauty which St. Paul, as we all remember, describes in a stupendous way: "in all its splen-dour, without spot or wrinkle, or any such thing, that she might be holy and without blemish" (Eph 5, 27). The Church's holiness, in its state of becoming, has its model, its "typus" in Mary, as St. Ambrose will say (in Lucam, II-7), and St. Augustine will comment: "figuram in se sanctae Ecclesiae demonstravit" (De Symbolo, I; P.L. 40, 661), Mary represented in herself the figure of the Holy Church. ¯ A model, a specimen, an ideal figure of the Church; is that enough? The theological truth goes further, and enters the frontiers of that subordinate causality, which in the divine plan of salvation inseparably associates the creature, Mary, the Handmaid of the "Fiat," with the mystery of the In-carnation, and makes her,: St. Irenaeus writes, "a cause of,this salvation for herself and for the whole of mankind" (Adv. haereses, III, 22, 4). "Mother of the Church" We will rejoice, then, to have in St. Augustine the conclusion which at the end of the III section of the Council we made our own, explicitly recog-nizing the unquestionable right of the Blessed Virgin to the title of "Mother of the Church." If, in fact, Mary is the mother of Christ in the flesh, and Christ is the head of the Church, his Mystical Body, Mary' is spiritually the Mother of this Body, to which she herself belongs, at an eminent level, as daughter and sister (cf. St. Augustine, de Sancta Virginitate, V and VI; P, L. 40, 339; and cf, H. De Lubac, Mdd. sur l'Eglise, c. IX) . To you, Teachers, Research workers and Students of our Rbman Uniz versities; to you, young Seminarian~, to you, Religious men and women, goes particularly a cry from our heart: love, invoke and imitate Mary Immaculate, the Mother of Christ and the Mother of the Ctiurch, and make good use, for the present and for future generations, of the treasure of wisdom that the second Vatican Ecumenical Council was and is. The Spirit Speaks: When and How? Thomas Dubay, S.M. Father Dubay, a frequent contributor to our journal, is engaged full time in lecturing and writing in the area of religious life. His home address is: Marist Seminary; 220 Taylor Street, N.E.; Washington, DC 20017 "Speak, Lord, for your servant is listening" (1 Kgs 3:10). ¯ One need not emphasize the point that a vibrant sector of Christian life at this point of history is the sector of the Spirit, the Holy Spirit. The charismatic renewal has been promoting with no little success a whole life-style patterned on and growing out of a program centered in the Spirit's activity in the midst of God's people. This renewal is by no means restricted to "the release of the Spirit'? or the gift of tongues or the healing ministry. It is felt that the Holy Spirit is speaking today not only to saints but to sinners, not only to officialdom but to the lowly placed. To some considerable extent, but not with an entire coincidence with the charismatic movement, the Spirit movement' has been prominent in renewal efforts carried on in religious life. Books, articles, lectures, chapter documents often refer to the Holy Spirit, especially under the rubric of openness to Him, listening to Him. The central thrust here is not so much prayer experience, speaking in tongues or engaging in a healing ministry as it is in detecting what God is saying to us, both to the individual and to the community. This thrust toward listening to the Spirit is readily noted in the popularity of discernment methods, techniques, processes~ Although one begins to sense an incipient, weariness with discernment talk, the interest remains noteworthy. The reality surely is of crucial importance in an age struggling to find the mind of God and to read the signs of the times. If God does speak to His people--and Scripture insists that He does--it can never be unimportant to listen. 164 The Spirit Speaks: When and How? / 165 An Anomalous Situation But this ."listening" is where .our problems begin, problems that press for solution. Before we can intelligently explain how one listens to the indwell-ing God, we should first understand something of how He speaks. The literature of our day, issuing both from the charismatic renewal and from religious life circles, says almost nothing on this subject. As a matter of fact, I must. candidly add that while speculative theologians often refer to the activity of the Holy Spirit in the Church, they seldom discuss how He acts and enlightens the individual through a personal contact. They do, of course, rightly point out that God speaks to His people through Scripture and through the representatives He has established in His Church: "he who hears you, hears Me" (Lk 10:16).1 But this is not the question at hand. People both in the Pentecostal movement and in religious life have in mind a personal (individual and!or communal) encounter with the Holy Spirit, and in this encounter they "listen to Him." Our situation, therefore, is odd. On the one hand many persons rou-tinely speak of "listening to the Spirit" as though He were as familiar as a friend speaking over one's right shoulder. Yet on the other hand almost no one explains how He speaks--even though we all know He does not speak in sound waves. Nor are we told how one can be so sure it is the Spirit speaking. Until we provide satisfactory answers to the question, "How does the Spirit speak?" we are left with some embarrassing problems. How can anyone be so sure he is listening to the Spirit and not to his own desires? We hardly need to debate the observation of Aldous Huxley: "The untutored egoist merely wants. Give him a religious education, and it becomes obvious to him, it becomes axiomatic, that what he wants is what God wants.'"-' Does God speak in diverse ways? If He does, how can we know the differences? What are we to think of,serious and sincere people who are convinced that they are receiving special messages from the Holy Spirit? Is good will enough to insure "listening to the Spirit"? Who Can Answer Our Questions? If it is true that the popular and theological literature on the con-temporary scene seldom discusses the title questign of this article, one may rightly wonder who can answer it? I know of two sources: Scripture and the mystics? We shall in this article explore both of these sources that we may discover on solid grounds when and how the Holy Spirit speaks in our own day. ~See also Jn 13:20; Jn 21:15-17; Lk 22:31-32; Tt 1:7; 1 Tm 3:15; 2Tin 3:14-16 and many other like texts. ~The Devils o] Loudun, p. 18. ZBy "mystics" here I do not refer to the recipients of extraordinary phenomena such as levitation or the stigmata. The word in Catholic theology indicates those men and women who have a deep experiential encounter with God. 166 / Review Jor Religious, Volume 35, 1976/2 Scripture on the Experience og God ~ ~ We may acknowledge at the outset~ ~that the Lord God did speak to select representatives in biblical times~ and in :extraordinary ways (Heb l:l ). However, we shall not be primarily concerned here with the divine messages addressed to public personages, to a Moses or to a Paul. Rather we shall direct our attention to the usual, frequent, routine ways God speaks to the inner heart of anyone close to Him. Our tasks will be three: a) Introductory observations b) What does one experience when he experiences God? c) Implications of the .biblical account. When we complete our biblical study, we shall~ investigate the mystics' message. They have a great deal to say about listening to God: when and how it happens and does not happen. a) Introductory observations Just what is experience? We use the word constantly both in popular speech and in scholarly articles, but seldom does .anyone .suggest its mean-ing. The best synonym I can think of is awareness, Without awareness one cannot experience. A genuine experience is an awareness of something, even if that awareness focuses on one's self. An illusory experience is subjectively real but it has no objective correlative. Experience for human being .implies a passivity, a being affected by the object (tapioca, .coldness). In sensory experiences affectivity (pleasant, unpleasant, cold-hot, smooth-rough, sweet-sour) predominates over knowl-edge, whereas in intellectual experience the cognitive and the affective are closer to,.being equal partners because they more intimately interpenetrate each other. - Although it is obvious on ~a moment's reflection that ,19od cannot be experienced as though He were a material object somehow palpable, some seem to assume that He must be absent if.He does not manifest His pres-ence in human ways. He is God, and we should be .content to allow Him to operate in a divine manner. We may speak of an experience-of-God continuum tl~at runs from reasoned conclusions about Him (the weak. end of the continuum or spec-trum) ~,to the face'to,face vision of Him in. glory (the strong end). In be-tween we can locate the poetic, ,artistic and infused mystical experi~n(es, In this article I shall be concerned chiefly with the last, the divinely originated, mystical encounters with our God revealed in Christ. We need to emphasize that the experience of which we speak here comes from God, not from what we do or feel or will. It is not our idea which we like and and then baptize as being His idea. When God speaks, it is God who speaks. b) What does one experience when he experiences God? ~ Divine ~xperience is not one sole awareness. The reality is rich and is expressed in many ways, each of which brings out an element or emphasis found in the whole. I wiil distinguish and number these elements not to The Spirit Speaks: When and How? / 167 separate them but to clarify the richness. Our usual human way of under-standing is through concepts ,and distinctions. One who is impatient with reasonable distinctions does not understand that he could not utter his sentence of objection except by distinguishing each word of it from every other word. In what follows, however, we must understand that the reality is not a series of chopped up pieces but a flowing whole of diverse strands and richness. 1) PRESENCE-AWARENESS. The experience oLGod includes an aware-ness, a sense of His divine presence. One is aware that God is with him, be-fore him, at his'right hand (Ps 16:8). The Holy Spirit is given to "be with" the disciple of the Lord (Jn 14:15-17), and Jesus' name is Emmanuel, God-with-us (Mt 1:23). He promises to be with His disciples all days, even to the end of the world (Mt 28:20). One who loves possesses an abiding presence of God within himself (I Jn 4:16). We shall see further on how the mystics elaborate on this presence-awareness. 2) ~ SPIRITUAL AWARENESS: SENSE-LIKE BUT NOT SENSE-LIKE. Because God is purest Spirit no .one can attain Him through sense knowledge. Yet Scripture is not reluctant to use sense knowing to bring out the reality and richness of a divine-human encounter. We are to taste and see for ourselves the goodness of God (Ps 23:8). Jeremiah felt an inner touch, a burning in his being (Jer 20:9). Paul speaks of the fragrance of Jesus' offering (Eph 5:2). The Song of Songs refers to the hearing of a voice (Song 2:14). The mystics repeatedly refer to the five senses to explain a deep meeting with God. St.-Augustine,~offers a classical example when in the Conjessions he brilliantly denies that a profound experience of,God is sense-like but then immediately turns around and affirms that there is a sense-likeness in it: ~' Not with doubtful but with sure knowledge do 1 love you, O Lord. By your Word you have transfixed hay heart, and I have loved you . What is it then that I love when I love you?'Not bodily beauty, and not temporal glory, 'not the clear shining light, lovely as it is to our eyes, not the sweet melodies of 0many-moded songs, not the soft smell of flowers and: ointments, and per-fumes, not manna and honey, not limbs made for the body's embrace, not these do I love when I love my God. Yet 1 do love a certain light, a certain voice, a certain odor, a certain food, a certain embrace when I love my God: a light, a voice, an odor, a food, an embrace for the man within me, where his light, which no place can contain, floods into my soul; where he utters words~that time does not speed away; where he sends forth an aroma that no wind can scatter; where he provides food that no eating can lessen; where he so clings that satiety does not sunder us. This is what I love when I love my God.4 St. John of the Cross at one time uses music to suggest how a person can "hear" God in His creation: "Creatures will be for the soul a-harmonious 4Con[essions, Ryan translation, Image edition, Bk 10, c. 6. 168 / Review for Religious, Volume 35, 1976/2 symphony of sublime music surpassing all concerts . She calls this music 'silent' because it is tranquil and quiet . There is in it the sweetness of music and the quietude of silence.'''~ At another~ time the saint describes the experience of God as a fragrance: "Sometimes the fragrance is so abundant that it seems to the soul she is clothed with delight and bathed in inestimable glory.'''~ While both the biblical writers and the. later mystics know well that God is infinitely beyond our realm of sensation, yet they speak in this fashion in order to bring out the reality of the experience of God and the richness of it. 3) NEW K.NOWINO, D.IVINE AND DARK. When one advances into a depth relationship with God he grows in knowing his Lord without knowing how he knows. He perceives this hidden God in darkness (Is 45:15), and yet the Son manifests Himself to the person who loves and keeps His word (Jn 14:21). The Father, says St. Paul, radiates in our minds His own glory, the glory that shines on the face of Jesus (2 Co 4:6). Angela of Foligno observed that the more the supreme Good is seen in darkness the more does one know He surpasses all goods~ Listening to the Spirit, there-fore, does not usually mean listening to a clear message. God does not dictate idle details about one's friends, family, enemies, oneself. The man or woman listening to the Holy Spirit is learning most of all about the three divine persons, darkly beautiful. 4) YEARNING FOR GOD. God often speaks a thirsting for Himself into the human person. It is a thirsting that purifies the recipient for deeper union and love, a thirsting that widens capacity and "bestows humilityi The psalmist seeks and thirsts like parched earth (Ps 63:1) or like the deer panting after the running waters (P~ 42:1-2). Isaiah longs for his Lord and keeps vigil for Him through the night (Is 26:8-9). St. Augustine sighs for God day and night,r All available evidence indicates that the Holy Spirit communicates this divine thirst far more frequently than He does concrete messages that satisfy curious eyes and itching ears. God. has nothing better to say than Himself. That is why in the incarnation the Father spoke His Word into the world of human flesh. When one listens to the Father, he hears mostly the Son. 5) PEACE AND COMFORTING. Our God is a healing God, a God who l(~ves and therefore comforts us in~ all our sorrows (2 Co 1:3-4), a God who gives a peace that surpasses understanding (Ph 4:7), a G~)d who re-freshes the wearied soul and gives rest (Jr 31 ~25-26; Mt 11:28). While our own selfishness begets conflict and factions (Ga 5:19-21), what the Spirit r'Spiritual .Canticle, Stanzas 14-15, #25; I am using here The Collected Works o[ St, John o] the Cross, translated by Kieran Kavan~augh, O.C;D. and Otilio Rodriguez, O.C.D., New York, 1964, p. 472. ~lbid., Stanza 17, #7; p. 480. rConfessions, Bk 7, c. 10. The Spirit Speaks." When and How? / 169 brings.is very different: love, peace, harmony. (Ga 5:22). The Hebrew shalom was not a mere absence of conflict. It implied a fullness, a rich integrity, something akin to our word, prosperity. God speaks peace, shalom, to his people. His word makes individuals and communities inte-gral, whole, loving. 6) INPOURED LOVE. The divine gift par excellence is love: "the love of God is poured into our hearts by the Holy Spirit who has been given to us." (Rm 5:5) Those who divide the community into factions, who disregard their leaders are not listening to the Spirit who brings unity (1 Co 12:12-13; Ep 4:3-6) and an obedience to those overseers whom he Himself has placed to rule the Church of God (Ac 20:28). This love is a sign of the genuine disciple, one who loves as the Lord Himself loves (Jn 13:34-35). The Spirit speaks love (Ga 5:22). 7) UNION-POSSESSION-BURNING. This love of the Holy Spirit centers especially.on the three divine persons and it grows to a point where it can overwhelm one (2 Co 5: 14). It.can make one's heart.burn: "there seemed-to be a fire burning in my heart, imprisoned in my bones," said Jeremiah. "The effort to restrain it wearied me, I could not bear it." (Jr 20:9) The disciples on the road to Emmaus felt this burning as they listened to the word of the risen Kyrios (Lk 24:32), and the mystics commonly speak of it. Augustine~could write of being set. on fire for God by the psalms and of burning to repeat them.s Further on he declared that love was his gravity: "By your gift we are enkindled, and we are borne upwards. We glow with inward fire, and we go on. We asc(nd steps within the heart, and we sing a gradual psalm. By Your fire, by. Your good fire, we glow with inward fire:'''~ St. John of the Cross could speak simply of the perfect "who burn gently in God.''1" Once again we emphasize that when God speaks it is not a narration of idle details that satisfy curious expectations. God mostly speaks love. ~ 8) BEAUTY OF GOD AND JOY IN HIM. The experience of God is a growing perception of His goodness and beauty. We are to taste and see for ourselves how good He is (Ps 34:8). The one thing, the top-priority sought by the psalmist is to°dwell in the Lord's house all the days Of his life and thus to "gaze on the beauty of the Lord" (Ps 27:4). Augustine puts this in his own inimitable language: "All things are beautiful because You made them, but You who made all things are inexpressibly more beautiful . Too late have I loved You, O Beauty so ancient and so new, too late have I loved You!TM Our joy is to become so deep that it is radiant (Ps 34:5), complete (Jn 15:11), unending (Jn 16:22),.always and every- 81bid., Bk 9, c. 4. '°1bid., Bk 13, c. 9. 1°Dark Night of the Soul, Bk 2, c. 20, :~4; p. 337. 11Confessions, Bk 13, c. 20 and Bk 10, c. 27. 170 / Review ]or Religious, Volume 35, 1976/2 where (Ph 4:4), beyond description (I P 1:8). This, too, the Bishop of Hippo heard from the indwelling Lord: ",Sometimes You admit me," he said, "in my innermost being into a most extraordinary affection, mounting within me to an indescribable delight, If this is perfected in me, it will be something, I know not what, that will not belong to this slife.''r-' This'is what the Lord God especially speaks, and this is what they hear who deeply listen. 9) POWER, STRENGTH, FREEDOM. God speaks 'not only words but power itself.-It would seem correct to say that worded communications from Him are~comparatively rare, while bestowals of power and freedom . are comm.on, common that is to people who are mature in prayer. Paul came to the Corinthians not with human philosophy but with the power of God (1 Co 2:5). He explains that God,s kingdom.does not consist only of words--it~is power (1 Co 4:20). The apostle himself experiences "an overwhelming power" from the Father (2 Co 4:7). All he wants to know is Christ and the power of His resurrection (Ph 3:10). This power is a liberating dynamism: "Where the Spirit of the Lord is there is freedom" (2 Co 3:|7). c) Implications of the biblical account. Perhaps the most striking note of this New Testament picture of how God speaks is that He does not ordinarily speak specifics. It is true that public persons or those closely related to them do occasionally receive particularized directions. This is true, for example, of Peter (Ac 10:9-16), Cornelius (Ac 1'0:3-6), the "Council of Jerusalem" (Ac 15:28), Paul (Ac 9:3-6: Ga 2:2; 2 Co 12:8-9), Ananias (Ac 9:10-16). In the Christic economy when specific divine messages are given, they must be submitted to human authorities. This has long been the practice of spiritual directors and it is rooted in revelation itself. Even St~ Paul sought the .approval of the "leading men" in Jerusalem for the mission he had received directly from the risen Jesus (Ga 2:2, 6, 10). The New Testament gives no. com-fort to visionaries who deem themselves exempt from any structural guidance. What God usually does speak to the ordinary person is inner trans-formation. He speaks goodness in a general manner. He speaks his pres-ence ~. spiritual awareness., divine-dark knowing of himself., yearn-ing for his presence . . . peace and comfort . . , inpoured love . . . union-possession- burning., beauty and joy . . . power and freedom. This may come as a ,surprise to devotees of private revelations~ but it does not surprise experienced spiritual directors. Those who listen to God most genuinely are not those who believe they have received many detailed messages, but rather those whose minds have been fillhd with everything true, noble, good, pure, virtuous, worthy of praise (Ph 4:8). r"Ibid,, Bk 10, c. 40. The Spirit Speaks: When and How? / 171 Further Development, s: St. ~Iohn of the Cross While Sacred Scripture is rich in its variegated ways of dealing with the experience of God, it does leave, us with the need to unfold the richness further. We ,may therefore ask several qi~estions. Does the Holy Spirit speak in varying degrees of intensity? If so, what are they like? Does He add His own peculiar light to our human reasonings and searchings? If so, how does this happen? Can we know when it .happens? Is it possible to be mistaken regarding a genuine communication from ,13od? Were the saints ever mistaken? What does one do if he thinks (or is even convinced) that God has enlightened him in some specific way? In looking through a considerfible amount of the literature produced on these questions rI can think of no one more competent to respond to our questions than St. John of the Cross. That this Carmelite saint experienced the deepest, most magnificent encounters with the ,living God is beyond debate. If anyone~ has known what knowledge through infused love is all about, John has. If anyone has been capable of analyzing and synthesizing the sundry, elements in the experience of God:in all their varieties and de-grees, John has. If any mere man or woman has listened to the Spirit, John has. We shall, therefore, take this theologian of mysticism as our guide. In an area in which the Spirit-structure tension in the Church occupies center stage we need a master. "' Types of Communication God does not speak to,man as man speaks to man. He speaks as God; and consequently we should be wary Of our preconceived ideas as to how the communication ought to be carried: off. Moreover, He does not speak in one way only. Nor should we assume that His speaking is always unmis-takable: The indwelling God leads us into all truth (Jn 14:26; 16:13) in diverse ways and degrees. St. John.~of the Cross discusses these ways and degrees under the caption of what he calls supernatural locutions.13 It seems to me that this expression, "supernatural ,locution," is equivalent to what we mean in saying that the Holy Spirit speaks to us. John's'"locution" is a type of "apprehension," a knowing.It is a type that is "produced in the souls of spiritual persons without the use of :the bodily senses as means."14~,These are not sensory orqmaginary visions. They are "produced," that is, received from God. One does not originate the locution. God speaks and enlightens. Man receives. The saint reduces the many ways in which God speaks to three types. There are, in order of ascending value (and using the saint's terminology), a.~See Ascent o] Mt Carmel, Bk 2, cc. 28-31. 141bid., c. 28; p. 203. 172 / Review ]or Religious, Volume 35, 1976/2 successive locutions, formal locutions and substantial locutions. I will speak of them in my own language as well as John's. a) Assisting enlightenment (successive locutions). This .first type of divine speaking always occurs when one is "recollected and attentively absorbed" in some thought process. The.,enlightenment al-ways concerns the subject on which one is meditating?~' During this time, says John, the person is united with the truth and with 'the Holy Spirit who is in every truth, and yet he is thinking, reasoning in the usual, human man-ner. The Spirit aids him in forming his concepts and judgments. There is so great a clarity and ease in this activity thatqt seems another is teaching him, as indeed is the case. In this communion with :the. indwelling Spirit about a particular matter the person goes on to "form interiorly and suc-cessively other truths.''1' John supposes that this enlightenment occurs dur-ing prayer, that is, while one "is '!recollected" and "communing with the. divine Spirit?' It seems, therefore, that this type of speaking does not usually occur in dialogue sessions but in the midst of prayerful communion. The recipient of this assisting enlightenment "is unable to believe" that it originates with himself, but he has the awareness that it derives from another. And yet the knowledge received (it cannot be. attained by personal industry) is so delicate that the natural intellect by its own activity "easily disturbs and undoes" it.lr This point is important. Even when God does speak in this manner, he does not exclude our human activities with all their limitations, preconceptions, biases, errors. Even when he enlightens, he' permits men and women to be what they as a matter of fact are, fallen men and women--redeemed, yes, but still wounded and. deficient. We may conclude that this assisting enlightenment is not merely human reason proceeding under its own steam and deriving from the Holy Spirit only in the sense that anything true and good derives from him. The divine speaking is something over and above the gift ,of native intelligence, even though in the successive locution lit works closely with that intelligence, b) Independent-ideational speaking (formal locutions). Whereas the assisting enlightment occurs only when one. is prayerfully meditative, this divine speaking can happen at any time. In the first the locution accompanies human activity, while in the second it is uttered in-dependently of what the recipient is doing: "They are received as though one person were speaking to another.'''8 One may receive this locution while he is working, conversing; playing or praying. "Sometimes these words are very explicit and at other times not. They are like ideas spoken to the l~'lbid;, c. 30, #1; p. 208. ae'lbid., c. 29, #1; p. 204. ~rlbid., c. 32, #4; p. 213. aSlbid,, c. 30, #2; p. 208. The Spirit Speaks." When and How? / 173 spirit. At times only one word is spoken, and then again more than one; . . .-19 Although the recipient is clearly aware that this locution comes from another and thus has no reasonable doubt abou~ the otherness of origin, he can only too easily be deceived aSotO who this other is. It may be God or it may be the devil,o-" and the discernment is not always easy. Of this I shall speak later. c) Dynamic-effective speaking (substantial locution). It is now well known that the Hebrew idea of word, dabar, was not a mere intellectual representation of reality but a dynamic power. Just as the rain and snows come down from the heavens and produce food, so God's word comes down and achieves its effects (Is 55:10-11)~ The divine ~ord acts; it does things. It is like fire and a hammer that sunders rocks (Jr ,23:29). It is active, alive; it judges, divides and cuts like a two-edged sword (Heb 4: 12). Yahweh's word alone caused all creation to be (Gn 1 and 2). Jesus' words are spirit and life (Jn 6:63). This dynamic-effective speaking (substantial locution) is not merely an assisting enlightenment (the first manner) nor an ideational speaking (~the second manner). It is a powerful producing-in-the-soul of what it says. St. John of the Cross calls this communication substantial because it im-presses its meaning in the very substance of the recipient's being. The word does what it says. "For example," notes the saint, "if our Lord should say formally to the soul: 'Be good,'oit would immediately be substantially good; or if He should say: 'Love Me,' it would:at once have and experience. within itself the substance of the love of God; or if He should say to a soul in great fear: 'Do not fear,, it would without delay feel ample fortitude and tranquillity.''zx These dynamic~effective communications are the most excellent for several .reasons. One is that deceit, is impossible, since the devil cannot pro-duce this .goodness within one. Another is that these locutions impart "incomparable blessings" of life and goodness to the person who receives them. There is consequently nothing to fear or to reject. The recipient need do nothing about them "because God never grants them for that purpose, but He bestows them in order to accomplish Himself what they express.'':2 Divine Message and Human Fallibility We approach now a problem whose solution is anything but apparent. As a matter of fact it appears on the surface that the union of two factual 191bid. o-°ibid., c. 30, #3-5. °-1Ibid., c. 31, #1; p. 210. °'°'Ibid., c. 31, #2; p. 210. 174 / Review ]or Religious, Volume 35, 1976/2 premises is impossible. Fact number one: God does speak to certain men and women and He speaks with unfailing truth. Fact number two: these same men and women are often (not just rarely) mistaken in what they hear or think they hear or in what ihey conclude from what they hear, We immediately wonder what the sense of fact number one would' be, given the existence of fact number two. Why would or should God speak to people who often are mistaken in what they hear? One answer to this question is obvious on a momentrs reflection. A fruitful source of error in this area is a simple mistaking of the source of the locution. People often think they are listening to the Spirit when lie is .not speaking at all--or at least He is not saying what they think He is saying. We may not hold God responsible for what He did not say. Yet a problem remains: even when God does speak, the r.ecipient may either not hear or distort what~ he did hear or conclude invalidly from it. Why, then, should God speak when this may be the likely result? One response is identical to what we would say about any human speaking to a fellow human: failure to hear or distortion of the statement or invalid conclusion are always possible. Anyone who has lectured knows this from personal experience. It is remarkable how many people do not hear what you have said (or read what you have written). Yet we do not for that reason cease :speaking or writing. God .speaks to His people for the same reason we do: many do hear, and hear rightly. A lecturer or writer admit-_ tedly takes risks in sharing his thoughts publicly. He knows some will miss the message, while others wittingly or unwittingly will twist it. Yet he also knows that others will hear rightly. God loves us so much that He 'al-lows some to distort His word so that He may communicate intimately with those who will not. There are two reasons according to St. John of the Cross why a divine communication, even when perfectly authentic, can be the occasion for the recipient to be misled regarding it. The first reason is our crude way of understanding the divine mind. Explaining why not all revelations turn out as we expect them to turn out, that is, in their literal sense, the saint notes one reason to be that "since God is immense and profound, He usually embodies in His prophecies, locutions, and revelations other ways, con-cepts and ideas remarkably different from the meaning we generally find in them. And the surer and more truthful they are, the less they seem so to us."'-'~ The saint goes on to illustrate our usual "extremely literal method" with biblical examples. In making His covenant with Abram the Lord God promised that he would give the patriarch a new land. The latter understood this literally of his own personal possession and inquired what the sign of it would be (Gn 15:7-8). However, Abram died before .his possessing the land and "~.~lbid., c. 19, #1; p. 163. The Spirit Speaks: When and How? / 175 so one might have supposed' the divine promise mistaken. But it is the supposition that was mistaken .because it was based on a literal under-standing. Abram was given this land in his descendants as was explained a few verses further on (vv. 18-19). When God's people read that the Messiah was to rule from sea to sea, that His foes would bow down before him and lick the dust of the earth (Ps 72:8-9), they had a true prophecy but they misunderstood His rule to be temporal, whereas it was inner and eternal. So also the disciples on the road to Emmaus were reproved by the risen Lord for being dull and slow in failing to understand what the prophets had announced concerning the Messiah (Lk 24:25). St. John of the Cross concludes~ that "evidently, then, ~even though the words and revelations be from God, we cannot find assurance in them, since in our understanding of. them we can easily be deluded, and extremely so.''24 If this could happen in biblical times with genuine divine communications, it surely can happen in our times. The Carmelite points out that in divine words "God always refers to the more important and profitable meaning,'''5 whereas we tend to see in those same words something less important,' something perhaps merely temporal, even trivial or selfish. This is why the man of the flesh, to use Pauline terminology, the worldly man, cannot (not simply, does not) understand the things of God.(1 Co 2:14). He is too materialistic, too crass, too literal to grasp the divine meaning. One must undergo a con-version, get rid of his worldliness, says Paul, in order to come to know the perfect will of God (Rm 12:2). The second reason why an authentic divine communication can be mis-applied by the recipient is that God's judgment may be~conditional, and that without the knowledge of the human person. God's word or promise may so depend on some contingent event that when that event does or does not occur, so also the divine degree does or does not take~ effect. John cites Jonah's proclamation that Nineveh shall be destroyed in forty days (Jon 3:4). Yet the city was not destroyed because the people repented and did penance: The cause of the decree, human sin, was removed by penitence and so was the decree itself. They especially who do not understand the unfathomable abysses of the divine mind easily suppose they do understand. John of the Cross, who surely experienced God as few others have, supposed otherwise: "Be-lieve me," he concluded, "a person cannot completely grasp the meaning of God's locutions and deeds, nor can he determine this by appearances without extreme error and bewilderment.~''z5 Z4lbid., c. 19, #10; p. 167. God does not necessarily prevent even a genuine mystic from being mistaken in his understanding of an authentic communication. z~Ibid., c. 19, # 12; p. 168. ~ Z~lbid., c. 20, #6; p. 171. 176 / Review for Religious, Volume 35, 1976/2 Assisting Enlightenment and Human Fallibility What we have thus far considered regarding the divine message and human fallibility St. John of the Cross applies to visions as well as to locu-tions. We may now turn our attention specifically to what he calls suc-cessive locutions and I have termed God's assisting enlightenments. When the Holy Spirit aids us in prayerful pondering, is it likely that we can be mistaken in our conclusions? In itself the light of the Spirit can never be mistaken. He who is the tyuth can do nothing but illumine with the truth. However, the light He bestows is often so delicate and lofty that it leaves considerable room for human activity. And when we have room for human activity, we have room for error--unless there be a special divine intervention as is the case with the charism of infallibility given to the Church herself. The possibility of error is present especially in what we deduce and conclude from the divine enlightenment. The light of the Holy Spirit, says John, "is often so delicate and spiritual that the intellect does not succeed in ~being completely in-formed by it; and it is the intellect that of its own power, as we stated, forms the propositions. Consequently the statements are often false, or only apparent, or defective.'':~ This is important. Many of us seem to assume that "listening to the SpirW' means listening to neat, specific conclusions that God somehow inserts into the mind. And we further assume that if we have .an idea we think good it must be He who inserted it. Not so. That sort of neat "formu-lation- insertion" I would call an extraordinary private revelation, not a usual assisting enlightenment. In the latter case it is we who draw the conclusion, and it may be true or untrue, wise or unwise, loving or unloving. History bears out the solidity of this analysis. All through the ages there have been men and women who have expressed a profound conviction that their messages, even the most bizarre and untenable messages, have been spoken by God Himself. They seem not to suspect that they have them-selves contributed anything to their conclusions. John was able to write of this problem in terms that may startle us by their relevance: "I greatly fear what is happening in these times of ours: If any soul whatever after a bit. of meditation has in its recollection one of these locutions (succes-sive), it will immediately baptize all as coming from God and with such a supposition say, 'God told me,' 'God answered me.' Yet this is not so, but, as we pointed out, these persons themselves are more often the origin of their locution.''-~ P. de Letter is of the same mind. Remarking that even genuine charismatics can add human particulars of time and place to an authentic divine message, he notes that "they themselves are generally ~-Tlbid., c. 29, #3; p. 204. '-'Slbid., c. 29, #4; p. 204. The Spirit Speaks." When and How? / 177 unable to make a distinction between the divine and human elements."~"' A. Poulain and K. Rahner speak of the commonness of,human errors added to divine communications.:'" At this point one may ask how our intellect may be more completely informed by the light of God and thus be less subject to its proclivity to adulterate the delicate divine light with its own human shortsightedness. The answer is gospel goodness in general and the light of deep ., faith in particular. According to St. Paul the only way to attain to God's mind and know His perfect will is to put aside worldliness and.undergo conversion (Rm 12:2). The judgment of St. John of the Cross is the same: "The purer and.more refined a soul is in faith, the more infused .charity it possesses, and the more charity it has the more'the Holy Spirit illumines it and com-municates His gifts, because charity is the means by which they are com-municated,'''~' We see the truth of this in everyday life. Simple people of much love far surpass unloving intellectuals in basic wisdom. Diverse Origins of "Inner Lighls" There is yet another aspect to our problem, namely the origin of the enlightenment. Thus far we have supposed the light to come from God. Our theology of discernment of spirits speaks in the plural: spirits. St. John is of like mind. "Manifestly, then, these successive locutions can originate in the intellect from any of three causes: the divine Spirit, Who moves and illumines the intellect; the natural light of the intellect; and the devil who can speak to it through suggestion.":"-' While ~most people are willing to grant that .their own biases and preferences may suggest ideas to their minds, a goodly number may me~ely smile at the suggestion that the devil may be their origin. Even though this is not the place to adduce the ample biblical and magisterial evidences for diabolical reality and activity, it may be useful to point out that we do not pick and choose among, the data of divine revelation. Sound exegesis by all means. But nonetheless one accepts the whole Christ message or he shows that his criterion of acceptance or not is his own judgment rather than the divine word. After a review of biblical evidences, the Scripture scholar, Leopold Sabourin, concludes that "whoever reads"the New Testament with-out pr.econceptions or myth phobia should easily agree" that there is clear evidence of the existence of a personal hostile power and that this is an essential element in New Testament teaching. Sabourin also refers to e:,p. de Letter, New Catho'lic Encyclopedia, 12:446-447. .~oSee their works~ respectively Graces o[ Interior Prayer and Visions attd Prophecies. I also have touched on this point in "The Problematics of Discernment," Spiritual Li[e, Summer, 1974, pp. 135-147. .~lSt. John of the Cross, Ascent o] Mt Carmel, Bk 2, c. 29, #6; p. 205. .~-lbid., c. 29, :~ 11; p; 206. Review for Religious, Volume 35, 1976/2 Lyonnet's judgment regarding St. Paul's assertions on the devil: "To con-clude from these passages that Satan is for the Apostle a pure personifica-tion of the forces of evil would be to contradict as a whole the biblical and Pauline doctrine.''33 Our best theologians'write in the same vein. "The existence of angels," observes Karl Rahner, "cannot be disputed in view of the conciliar declarations (D 428, 1783). Consequently it will be firmly maintained that the existence of angels and demons is affirmed in Scripture and not merely assumed as a hypothesis which we could drop today.''34 If inner enlightenment may originate in other than divine sources, the question of discernment immediately arises. Can we know in a trustworthy manner the origin of our inner lights? Does the Spirit make Himself known? How do we detect Him? Whaf would be the signs of His activity as dis-tingnished from diabolical ,activity? Scripture, and especially the New Testa-ment, says so much about these questions that a mere article could not be adequate to report it all. Even less can a part of this article suffice. I may touch, however, only briefly on a number of considerations. Testing of the Spirits Jesus Himself leads the way to the later New Testament insistence that the spirits must be tested by the structural elements in the Chui'ch. The signal importance of this testing occurs, for example, in His prayer for Simon Peter. Significantly, this prayer centers on disturbances among the faithful caused by Satan. And the disturbances occur in the area of faith commit-ment. Jesus prays that after Peter's conversion he will strengthen his brothers and keep them firm despite satanic influences: "Simon, Simon! Remember that Satan has asked for you, to sift you all like wheat. But have prayed for you that your faith may n~ver fail. You in turn must strengthen your brothers" (Lk 22:31-32 NAB).3~ Jesus' prayer is always efficacious: what he prays for happens. Thus Peter's service in the Church is an effective faith service. While the devil does his best to disturb and dis-rupt, Peter tests him, unmasks him, overcomes him, protects the brothers and sisters in: their commitment to the Lord. It is obvious that Peter can confirm and strengthen in the faith only those who accept and listen to him. God forces no one. This is why St. Ignatius of Loyola, a leading figure in the history of discernment practice, considered the Successor of Peter the first tester of spirits and thus the last word on earth. This is why Ignatius (and other saints are of like mind) did not consider an important ~aLeopold Sabourin, "The Miracles of Jesus (II). Jesus and the Evil Powers," Biblical Theology Bulletin, June, 1974, p. 153. 34"Angels," Sacramentum Mundi, I : 32. aSSee Raymond E. Brownl Karl P. Donfried and John Reumann, editors, Peter in the New Testament, pp. 119-125. The Spirit Speaks." When and How? / 179 discernment process c.omplete until the Holy Father had approved the communal decision Ignatius and his companions had reached. St. Paul himself who received a direct commission from the risen Jesus nonetheless submitted his work to "the leading men" in Jerusalem to obtain their approval (Ga 2:2). Outer testing of the inner spirits is absolutely crucial if authentic enlight-enment is to be kept free of illuminist counterfeits and their bizarre conse-quences. o~Whatever else may be said about the illuminist, there is no doubt that no one can correct him. He is so sure of his privileged access to the mind of God that no other, not even Peter, can successfully point out to him that he is straying. Yet the very Spirit who speaks in our inner hearts has Himself established the outer structure to test the inner message. "Keep watch over yourselves," said Paul to the overseer-bishops of Ephesus, "and over the whole flock the Holy Spirit has given you to guard.' Shepherd the Church of God . . ." (Ac-20:28). The saints instinctively live this principle. St. Teresa of Avila, for example, a woman clearly led by the Spirit, strongly desired that, her works be examined and corrected and approved. Reaction Patterns It is interesting to observe the widely differing reactions people preseiat to the allegations that the Holy Spirit has spoken to someone or that He commonly enlightens from.within. We can speak of a reaction spectrum. At one end of it are those who ridicule the whole idea. They may be theists;~' but they just do not accept that God says anything particular to anyone. The objectivity of divine revelation is enough for them (though they may forget that the prophets and apostles had subjective experiences of God), .and so they look upon the charismatic renewal as a subjective enthusiasm. These people would probably pass up the present article because the title of-it indicates that the Holy Spirit does speak to men and women today. At the other end of the spectrum are those who readily believe that the Holy Spirit speaks. The~e people believe that ,He speaks often and that it is easy. to be in touch with Him. They tend to be uncritical and so are easily persuaded that their thoughts and desires and aspirations derive from God Himself. They would probably be attracted b3~ the title of this article but would tend to reject what I have said about the errors and illusions that abound in much of alleged "listening to God." Thus our subject is a touchy one. The Church's position lies somewhere in the midst of the two extremes of nothing or all. There are valid experi-ences of God and they are to be valued. He does enlighten those who are purified sufficiently to perceive His light. But there are also illusory experi-ences that are nothing more than unfounded persuasions. These can be found among people who are convinced that God is speaking to them, when as a matter of fact nothing of the sort is happening. Review for Religious, Volume 35, 1976/2 Practical Suggestions Supposing then that they are sons of God who are led by the Spirit of God (Rm 8:14), and yet that all things are to, be tested (1 Th 5:19-22), we may ask what this biblical position requires in everyday life. How does one tread the path of the golden mean between two extremes? 1 ) Hard-nosed evidence. While we should value the divine interven-tions in everyday life, we should not suppose them unless the biblical con-ditions are fulfilled. We do not presume, for example, that a proud or vain person is listening to the Spirit. Jesus has made it clear that the Father does not reveal His mysteries to the conceited but only to the little ones (Lk 10:21). A competent spiritual director looks for gospel holiness before he accepts that his client is "listening to the Spirit." This is why for centuries knowledgeable priests have discounted alleged divine phenomena in proud or disobedient people. Those who reject the outer word cannot be hearing the inner word. God does not contradict Himself. 2) No finite idea expresses God adequately and "thus we ought not to cling to it. One of the most valuable contributions offered by St. John of the Cross to this question of listening to God's voice can be missed even in a careful study of his work. It is that the most important element in most di-vine communications is not the clear idea, the detailed course of action to be followed. It is the love-penetrated touch of the divine in dark faith, a touch that itself communicates humility, love, prayer, strength, peace, joy. The most valuable gift God can communiqate to anyone is Himself, and He is no thing, no idea, no pattern of action. The Love Who is God is poured out0into our hearts by the Holy Spirit Who is given to us (Rm 5:5). Once we understand this we have gone a long way in understanding .John's severity in making so little of locutions and visions. The~saint recommends that the recipient of divine communications pay little attention to them, because if he gets attached to them, he feeds on them rather than on God.36 One likewise' begins to consider himself especially favored by God and,to look down on others who, in his opinion, do not enjoy this same enlighten-ing by the Spirit. The attachment can become a stubborn refusal to listen to anyone who may disagree because "I am listening to God." Clinging .to a finite communication, this person fails "to soar to the heights of dark faith.''3~ And in pilgrimage it is only in faith that we journey to the father-land (Heb 11"13-16). 3) Little attention is to be given to inner communications. I suspect that many people are surprised if not shocked at the attitude St. John of .~6The total renunciation demanded by Jesus is applicable here: "Unless a man re-nounce all he possesses he cannot be My disciple." (Lk 14".33) Even an idea about God is not God. '~rSt. John of the Cross, Ascent o] Mt Carmel, Bk 2, c. 18, #2; p. 160. The Spirit Speaks: When and How? / 181 the Cross takes toward inner enlightenments. He repeatedly advises the recipient to pay little attention, even no attention to them. The saint is so strong on this point that unless one is well acquainted with his whole teaching and life, he might conclude that John scarcely believed that God does communicate with the human person. Yet the saint, deeply believed in this .communication and in his own person enjoyed the very loftiest favors. Because his teaching is surprising to many of us, it may be well to offer here"a summation of it. We may first see two examples typical of the saint's statements of rejection, and then we will consider several reasons for the advice. Speaking of imaginative visions or "other supernatural communi-cations" received by the senses and independent of one's free will, John asserts 'q affirm that at whatever time or season (in the state of perfection or one less perfect) an individual must not desire to give them admittance, even though they.come from.God.''~s Later on in the same work as he discusses successive locutions the saint again says that "we should pay no heed to them, but be . . . content with knowing the mysteries and truths in~- the simplicity and verity~ with which the Church proposes them.'':''' This advice admittedly runs counter to what most of us. would expect. We would think that if God speaks,, we should pay attention, close atten-~ tion. We would consider a rejection of.the communication an insult to the speaker of it. Why is ~John (and other saints) of this mind? The first reason is the likelihood of illusion, deception. St. John o[ the Cross would surely agree that when God speaks, we listen carefully. This is precisely why the saint clings so tenaciously to Scripture and the teaching Church. Public revelation is sure and free from illusion and so is the teach-ing of the divinely commissioned Church, pillar of truth (l Tm 3:15). Private revelation is often not sure, that is, what is commonly thought to be revealed by God is not revealed at all. St. Paul was of this mind. He told the Galatians in no uncertain terms that even if .an.angel from heaven were to teach them something contrary to what they learned from human lips, they were to reject it (Ga 1:6-9). In other words, Paul was saying that such private "~revelation" was not revelation from God at all. When one pays much attention to "communications" he leaves the sure path of faith for the unsure path of "what 1 heard, what I received, what I see." History tells a 10ng and sad tale of the illusions that abound in this second path. Secondly, p,eop.le who are much concerned with God speaking within tend to neglect clear duties without. "On judgment day," says our Carmelite guide, "God will punish the faults and sins of many with whom He com-muned familiarly here below and to whom He imparted much light and 3Slbid., c. 17, #7; p. 158.- :~.~lbid., c. 29, -#:12; p. 207. Review for Religious, Volume 35, 1976/2 power. For they neglected their obligations and trusted in their converse with Him.''.'° John then illustrates his idea with. the words of Jesus, "When that day comes, many will plead with Me, 'Lord, Lord, have we not prophesied in Your name? Have we not exorcised demons by its power? Did we not do many miracles in Your name as well?' Then I will declare to them solemnly, 'I never knew you. Out of my sight, you evildoers!' " (Mt 7:22~23). Doing the Father's will (Mt 7:21) is more important than receiving special .favors from God. St. Paul repeats this truth when he tells the Corinthians that their most marvelous charisms (including the gifts of healing, miracles, tongues) are of,no value without love (1 Co 13:1-3). The Carmelite explains how spiritual directors shouldguide people in faith, not in supposed special communications. These directors "should explain how one act done in charity is more precious in God's sight than all the visions and communications possible--since they imply n~ither m~rit nor demerit--and how many who have not received these experiences are in-comparably .more advanced than others who have had many.''~1 This last remark is both sobering and comforting. A third reason is a core reason. I have said above that the deepest value in a. divine communication does not lie in clear concepts or blueprints for future action. It lies in a deeper drinking of the divine, a drinking that is general, dark, non-ceptual, love-immersed. If a person pays much atten-tion to the clear words or ideas he has "heard" at prayer, he is absorbed in finite particulars rather than with the God who ,is infinitely beyond even the best concept. In pilgrimage we' journey to God best not in clear ideas but .in dark faith; Paying little attention to "communications" is wise, fourthly, because a subtle vanity easily seeps into persons preoccupied with "listening to the Spirit" in a self-conscious way. Like the pharisee in the parabl.e (Lk 18: 9-14) they may begin to consider themselves unlike the rest of men. Need-less to say, this attitude is not one conducive to growth in love.'~ Fifthly, giving attention to inner communications carries with it the need to discern their origin, whether they come from God, the' devil, or' one's own unrealized desires.":' While the work of discernment is. advisable for important matters, one can hardly seek out a spiritual, guide and/or engage in long prayerful study for routine everyday affairs. If one is an avid "listener to messages,", the alternatives are a preoccupation with analysis or ¯ ~Olbid., c. 22, #!5; p. 185. ~'lbid., c. 22, # 19; p. 187. ~ '~-°"They think something e~traordinary has occurred and that God his spoken, whereas in reality little more than nothing will have happened, or nothing at all, or even less than nothing. If an experience fails to engender humility, charity, mortification, holy simplicity, and silence, etc., of what value is it?" Ibid., c. 29, .#5; pp. 204-205; "albid., c. 17, #7; p. 158. ' The Spirit Speaks: When and How? an unfounded assumption that "it all comes from the Lord." Even a saint does not assume the latter. Finally, the recipient of an.authentic communication from God does not need to pay attention to it in order to derive its benefits. This many people do not realize. God produces the good effects of His communication with-out the recipient being able to prevent it. "A person," says John, "cannot hinder the goods God desires to impart, nor in fact does he do so, except by some imperfection or possessiveness.''44 By renouncing all divine communications° (and John includes visions, locutions, fragrances, pleasures, words) "a. person takes from these apprehensions only what God wants him*to take, that is, the spirit of devotion, since God gives them for no other principal reason.''4'~ The same is true of the lesser assisting enlightenment.4~ Paying little attention to inner enlightenments' is for all these reasons a sensible reaction that combines a vivid faith in the indwelling Trinity with a sober refusal to succumb to a credulous illuminism. These reasons also explain the remaining bits of practical advice. 4) Use of reason as a source ~of light. God expects us to use ordinary means~ to achieve ordinary ends. If I break a leg, he expects me to get it set by a doctor. I may pray for divine healing but not at the expense of refusing ordinary medical help. We should surely pray for divine enlightenment but not at the expense of refusing to study and consult. Where .human reason is sufficient to solve problems "usually God does not manifest such matters through visions, revelations, and locutions, because He is ever desirous that man insofar as possible take advantage of his own reasoning powers. All matters must be regulated by reason save those of faith, which though not contrary to reason transcend it.''47 This is a mystic with his feet on planet earth. 5) A divine Message needs human approval. This advice is shocking. It seems the reversal of the truth: a human message needs divine approval. A distinction is in order. When the divine message° is public, it needs no approval other than that~ required by Christ Himself. That is, it needs the acceptance of no merely human court. St. Paul explicitly declared that it made not the slightest difference to him whether any human tribunal found him worthy or not (1 Co 4:3). Yet the same apostle submits his divinely received commission from the risen Lord to the authorities in Jerusalem (Ga 2:2, 6, 10). All the more when a divine message is a private revelation must it be approved by due authority. 441bid. "t51bid., c, 17, #9; p. 159. 46"The profit produced by a successive locution will not be received from focusing one's attention on it. Through such behavior a person instead would be driving away the locution." Ibid., c. 29, #7; p. 205. ~ ~ 4"rlbid., c. 22, #13; p. 184. Review for Religious, Volume 35, 1976/2 The New Testament.consistently requires supposedly divine communi-cations to be submitted to the approval of the Lord's representatives. This we already find in the earliest,New Testament document. The gifts of the Spirit are not to be suppressed but they are to be tested (1 Th 5:1.9-22). They who want to hear Jesus must be prepared to hear~His representatives; otherwise they are rejecting Him (Lk 10:16; Jn 13:20). The heretics at the close of the first century are known to be false prophets because they refuse to listen to the leaders of the ekklesia ( 1 Jn 4: 1, 6). St. John of the Cross, therefore, is asking no more than the New Testa-ment when he teaches that one ought not to do what a locution tells him un-less he receives a human approval. The saint does not tire of insisting on this biblical point: "We must be guided humanly and visibly in all by the law of Christ the man and that of His Church and of His ministers. This is the method .of remedying our spiritual ignorances and weaknesses. One should disbelieve anything coming in a supernatural way, and believe only the teaching of Christ, the man,~as I say, and of His ministers who are men . (In the Old Testament) the people were to believe that God spoke to them through the mouth of these prophets and priests and not through their own opinion.'''s John supports his teaching from St. Paul who demanded that the Galatians set aside whatever they think an angel from heaven might say in favor of what human teachers have taught (Ga 1:6-9). In tile. work of spiritual direction I consistently find that persons who give every sign of genuine prayer development and authentic holiness in-stinctively follow this practice, The Holy Spirit gives them the inner in-clination, even a felt need to submit the apparently divine communication to a priest in whom they can confide.4'~ This inclination may be taken as a sign of a genuine communication from God, whereas its absence suggests otherwise?° This advice is, of course, consistent with all else we h~ve studied above. Christ did not establish an angelism, an invisible Church. He takes our "bodyliness". seriously. He operates now both immediately through His Holy Spirit working invisibly and mediately through His human representatives ¯ ~Slbid., c. 22, #7, 8; pp. 181-182. ~.'~"God is so content that the rule and direction of man be ihrough other men, and that a person be governed by natural reason, that He definitely does not want us to bestow entire credence upon His supernatural communications, nor be confirmed in their strength and security until they pass through this human channel of the mouth of man. As often as He reveals something to a person, He confers upon his soul a kind of inclination to manifest this to the appropriate person." Ibid., c. 22, #9; p. 1.82. .~0The saint connects this'trait with humility: "This is the trait of a humble person: he does not dare deal with God independently, nor can he be completely~ satisfied without human counsel and direction." Ibid., c. 22, :~11; p. 183. The Spirit Speaks: When and How? / 1:85 worki.ng visibly. So great is the likelihood of illusion and misinterpretation in the subjective realm that an objective evaluation is indispensable. What should be done when a competent guide is not available we consider next. 6) Competent spiritual direction. A qualified and experienced guide when faced with alleged divine communications sees them, of course, in their context. He considers the recipient's lifestyle, whether it is character-ized by love, joy, humility, detachment, obedience. The Father and the Son do not reveal themselves to the unloving and the proud (Jn 14:21; Lk 10:21). St. Paul told the Galatians that what the Spirit brings to His own is not self-indulgence or temper or fa~ctions or impurity but rather love, joy, peace, patience, gentleness, self-control (Ga 5: 19-22). I find repeatedly in spiritual direction that a deep prayer life, a genuine communion with God indwelling, is invariably.accompanied by these New Testament criteria. The spiritual director usually does well not to make much of the com-munication reported to him (although he belittles neither the person nor the report). If the communication is from God, its chief good effects are already achieved. If it is not from God, the less attention paid to it the better. Religious still complain, as did St. Teresa of Avila four centuries ago, of the lack of knowledgeable spiritual directors. What should one do if he cannot find a competent guide? It is my opinion that in the area of advanc-ing prayer as also in this matter of alleged communications, no direction is preferable to probably incompetent direction. A great deal of damage can be done by well-intentioned but faulty guidance. St. John of the Cross seems to have been of the same mind. After advising that formal locutions should be manifested to "an experienced confessor or to a discreet and wise person," he adds that "if such an expert person cannot be found, it is better not to speak of these locutions to anyone, but simply pay no attention to them, for a soul can easily fall into the hands of some persons who will tear it down rather than build it up. Souls should not.discuss these locutions with just anyone, since in so serious a matter being right or wrong is of such importance.TM 7) Growth in ]aith. A pilgrimage people travels not by vison but by faith (Heb 11:13-16; 1 Co 13:12). Toward the beginning of this article we considered that when God deals with private persons (as distinguished from the publicly commissioned heralds of His revelation), He usually com-municates with them in the general know!edge of dark faith. Even when He may offer a specific message, He wants it confirmed by the appropriate human authority. The proximate means by which we are united to God is nothing finite and created. It is the adherence to God Himself revealed in His Word. The 51Ibid., c. 30, :~5; p. 209. 186 / Review lor Religious, Volume 35, 1976/2 stronger this clinging to Him, the more readily He communicates with the one clinging?-~ For St. Paul only the converted, the holy can detect the mind of God and know His perfect will (Rm 12:2). The more one is transformed by faith andlove the more God can pour out' additional light and love into his heart and mind. In this way we are transformed from one glory to an-other by the indwelling Spirit (2 Co 3:18). r"-"'The Holy Spirit illumines the intellect that is recollected," says John, "and He illumines it according to the mode of its recollection, and the intellect can find no better recollectt0n than in faith, and thus the Ho.ly Spirit wili not illumine it in any othei" recollection more than'in faith. The purer and more refined a soul is in faith, the more infused charity it possesses, and the more charity it has the more the Holy Spirit illumine it and communicates His gifts."lbid., c. 29, #6; p. 205. To A Benedictine Were you a dawn-rising monk in a black-robed hood Meditating in a Kansas winter wood? As you shuffled to chapel in bare, black sandals Lighting beeswax tapered candles-- Did you gaze into Christ's~bleeding eyes On His altar crucifix? And soul-long as all souls long for an unearthly Paradise As your hand touched His candlesticks? Later in your journeys all around the U.S.A.-- Did you study, thought-penetrate all people's problemed way? Did you want to reach the people when the people turned away? Did you find it very difficult sometimes to even pray? For God is ~never lost or ever far away . " But sometimes our paths seem hid and crossed, With clouds hiding tomorrowt darkening our future's way. Yet we know Redempti,on's garment must be woven By our own hands this very day, woven in Christ's design and way. Christ has a certain design, one that's yours, one that's mine, With His holy gift of time, He'll teach us to weave His way. If we don't forget to love Him, listen to what,His voice will say, He'll lift us up, overflow our cup. We'll find a brighter day. Mary Ann Putman 4422~.42nd Ave., S. West Seattle, WA 98116 Reflections on Our Congregation Sister Cecilia Murphy~ R.S.M. Sister Cecilia is Director General of the Sisters of Mercy in Pittsburgh. On the oc-casion of last All Souls~ Day, she reflected with her sisters on the "'many saints of our Congregation" and on the meaning of the Congregation itself. She resides at 3333 Fifth Ave.; Pittsburgh, PA 15213. We as a Congregation have some penetrating questions to answer. Among these questions are: What are we as a religious Congregation? What are we to each other? What is-our Congregational apostolic presence? What witness do we give as Sisters of Mercy? Does our life style reflect that of Christians who believe in the beatitudes and who strive, to live lives of ~simplicity? Do we feel the cost of being consecrated to God or do we dilute the suffering in our lives by compromises? Are ,we joyful people who live other-centered lives? Do we wish to grow and attracL new members? My most vital concerns about the Cqngregation center around questions like these. We must answer these questions as individuals and as a Congrega-tion. No General Director, no Council, no Policy,.Board can answer these questions. Each of us must assume the responsibility ,, to answer these ques-tions. ~ Our Decrees acknowledge the primacy of interior renewal. Are we really attentive to interior renewal? Our focus on external renewal is evident. Our external appearance,, our life style, our behavior patterns have changed greatly since 1966. What has happened to us interiorly? During the past nine years, many of us have suffered intensely from change. Through this suffering we have grown individually and as a Congregation. But, we now need to focus on some aspects~of our lives which need attention from each one of us. Personal prayer, without question, is an absolute necessity for each Sister. Never in our history .has the need for personal prayer been greater, 187 Review for Religious, Volume 35, 1976/2 and never have our distractions from prayer been greater. Prayer, as we all know, is not an obligation that we clock of[ at one-half hour periods; it is a way of life; it is a giving of ourselves to the Lord day by day despite the noises of our work and our relaxations. Why did we come to religious life? We must constantly seek to answer this question--not for some other Sister, but for ourselves. Do we as a Congregation witness to the value of prayer in our lives? Do people sense in me, an individual Sister of Mercy, that prayer is a priority? Do I ever take time for a day of retreat? Con-sidering the challenges to our life and to our spirit, these are not questions we can afford to ignore. These are questions that each of us must answer. I am firmly convinced that if we as a Congregation renew ourselves in-teriorly and face the question of personal prayer, we will not be predicting a rate of growth of one new member each year. We must be renewed in our commitment to personal prayer. Prayer presupposes some time for quiet. We live in a noisy world of TV, chatter, and many other noises, but we must remember that we need time and space for prayer. External stillness can help dispose us to God. This quiet cannot be imposed, but I ask eacfi Sister to contribute to a spirit of quiet and calm in her living situation. Thr6ugh this we can better stand before God, be ready for His word, and become more attuned to Him, more in touch with ourselves, our strengths, weaknesses, and potentialities. While we must pray alone, we must also pray together. Communal prayer t~or many Sisters is a source of concern and a disappointment. That in itself is a hopeful sign. I feel that there is a growing concern within us as a Congregation that we want and need to pray together: No one form of prayer will satisfy every Sister at all times~ But we have a right to expect communal prayer from each other. Each group of Sisters living together must continue to'be concerned and to make serious'efforts to pray together. It has been frequently said that communal prayer cannot be a forced situation, in which those who seldom communicate meet to*recite the same words. Prayer requires some union of mind and heart among its partici-pants. Thus, the need for rehewal in prayer touches on vital questions of community, of what we are to each other. By membership in the Congregation we share a bond of religious dedi-cation and a commitment to common ideals~ Sisters of our Congregation should be "special" to us even though we may not share their life Style or dress. We MUST be kind to one another. We cannot destroy each other. We must begin to 'realize that our conversations, our attitudes of hopeful-ness and joy or of complaint and negativism can cause 6thers to be strength-ened and rejoice in their vocations or to lose heart 'and wonder what re-ligious life has done for us. Our attitudes are conveyed in subtle 'ways; our words also tell others how we feel about them and what our values are. We must, if we'are to survive or deserve to survive as a Congregation, take careful account of our attitudes toward each other and toward the Congre~- Reflections on.Our Congregation / 189 gation. Catherine McAuley gave us a legacy of union and charity.Thus, we cannot spend our waking hours, our phone and table conversations gather-ing information ,about other Sisters, judging each other, and using leisure time in pettiness. There is NO time for this. We have;been called to be apostles, to spread, the "good news," to be "good news" to others. None of us, regardless of age or occupation, is exempt from this responsibility. Each of us needs to ask herself: Am I good news to others? Do Sisters consider me a strengthening factor in Congregational life? None of us has a perfect record in this regard. But let us begin again. Let us try to be more aware of our words and attitudes, more supportive of each other, not just as we do so well in times of death and sickness, but every day. Let us likewise reflect upon our attitudes to others outside the Congregation. Are we prejudiced? Are we concerned about others who lack the necessities of life? Are our values really Christian? Living religious life is not easy. It costs a great price. In the New Testa-ment we learn from Christ the cost of discipleship. He was hated, con-fronted, and crucified. He was, for all human purposes, the greatest failure the world has ever known. He did not come to bring us suffering but to teach us how to live with it. To His~ disciples He said: "Take up your cross and follow me". "Unless the seed die, it remains alone". "Un-less you deny yourself . . . " Christ did not igreach an easy message. He did not call His disciples to a life of comfort and security. He said: "The Son of Man has nowhere to lay His head". "the servant is not greater than his Master." It is never easy to be a disciple. It we are comfortable, satisfied and complacent, we have great cause for concern about our Con-gregation. No one who tried to fulfill the will of God did so with comfort and satisfaction. I see in our Congregation some need for each of us to reflect on the meaning of the cost of discipleship. Have I personally lost sight of who I am called to be? Have I compromised and rationalized so that I can have the best of two worlds? I cannot look at another Sister and judge what she has done. I must look at myself. When the Church abrogated the Lenten fast, she intended that we impose new personal penance upon our-selves. Do we do this? The human condition has not changed, nor has our need for self-denial. Each of us is, a sinner and the more we know of God, the more we know how sinful we are. None of us is perfect nor can we forget that we need to make conscious responses in self-denial. Catherine McAuley founded her Congregation on Calvary to serve a crucified Master. Each of us has a share in that mission by our member-ship in this Congregation. Catherine McAuley held ideals of service like: "God knows I would rather be cold and hungry than that His poor should be deprived of any consolation in our power to afford." Is this a reality in my life? Am I willing to be hungry, even occasionally, that others may eat? These are the kinds of questions we must face if we are to be true to the 190 / Review ]or Religious, Volume 35, 1976/2 spirit of Catherine McAuley. We need God desperately and we need each other desperately. We need to 'be willing to experience conversion personally and as a Congrega-tion. We must be willing to pay the price for this conversion. ~ We can and must be a tremendous potential for good in the Church and the world. We can and we must witness to each other and the world that material goods are NOT the source of our joy nor the values on which we spend our "energies. We need to reflect simplicity--not in a judgmental or self-righteous way but in a spirit of who we are called to be. We can~and we need to reflect a joy'that comes from living with Sisters of joy who belong to God and who are free to be faithful in celibate love. We must focus on what we are to each other in community, We must share not only our goods but ourselves. If we have any struggles today and. are to attract new members to our Congregation, I am convinced we must experience interior renewal and unity of purpose. We know that God is faithful and that He will help us in this. Let us unite together as a Congregation, renewed in our purpose to pursue conversion. May God grant each of us light, strength, patience, and courage so that individually and corporately we will be strengthened to spread the good news, to further God's Kingdom, to be vital Sisters of Mercy. A More Authentic Poverty Horacio de la Costa, S.J. At the time of the 32nd General Congregation of the Society of Jesus, Ft. de la Costa was one of~the four General Assistants to Fr. Arrupe. Subsequent to the Con-gregation, he was able to return to his beloved historical studies and writing, center-ing on the history of the Church in the Philippines. He resides at Xavier House; P.O. Box 2722; Manila 2801; Philippines. A consideration of the D~cree on Poverty of the 32nd. General Congrega-tion of the Society of Jesus must begin with a word about its background. The General Congregation immediately preceding, the 31st, decided that Jesuit legislation on poverty should be brought into conformity with the dispositions of. Vatican II, but at the same time perceived that this would be better done not by itself but by experts reflecting on the matter over a period of time. It therefore elected what are called definitores to draw up Statutes on Poverty which would become Society law, on the authority of the General Congregation itself, upon approval of the. Superior General. In 1967¢ Father General Arrupe approved these Statutes. The 31st General Congregation had provided, further, that the 'Statutes thus adopted be submitted for review to the next General Congregation. Ac-cordingly, Father General Arrupe, having decided after the Congregation of Procurators of 1970 to convene the 32nd General Congregation, ap-pointed a study commission to go over the Statutes and ~:ecommend possi-ble improvements. Some of the delinitores sat in this commission also. Most of its members were moral theologians, jurists, or administrators. Some months before the Congregation convened, Father General expanded the *This article is :being published simultaneously in the current issue of Jesuit Studies (The American Assistancy Seminar in Jesuit Spirituality) entitled: "On Becoming Poor: A Symposium on Evangelical Poverty." 191 Review ]or Religious, Volume 35, 1976/2 membership of tffe commission to include experts from other disciplines and areas of experience. The 32nd General Congregation constituted from among its member-ship its own Commission on Poverty: Commission III. Some of the mem-bers of the pre-Congregation commission, being also congregati, were elected to Commission Ili. Very broadly speaking, it can be said that for the jurid-ical aspects of the' present Decree, the Congregation relied chiefly on the work of the pre-Congregation commission; for its pastoral aspects, on its own Commission III. The Decree itself is divided into three sections. Section A is a declara-tion of what Jesuit poverty should be today in the light of prevailing con-ditions in the Church and in the world. This declaration sets forth the as-cetical and pastoral principles on which is based the dispositive part of the Decree, Sections B-F. Section B, "Norms," gives the prescriptive guidelines for a revision of the Statutes on Poverty, to be undertaken by a commis-sion appointed by Father General, who is to approve and promulgate the revised Statutes. Sections C-F are supplementary provisions concerning certain aspects of the new juridical structure which is being given to the Jesuit practice of poverty. A prinCipal objective which the pre-Congregation commission set for itself was to simplify Jesuit legislation on poverty. It was observed that over the years numerous alterations had been introduced into the primitive legis-lation of the Ignatian Constitutions, usually by obtaining an indult, that is, an exception to the law, from the Holy See; for instance, the indult whereby Jesuits are enabled to accept Mass stipends. Another~ kind- of deviation from the primitive legislation was that of certain accepted anomalies; for :instance, houses of writers.: A house of writers is not, strictly speaking, a "college" in the sense of the Constitu-tions. It is not a house of formation, the only Jesuit institution to which St. Ignatius allowed fixed revenues. Later, however, houses of writers were also permitted fixed revenues, on the grounds that they cannot otherwise carry on their valuable apostolate, since the kind of books Jesuits write are very seldom best-sellers. Similarly, there was no provision in the primitive legislation for the care of the sick and the aged. These were therefore assigned to the same juridical category as the Jesuit seminarians ("scholastics") supported by the colleges. In effect, those retired from the active apostolate were equated with those who had ~not yet begun it, and the arca seminarii, or formation fund, did double-duty as a social-security fund. . There were also accepted ambiguities which amounted to legal fictions. For instance, missionary priests in the Spanish colonies--at least up to the time the Jesuits were expelled therefrom (1767)--received fixed yearly stipends from the government. In the Philippines, this stipend was 100 silver pesos and 100 [anegas (bushels) of rice a year. This was by no means A More Authentic Poverty / 193 a pittance. A silver peso in those days was really made of silver, and its purchasing power was probably a hundred times that of the present metal-alloy peso. At any rate, each missionary priest was able to support with his stipend a missionary ~brother,~and still have something left over toward building a parish church and a parish, house. Now then: this stipend can, with a little stretching of meaning, be called an alms. But the government, and almost everybody else, considered it a salary--so.mething which the Constitutions did not allow for, especially with reference to spiritual min, istries, the normative maxim for which was. to "give freely what you have freely received." A more recent example of ~this ambiguity is the~ salary received by military and hospital chaplains. Military and hospital chaplaincies are certainly valuable, even necessary apostolates, But in many countries of the world, 'the civil law does not allow anyone to become a military or hos-pital chaplain unless he accepts a salary. It does not allow him to give freely what he has freely received. Finally, there was what looked like downright violations of th~ law to those Who ttid not understand or appreciate the need from which they arose. How, ,for instance, was the glorious Japanese mission of the Old SoCiety, founded, by Xavier himself and so fruitful in martyrs, supported?~:Why, by the fantastically .lucrative Macao,Nagasaki silk trade. ,.Portuguese inv~estors in the trade would invest sums for, or on behalf of, the Jesuit Provin(~'of Japan, and the profits from these investments were. what supported' the Province's catechumena~es, houses of formation, mission station~, printing press. Were they alms? Were they fixed revenues? Or were they negotiatio vetita, commerce forbidden to clerics? All these complexities seemed to arise from the fact that thoroughly ~alid and even absolutely essential apostolates could not be undertaken or main-tained without such departures from the primitive legislation. And 'the reason for this was the difference in economic, social, and juridical struc-tures between the modern world, the world that emerged from the Indus-trial Revolution, and the late-medieval world, the world of St. Ignatius. There are all-pervading socioeconomic realities we must take into account today which St. Ignatius and his first companions almost certainly did not foresee. Here are some of them. In many parts of the world, Western and non-Western, capitalist and socialist, there is a decline in the witness value of mendicancy. Living on aims is rarely if at all considered an effective witness to iapostolic fi'eedom and trust in divine Providence, Accompanying this decline is a correspond-ing appreciation of the ethical and social value of work, and of wh.a.t are generally considered to be the natural adjuncts of working for a living, such as the provident setting aside of savings for the future, and the invest-ment of such savings in economic enterprises that generate income. Another difference to be noted between St. Ignatius' time and ours is 194 / Review lor Religious, Volume 35, 1976/2 the decline in the modern world of the temporal power .and wealth of the Church,-and the dissolution of medieval forms of union of Church and State. It is no longer possible,for large-scale apostolic enterprises to be financed by endowments granted by pope or prince, by cardinal or'con-quistador. How are large-scale apostolic, :enterprises financed today? Mostly by smal! private donations derived chiefly from the middle class: the people; neither rich nor poor, who enable o religious institutes to train,their seminarians and establish foreign missions. It is a fact, to be acknowledged with gratitude, that in the world as it now is we, depend almost entirely on the bourgeoisie for the financial viability of our apostolic enterprises. On the other hand, we r~eligious are called to live not precisely as bourgeois but as poor men and women. How do we do this, in the world as it now is? How do we set up a structure~for our poverty that will be simple enough and practical enough to enable us to carry on our ministries effectively, and yet live poor? ~ ~ The pre-Congregation commission on poverty mentioned earlier pro-posed that one way of doing this was to accept the basic distinction be-tween communities and apostolic institutes, .a distinction already Sketched out by the definitores of the Statuta of 1967. The 32nd General Congrega-tion ac6epted the :distinction, along with the juridical implications spelled out by'the commission.1 In fact, the Congregation made that distinction the "keystone" of its "reform of the structure of temporal administration.":-' There are, of course, preblems raised by this revision of structure, or foreseen as'following upon it. That is why the Holy Father directs that the Decree be put into practice ad experimentum, so that the. next General Congregation "can re-examine the entire question on the basis of the .experi-ence acquired in the years to come.''3 But ~where the religious life is.con-cerned, juridical structure is usually consequent on a spiritual discernment. In the present case, that discernment is set forth in the expository portion of the Decree (Section A), to which we now turn. The 32nd General. Congregation confirms the findings °of its predecessor on the basis of a review of the Societyrs experience during the decade inter-t" By the law of ~the Society there is to be established a distinction between com-munities and apostolic institutes, at least with regard to the destinatibn and usu-fruct of 'their goods and between the financial accounts of each."--Decree of Poverty B III 1. Apostolic institutes are defined as "those institutions or works .belonging to the Society which~ have a certain permanent unity and organization for apostolic pu,rposes, such as universities, colleges, retreat houses, and other such in which Ours cai'ry on their apostqlic work."--ibid. B I 2. "Th~ goods of apostolic institutes of the Society may not be diverted to the use or profit of Ours except for a suitabl~ remuneration, to be approved by the Provincial, for work in such institutes or for services rendered to the same."--ibid: B IV. ~-lbid. A IV I 1. '~Jean Cardinal Villot to Father General Arrupe, 2 May 1975, n. 5. A More Authenti¢ Poverty / 195 v~ening between them. These findings are chiefly three. First, that our pres-ent pra~ctice of evangelical poverty, falls short of. the norms .established by St. Ignatius and the first companions, and hence, that we must resolutely and perseveringly undertake a renewal of the spirit of poverty according to the specifically Ignatian inspiration. Second, that while we must~ by all means keep the primal norms of~.our poverty intact as far as their substantive de-mands are concerned, we must also adapt them to,the socioeconomic and juridical conditions of our time, very different from those of the time when St. Ignatius and the first companions established them. In other Words, our renewal of the spirit of poverty must be accompanied by a certain adaptation of structures and procedures; it must be a renovatio accoramodata. Third, that in the matter Qf poverty, as in other matters, ,spirit and structure are intimately interdependent; that while the spirit of poverty needs a structure to support it, safeguard it, and make it operative, the structure wilPnot work, will become dead-weight and dead-letter, unless those involved in the structure are imbued with the spirit of poverty and are resolved to make the structure work. The determination of the surplus income of 'a community might serve to illustrate this third finding, namely, the interdependence of spirit~and structure. The surplus income of a Jesuit community cannot be retained. It must be disposed of annually.4, By surplus income iS o meant what is over and-above the expenses and the contingency fund. provided for in the annual budget of the communit~y as determined by its "responsible administrator" with the appr.ovai of the provincial superior.~ The norm for estimating the annual budget is a community style of.life "removed .as far as possible from all infection of avarice and as like as possible to evan-gelical poverty.''6 Ultimately, therefore, this whole rrgime of placing the community on a budget and disposing of annual surpluses will depend on the style of life adopted by the community. It will depend oi~ how seriously the community tries to live up to the norm set by the Congregation, namely, that "the standard of living of our houses should not.be higher than that of a family of slender means whose providers must ,work. hard for its support.''r In a word, it will depend on how much alive the spirit of poverty is among us. For, as the Congregation. says; "While law can support spirit, no legal re-form will profit anything unless all, .our members elect evangelical poverty with courage at the invitation of .the Eternal King, Christ our Lord.,8 , 4Decree on Poverty B VII 1. 51bid. B VI. ~Ibid. B VII 1. rlbid. A llI 7. 8Ibid. A V 13. 196 / Review ]or Religious, Volume 35, 1976/2 The norm for our standard of living just ~ited may in ~turn serve to illus-trate the second 'of the findings mentioned above, namely, the need for adaptation. It is stated that our standard of living can be lower, but not higher than that of "a family of slender means." Yes; but what are "slender means"? What does "slender" mean? One particularization of the term follows immediately: a family of slender means is one whose providers must work hard for its support. This would seem to exclude unearned in-come, that is, income from'invested funds, at least as a principal source of support for our communities. It would seem to imply that our communities should derive their day-to-day support from the earnings of the day-to-day work of their members. Here is one example of the adaptation to the changed conditions of the times noted earlier. The Congregation itself calls attention to it: "For cen-turies, the perfection of religious poverty was found in mendicancy . He was .counted poor who lived on alms, placing all his hopes in the provi-dence of God operative through benefactors. With growing clarity the Church invites religious to submit to the common law .of labor. 'Earning your own living and that of your brothers and sisters, helping the poor by your work--these are the duties incumbent upon you.' '''~ This may possibly explain why the Congregation does not have'recourse to the gauges or measuring rods of religious poverty devised in times past. Such ~as, that religious poverty is a poverty of dependence~. dependence, in the first instance, on the superior, but through him, dependence on the providence of God "operative through benefactors,'--that is, dependence on alms. The emphasis today is not on alms but on work. Or again, that our poverty should be assimilated to that of honesti sacerdotes, reputable secular priests; for while the reputable secular priests of former times did live very slenderly, they were nevertheless supported by "livings,~' that ig, stable revenue derived chiefly from landed property. However, it must not be thought that the Congregation excluded mendi-cancy-~ dependence on alms for support--altogether. Neither did it sup-pose that religious who live on alms do not work. We should give it credit for a certain measure of realism. It is a fact that many of our, hardest work-ers are dependent~ on alms for their support; for instance, missionaries. It is also a fact that in certain regions of the world today, for instance, in those countries behind the Iron Curtain where the Church is permitted tO exist~ Jesuits can live and work only i~ supported by free-will offerings. And it is equally a fact that even in those regions of the world where the right of the Church to exist is recognized, much of the work we have to do as ministers of the Gospel does not have a financial remuneration attached to it. Thus, while we should by all means adapt ourselves to the work-ethic of our time, we should guard against pressing too closely the work-income ~'lbid. A II 4, citing Vat. II, PC n. 13, ET n. 20. A More Authentic Poverty / '197 nexus. It is my impression~ that the Congregation was fully .aware of the dangers of doing so; fully aware that it could introduce among us what usually accompanies the work ethic, namely the market orientation. It is not too far-fetched to foresee an evolution of attitude after this fashion: One begins by looking around for compensated.work in order to be able to contribute to the support of .one's community. One goes on to. prefer compensated to non-compensated work, the apostolic value of the Works being roughly ~equal. A gradual, perhaps a very gradual, an almost imper-ceptible reversal of values then takes place, whereby the value of apostolicity becomes Jsecondary to the value of marketability. Such a process might even end up with an alternative version of Surplus Value, namely, that wages represent an apostolic "surplus" over and above the apostolic value of the work itself, and hence that the better compensated work is the more apostolic work. Besides vitally affecting our choice of ministries, a too rigid interpreta-tion of the duty of ~"earning your.own' living and that of your brothers and sisters" could introduce in the Society--int~ormally, to be sure, but palpably another system of grades, one based not on presbyteral function but on earning capacity. Those engaged in gainful employment and thus con-tribute to the,support of the community would, for all practical purposes, be the professed; those not thus engaged, and hence are supported by the community, °would be the coadjutors. Such a stratification would tend to bring our c"0mmunity life down to a purelyhuman level, and may well have disastrous consequences: assumption of privilege by the ~gainful workers, frustration and resentment on the part of the "unprofitabl~ servants." Are these purely conjectural hypotheses, or do we perceive them even now, in certain parts of the Society, as a~ cloud no bigger than a man's hand? At any rate, we have from the'Congregation a reminder that the adoption of the work ethic--as, indeed, the adoption of any valid principle of action--involves risk. "The frequent engagement of Ours in professions and salaried offices it not without dangers, not only for the spirit of gratu-ity, but even, for the observance of common life itself. SuCh work is to be chosen only as a more effective means to the communication of faith, with-out thought of remuneration or of the privileges attached'to an office.''1° But to get back to the slender-means norm. Besides the fact that it.is means acquired by work, present hard work, rather than a stable income from invested funds, what other nuances can give it sharper definition? Perhaps this, that it should be a deliberate renunciatibn of consumerism, of "the appetite for enjoyment and consumptign of material goods" which, as the Congregation points out, "spreads everywhere and verges on a prac-tical atheism.''11 At least that. "At the very least, religious poverty should lOlbid. A III 8. 111bid. A II 3. 198 / Review ]or Religious,~ Volume 35, 1976/2 try hard to limit rather than:, to expand consumption,!~ :says. the Congrega-tion. 1-° ,.~ Another. nuance of the :slender,means norm is that our style Of life should be pitched at a level which enables and encourages us not only to work for t.h.e, poor but with ithe poor. In order to do that~ we need to i"acquire some experience of their condition;" and even of their "miseries and distress." This, the Congregation says, is a necessary consequence of the basic option we have made regarding our apostolate today, namely, "comniitment to the cause of justice and to the service of the poor.''13 It is with this nuance that the Congregation repeats ,St, 'Ignatius' injunction "to love poverty as a mother and, within the measure of holy discretion, experience some of its effects as occasions arise. Here, then, are some of the specifications that might make the slender-means norm of our voluntary poverty less abstract, more applicable to real, life .situations: Our style of life should be that of the worker rather than the rentier;.it should put out: of our reach the open-ended self-indulgence of . the consumer society; it should afford us some~direct experience of what the involuntarily poor of today have to put up with, so that we can the more realistically and effectively help them to help themselves. I must con-fess, however, that even so, for me personally, the slender-means norm remains somewhat 'fuzzy around the edges. And I think I see:the reason why in ~a statement in obliquo of the Congregation itself. It expresses regret that we have no other word.to designate the poverty of ~the.~)religous life except the word "poverty." This is regrettable ~because "poverty means very different things to different people.''.~ Indeed it does. Not only that; different people (and therefore different Jesuits) can hold their different views of poverty honestly and sincerely, without hy-pocrisy or cynicism. Further: the reasons why they hold these different views are not always myths but often realities. Thus, a Jesuit style of life really and truly considered poor in Australia or West Germany may well be considered really and truly :affluent in Ecuador or Indonesia; not neces-sarily because Ecuadorian and Indonesian Jesuits are religious of strict ob: servance, while Australian. and West-German Jesuits are religious ~ of lax observance; but simply because of~ the .difference between "a family of slen-der means" in the developed world and the corresponding family in the underdeveloped world. ~ Consider, too, the fact, or at least the possibility, that the type of apos-tolate to which a Jesuit is sent has, perhaps should have, an influence on his style of life; an influence that leads, perhaps inevitably, to a difference ~Z.lbid. A III 7. ~. ~'~lbid. A II 5, A III 10. ~Const. [287]. ~SDecree on Poverty A I11 7. A More Authentic Poverty / 19,9 in standard of living. Thus~ it might be asked whether the:style of life of Jesuits teaching in the Gregorian University~ in Rome should be, or can be exactly that of Jesuits working among the marginados in Venezuela. The classical.: precedents invoked by those who favor a difference are will known. Among ~he missionaries of the Old Society in India, was there not a sign~ificant difference in style of life between those who worked among the brahmins and those who Worked-among the pariahs? And what about the drastic change in style of life adopted by Xavier in Japan, when .he learned that the Japanese paid scant attention to mendicants but might possibly give a hearing to an hidalgo? Equally-familiar are the precedents brought forward by those opposed to recognizing such differences. Ignatius' instructions to Lainez and Salmer6n, papal theologians at the Council of Tre~nt, that they should not follow th.e life style of the Council Fathers, but should work in ,hosEitals as orderlies, preach in city squares without a Stipend, and beg their meals fromo, door. to. door. The example of Ignatius, himself, when, he returned to Loyola from Paris: refusing to stay in?.the ancestral castle with his brother, he chose to dodge in the town infirmary, considering it a better platform from which to. persuade his fellow citizens to the service of faith and~ the promotion of justice. There is, then, an ambiguity--a necessary ambiguity, as ,iLseems--in the general norms proposed .by the Congregation; and the Congregation. admits it. Not only does it recognize that poverty can mean different things. to different people, but in ;recommending "the insertion of communities among the poor" as '.'a testimony of love of the poor and of poverty to which the Church encourages religious," it calls attention to the fact that "implehae.ntation of this proposal will have to be different in our widely. diff,ering circumstances.''I~ What it is saying, in effect, is that the slender-means~ norm can mea.n different things to different communities., o Thp practical conclusign that follows from this is that it is up t'o the discernment of local and provincial_ communities to ensure that, taking into account differences in socio-economic context and apostolic commit-ment, our poverty is, and is .seen to be, the poverty of Christ. It is to the same practical conclusion that the Congregation comes in the other major areas of our life and apostolate.17.The crucial role which the Congregation assigns to discernment, personal, and communitarian, in the process of translating its decrees from paper to practice,~, clearly appears in that it recognizes discernment as an, ingredient of Jesuit identity,18 _.and giyes,~ex~, t.ended treatment to it as a feature of our community life.1:' ~ This brings us to what was mentioned earlier, as the first of the~ findings ~lbid. AIlI 10. ~TGC 32, "Our Mission Today," n. 71; "The Formation of Jesuits," n. 22. lsGC 32, "Jesuits Today," n. 19. ~ ~:~GC 32, "Union of Minds and Hearts," nn. 21-24. ~ 200 / Review 1or Religious, Volume 35, 1976/2 of the Congregation on Jesuit poverty, namely, the need for a renewal of the spirit of our poverty as conceived by St. Ignatius. A first observation and an Obvious one is that we h~ave vowed ourselves as religious to evangelical poverty, that is, the poverty proposed by the Gos-pel as a counsel of perfection~ and adopted by Christ~ himself. Hence, a first distinction, equally obvious, must be made between our voluntary poverty and the involuntary poverty that afflicts so large a portion of the human race. This inhuman and dehumanizing poverty, frequently imposed by in-justice, is an evil. It cannot be the object of a vow. It is not the poverty we embrace, it is the poverty, we must fight. Religous poverty is evangelical, not necessarily sociological. Not necessarily; which leads to a second observation. All religious in-stitutes are followings of Christ, but each religious institute follow~ Christ in its own way, according to the charism of its founder. Of St. Ignatius it may be said that his way of following Christ is pre-eminently the way of service, of apostolic service. We belong to a Society which~"'is founded for this purpose above all . the defense and propagation of the faith" :and any kind of ministry whatgoever that shall be "for the glory of God and the common good.''~° Our poverty, then, as everything about us, is-~or is meant to be apostolic. We embrace poverty not for its own sake, as another religious institute well might, but in function of the apostolate. St. Ignatius' phrase praedicare in paupertate--to preach in poverty--must, I think, be ~understood in this sense. We are to be poor that we may all the more effectively preach. The images in which St. Ignatius embodies his notion bf poverty seem to suggest as much. For Francis of Assisi, poverty is the Lady Poverty, the lady of a troubadour, a loveliness to be loved for itself alone. For Ignatius of Loyola, on the other hand, it is "the firm wall of rrligion"; fortifications designed to defend an intra muros, an area of peace in which to build the City of God. And we must love poverty, ~ertainly; but "as a mother": a mother who gives birth to a .life, nurtures and trains it, not to keep for herself but to send forth: a life that will be something of value in the world of me'n.21 In the world of men today, that something of value is, for us Jesuits, a commitment to "the service of faith, of whii~h the promotion of justice is an absolute, requirement.''z2 Hence, if the promotion of justice should i'equire in-some place, at some time, the "insertion of communitiesamong the poor," if it should summon us "to live among the poor, serving them and sharing something of their experience," something of their "miseries and Z°Form. Inst. n. 1. 21Cf: Const. [287], [553]. Z2GC 32, "Our Mission Today," n. 2. A More Authentic Poverty / 20_1 distress,'''-''~ then we .must. by all means do so, but with a clear understand-ing that such poverty is a degradation not an enhancement of the"human condition, and that we embrace it for the sole purpose of h.elping our fellow-men to free,themselve.s from it. In a word, ev.angelical poverty is not neces-sarily sociological poverty, but may demand acceptance of it in.function.of the apostolate. This brings us to a third observation, na~mely, that if our poverty is in function of the apos_tolate, then it is what might be called a "functional?' poverty. It is, in level, form and style the poverty that best serves our apos-tolic ends. Its measure is the tantum-quantum of the Exercises.-"4 That is why the Congregation begins its declaration on poverty with a "reflection on the Gospel in the light of the signs of our times"; or so it seems to me. It seems to me that the Congregation, faced with the task passed on to it by its predecessor of answering "the demands of a real and not pretended poverty," did not begin by asking the question "What should our poverty be?" but by asking the question "What should our poverty be ]or?'''~'' From its reading of the signs of the times, the Congregation brings for-ward certain apostolic objectives which our poverty should by preference bear witness to or serve. At a time when nations, groups, and individuals ha~,e come to realize that .the material resources of this planet.are limited, and have reacted to that realization by accepting as a fact of life that the race is only to the swift and the devil takes the hindmost, vowed poverty should be, and be a witness to, sharing. "On fill sides there is felt a desire to discover new com-munities which favor a more intimate interpersonal communication, com-munities of true sharing and communion, concerned for the integral human development of their members. Our lives, our communities, our very poverty can and should .have a meaning for such a world.'''-''~ That meaning and message will be effectively conveyed by "a poverty pro~foundly re~ newed . . . happy to share with each other and with ,all.'''7 In fact, "our communities will have no meaning or sign value for our tim.es, unless by their sharing of themselves and all they possess, they are clearly seen. to.be communities of charity ,and~ of concern for each other, and all others.''-~ Secondly, at a time when human .fulfillment tends to be equated with the possession, enjoyment, and consumption of material goods, vowed poverty should point in the opposite direction. It should point to. simplicity: :.~Decree on Poverty A II 5, A III 10. :4Cf. 'Spir. Ex. [23]. '-"~Cf. Decree on Poverty A 1I 3-5, A III 7. '-'Olbid. AlI 3. "-'Zlbid. A V 14. "-'Slbid, A II 5. 202 / Review [or Religious, Volume 35, 1976/2 a "simpler way of 'life," ~"simple in community expression and joyous in the following of Christ," and by this witness openin~ up to men "a new liberty and another happiness.''-~'~ Finally, at a time when the struggle for justice often means a~ struggle against unjust establishments, a disengagement from the affluent and power-ful elites from which we have received, and perhaps continue to°receive beriefacti6ns, vowed i56verty must have and be-seen to have a detachment that makes it credible. "It will be difficult for the Society everywhere to forward :effectively the cause of justic~ and human dignity if the greater part of her ministry identifies her with the rich and powerffil.'''~'~ That most be the touchstone of our credibility: detachment. "The attitude of the So-ciety should b~ that of the Third Class of Men. fully as ready to abahdon as to retain, to the greater service of God,''3~ manifest' in a povei'ty that is "apostolic in its~active indifference and readiness for any service; in-spiring our selection of ministries and turning us to those most in need?':~°- In sum: the,selfless sharing of a simplicity of life that leads to integral human developm6nt and, by its realism, gives credibility to our efforts to remove the obstacles tO that development--this is what the Congregation proposes our poverty should be today, as discerned frorri the Signs of the times: ~But in qchat'~sense is this a renewal, a making,new again, a return to what the Society was when it was new? This brings us back to'a point which came up earlier: the crucial role given by'this Congregati~on to discernment. For if it 0is admitted that ours is a functional poverty, a poverty in function oLthe apostolate,~then the authentic practii:e of that~poverty will depend at any given moment on what we discern to be,the Conc?ete objectives~of our apostolate at that moment; in short, on "our mission today." And this adap-tation is truly a renewal--so, at least, it is argued because it is precisely what St. Ignatius did. ~ ~. What Ignatius did was to giv meaning and structure to" the practice of' voweff poverty which was in function of what he discerned: to be the apos-tolic needs Of his time. He then wrote Constitutions which not-only do not forbid but demand that we practice our poverty in the light of a' similar discernment. What was his discernment? We might illustrate how concrete it was by its apparent c6ntradictions, for it is a'well-known fact that the concrete and its demands do not always meet the requirements of abstract logic. Ignatius made Jesuits in professed houses live from day to day and "-'albid. A II 3, A V 14. :~°Ibid. A II 5. 3~Ibid. AIII 9; cf. Spir. Ex. [155]. :*°-Ibid. A V 14; A More Authentic Poverty / 203, even beg from door to door; but he allowed fixed revenues for colleges, that is, the houses where Jesuits were being trained to live from day to day and beg from door to door. He would not permit the sacristies of our churches to be supported by such revenues, but-the churches themselves, Works of art which might be considered verging on the lavish,.he accepted from, or consented to be constructed by, benefactors belonging to the affluent establishments of his time. He did not favor our men going on horseback, even if they were on a mission and in somewhat of a hurry; yet he decided that professed houses should have a garden for our men to walk in. A garden! Why, certainly; a garden in cities where the ordinary citizen took the air in open sewers 'which, by an exaggeration of courtesy, were called streets. But, after all, was not Ignatius following in this matter the example of Christ himself? Christ, who regularly skipped meals because of the poor, the sick, and the bedevilled who pressed around him, but who told treed Zacheus to come down from his perch and give hil~ lunch in his house, the ~ather well provided house of an officer,of the internal revenue. Christ, who did not even have a foxhole or a bird's nest where to lay his head, but who, on his way to or from Jerusalem, regularly stopped_ at Bethany, in the house of the opulent Lazarus; who did this at lehst once with his entire entourage, seemingly unannounced, for he sent Mhrtha into a tizzy trying to figure out how may courses to lay on for dinner. Christ, who told the Seventy-two he was sending out on mission not to bring a purse or an extra pair of sandals, but who also told them that wherever they found accep-tance they should eat and drink what was put before them, because the laborer is worthy of his hire. Christ, who had a rather expensive robe, woven without seam from top to bottom, as the soldiers gambling for it immediately recognized; but who died naked on the cross. What then? Is there a fixed poverty line calculable in currency values,~ valid for all times and seasohs, to which we must keep? It ~ems not. But~ in that case how do we make, how can we be sure that we are making our poverty authentic? It would Seem that our po~verty is~authentic in the hi'eaT sure that it is really and truly in function of our apostolate--as it was in the case of Ignatius, as it was in-the case of Christ. And because it is in func-tion of the apostolate, our poverty, is, in sum, a basic insecurity: the basic insecurity of men who can.be sent and are willing to. be sent on any mission, even without provision for the jou~rney and with no assurance of provision at the end of it. Our poverty level is the minimum required to enable a Jesuit theologian to enlarge the frontiers ~of~ theology. It is also the maximum allowable "~for a Jesuit engaged in~ the "lSedagogy of the oppressed" to.be credible to. the oppressed. And it is a willingness on the part of the theologian to be sent to the oppressed, and a corresponding willingness ~n the part Of the peda-gogue of the oppressed to join a theological faculty. ,Let u,s, g~ve the last w~rd 204 / Review for Religious, l/olume 35, 1976/2 to the 32nd,General Congregation: "The authenticity of our poverty, after all, does not consist so much in the lack of temporal goods, as in the fact that we live and are seen to live from God and for God, sincerely striving for the perfection of that ideal which is the goal of the spiritual journey of the Exercises: 'Give me only a love of you with your grace and I am ~rich enough, nor do I ask anything more.' ":"~ a31bid. AV 14; Spir. Ex. [23~,].' * * Saint Louis University Accent '76 Summer offerings of The Department of Theological Studies, Saint Louis University June 22 - July 30 Accent: Spirituality Continuing SLU's tradition of summer institutes in Spiritu~ality, . Institutes: The~ New Testament and Traditions of Spirituality; Assimilating the LitUrgical Reform: Pastoral Ministry in Th, eological Focus Inaugural Institute: June 7 - June 17 Toward An American Spirituality (Herbert W. Richardson) Accent: °Religious Studies Continuing SLU's on-g0ing M.A. Program in Religious Studies. 12 Courses: Contemporary Doctrihe, Biblical Studies, 'Theology of Religious Life. Accent: Religion arid American Culture Continuing SLU's tradition of exploring the relationship between religion and culture. Workshops: Alternate Futures For Religious Education In The United States; New Interpretations of American Catholicism. Plus: Study Tour To lsrael All institutes and workshops can be separated into two-week segments. For complete information write: Department of Theological Studies Attn: Director of Summer Programs Saint Louis University 3634 Lindell Blvd; ' Saint Louis, Missouri 63108 Our Servant Song to Yahweh: The Radical Yes Sister Mary Catherine Barron, C.S.J. Sister Mary Catherine is an English teacher at Rome Catholic High School. She had p~blished earlier, in the November, 1975 issue. Sister resides at 808 Cypre.ss St.; Rome; NY 13440. In a poem of soul-shattering dimension, D. H. Lawrence, a very ~sensual man, poses a series of very spiritual questions.,He asks: Are you willing to be sponged out, erased, cancelled, ~ made nothing? Are you willing to be made nothing? dipped into oblivion? If not, you will never really change.1 His interrogation embodies the central Christological inquiry asked long before Jesus answered with His life. For throughout the centuries of salva-tion history it has been the haunting refrain of all who embrace the reality of the Servant Song. No matter where we turn in the Old Testament or the New, we find ourselves faced with its harsh delineations. ,Abraham must go through the annihilation Of family ties and holdings in order to found a nation from the child he nearly slays. Moses suffers privation, loneliness, and betrayal as he leads Yahweh's people to a land he never enters. David bears for-ever the searing knowledge of his sin as he witnesses its effects' upon his household and his kingdom. Hosea suffers the painfilled prostitution of his love; Jeremiah preaches renewal amid interior desolation; Isaiah witnesses 1D. H. Lawrence, "The Phoenix," The Complete Poems o[ D. H. Lawrence (New York: Viking Press. 1964). 205 206 / Review for Religious, Volume 35, 1976/2 to the emptiness of the Servant Who is to come. John the Baptist loses his disciples; Mary loses her Son; Jesus loses His life. What do we lose? In a past issue of Bible Today, Father Stuhlmueller reflects on the two-fold aspec't of vocation. He says: "Every vocation has an occasion, that which gets it started. Every vocation has a long search for the deeper mean-ing of what one started out to do.'' Somewhere between the ~'starting oc-casion" and the "deeper meaning" resides a radical "yes" on the part of the servant to what is so graphically outlined in the "Phoenix" poem. How do we say it--that radical "yes"? How did Jesus utter it? Through a total rendering of Himself, in faith, to His Father. He tells us: "Whatever the Father does the Son does too" (Jn 5:19). The Father's "radical yes" to His creation is manifested through the gift of His Son. The Son's "radi-cal yes" to His Father is manifested through the gift of Himself. There was nothing glorious about the human life of Christ. He paid dearly for every sign of spiritual power shown. He labored long and hard for infinitesimally small results. He traversed the length and breadth of His country only to learn that a prophet is never accepted by His own. He was condemned by leaders of the religion He fulfilled. And He

Issue 20.4 of the Review for Religious, 1961. ; JOSEPH F.~ GALLEN, s.J. Femininity and Spirituality A female insight of Gertrud von le Fort~ is the theme of this article. She writes: "L~on Bloy's words, 'The holier a woman, the more she .is a woman,' are valid also in re-verse; for the truly feminine role in every situation is i(retrievably bound to her religious character.''1 There-fore, it is likewise true that the more she is a woman, the holier she is. This principle extends also to the i:eligious state, and our topic.is that the holiness of the "sister must be built on her feminine nature and thus be distinctively feminine. Woman in the Gospel The women close to our Lord ir~ the CO, spel were femi-nine women. This is evidently true of the Blessed Virgin. She was the mother of mothers. Divine motherhood ele-vated her above all other mothers not "only in grace and sanctity but also naturally. "We often fail to re-member to what extent Mary is the most perfectly developed of all creatures, not only on the supernatural but also on the human level. Yet, it is a fact. There has been no other human being whose personality was de-veloped to such a pitch, to such a fullness of harmony and strength. In her, every power was fully cultivated and brought to the highest degree of accomplisliment. In her heart, all the delicacy of a virgin and all the ardor of a bride's love are joined to all the tenderness and gentleness of a mother. Purity, fervor, kindness, the strength to persevere, merciful understanding, the, power to forgive, a source of continual renewal and of refound enthusiasm . the heart of our Lady draws this unique treasure from her participation in the mystery of the Re-demption. In the Redemption were revealed all the potentialities' of her being. God Himself allowed this de- 1 Gertrud von le Fort, The Eternal Woman (Milwaukee: Bruce, 1954), 57. + 4- + Jose~ph F. Gallen, S.J. is pr0tessor of canon law at Woodstock College, Woodstock, Maryland. VOLUME 20, 1961" 4" 4. 4.~ REVIEW FOR RELIGIOUS 238 sire for sacrifice and the gift of self, which is in the heart of every woman and mo.ther, and which was in Mary to a supreme degree, to be realized to the full.''2 M6ther-hood, physical or spiritu.al, is the full development of the female personality, and in Mary this development reached its perfection. She is not only the saint of saints; she is the woman of women and the supernatural and natural ideal of all women. A devoted band of women disciples, with feminine spontaneity and. generosity, followed our Lord from Gali-lee and ministered to Him.8 A sinful woman bathed His feet with her tears, wiped them with her hair, kissed them, and anointed them.4 Martha and Mary had the faith of the heart in our Lord: "Lord, if thou hadst been here, my brother would not have died.''5 The femininity of Mary, who sat in such confidence at His feet,e in no way repelled ou~ Lord: "Now J~sus loved Martha and her sister Mary, and Lazarus.''7 Women com[ort'ed our Lord on the way to Calvary,8 stood at the foot of the cross,9 and would not depart from the cross.10 When the tomb was sealed, Mary Magdalene and Mary the mother of Joseph Could not leave it.11 They left fin.a, lly onl~ to think. of Him~and to prepare spices and ointments for His body~12 At the earliest moment after the Sabbath rest, at dawn on the third day, they returned to the tombA8 When the risen Christ appeared to them, they embraced His feet and worshipped Him.x4 Our faith is founded on the. Resurrection of our Lord. According to the Gospel story, He appeared first to Mary Magdalene; by His commigsion, this feminine ~oman became the hei'ald of the Resurred: tion to the ~pogtle~ a'nd, in the liturgy of the Church, the apostle to the apostles,x5 Woman in 'the Litu.rgy The same feminine tone is found throughout the liturgy ~and in the approved prayer of the Church. We have only to recall the titles in the Litany of Loretto: Mother most amiable, Virgin most merciful, Cause of ~ Paul-Marie de la Croix, O.C.D. ~hastity (Westminster: Newman; 1955), 145. tMt 27:55; Mk 15:.41; Lk 23:55. ~Lk 7:38. ~ Jn 11:21, 32. eLk 10:39. ~Jn 11:5. s Lk 23 : 27. OJn 19:25. ~o Mk 15= 40; Lk 23:49. ~a Mt 27 : 61 ; Mk 15 : 47; Lk 23 : 55. ~Mk 16:1; Lk 24:1. ~ Mt 28: 1; Mk 16: I-2; Lk 24: 1/ t' Mt 28:9. ~Mt 28:!0; Jn 20:17-18. our joy, Mystical rose, Health of the sick, Refuge of sinners, Comforter of the afflicted. We know that in the liturgy the Christian virgin is the bride of Christ and the bridal theme is: found frequently in Masses of the Blessed Mother and :of virgins,. In one,of the prayers from the common office of a virgin, we ask the grace to learn loving devotion to God from the virgin. In the third responsoryo of the feast of the Maternity of the Blessed Mother, we read: "Thou art made :beautiful and gentle in thy delights, O holy mother of,God,, and in the same responsory of the feast of St. Agnes:. "When I love Him, I am chaste; when I touch Him, I am pure; when I possess Him, I am :a virginY The hymn of Vespers of the feast of St. Mary Magdalene reads: "Source .and giver of heavenly light, with a glance You lit a fire o[ love in Magdalene and thawed the icy coldness of ~her heart. Wounded by love of You, she ran to anoint Your sacred feet, wash them~,with her ~tears, wipe ~hem With her hair and kiss them with her lips. She was not afraid to stand by the cross; in anguish of'soul she, stayed near Your tomb with-out any fear of the cruel soldiers, for love casts out fear. Lord Christ; love most true, cleanse us from our sins, fill our heart with grace and grant uvthereward of heaven/'16 Finally, the woman, in the office for holy women is a motherly woman. Woman in the .Doctrine ol the Church Doctrinally, the Church proclaims the distinctively feminine temperament in declaring that the mutual as-sistance or complementing of the sexes is an end of marriage. A fundamental reason for the " Church's re-strictions on coeducation is the specific feminine psy-chology. Pius XI stated in the Encyclical on Catholic education: "There is not in nature itself, which fashions the two quite different in organism, in temperament, in abilities, anything to suggest that there,can be or ought. to be intermingling, much less equality in the training of the two sexes."17 Plus XII reaffirmed the same principle: "Education proper to the sex of the young girl, and not rarely also of'the grown woman, is therefore a necessary condition of her preparation and formation for a life worthy of her.''Is Nature and Grace Sanctity, and also apostolic sanctity, can be defined as God giving me His grace and my c6rrespondence with 1BTranslation of the Reverend Joseph Connelly, H~mns'ot the Roman Liturgy (London: Longmans, Green, !~957), 214. x~ Acta Apostolicae Sedis, 22 (1930), 72. ~S Allocution to the Women Delegates oI the Christian Societies o! Italy, October 21, 1945, Acta Apostolicae Sedis, 37 (1945), 293-94. + + Femininity spirituality VOLUME 20, 1961 ~9 ÷ ÷ ÷ Jowph F. Ga//en, $4. REVIEW FOR RELIGIOUS 240 that grace. In our present context, God gives the grace to a human being, but to a woman, not to an angel nor to a man. It is evidently true that grace builds on nature and on the whole nature of the individual. Grace does not destroy but elevates and helps nature. Christian spiritu-ality does not annihilate our natural tendencies but orientates them properly, directs them to their proper end, turns them to God. It follows that grace does not destroy the feminine nature, that the more fully de-veloped the feminine nature the more effective grace will ordinarily be, and that the saintly woman is not an un-sexed woman but a feminine woman dominated by grace. Bainvel says of the saints: "Grace extinguished nothing of the light of their-intelligence, did not deprive~.them of .any strength of will, nor of their tenderness of heart, norof the delicacy of their sentiments.''19 There can be an obstacle, and a serious obstacle, to the sanctity of sisters by a spiritual formation, direction, and a concept of spirituality that tend to defeminize them. An antecedent possibility of this error exists. In-stitutes of religious women are based, and some of them very directly and immediately, on those of men; men have been the founders or cofounders of many institutes of women; men write the spiritual books that sisters read; and they instruct and direct sisters. The general observa-tion of Fitzsimons can be applicable here: ". and I noted how often, both in the secular and religious sphere, in small matters as in great, women had to be content with an adaptation of something masculine.''a0 The re-ligious life has to be essentially the same for both men and women; but that of women should have a feminine soul, atmosphere, and tone. In this matter, man can be a sound observer; he can point out defects, show the gen-eral direction, but he cannot be a master. Only women can fully understand and create this feminine atmosphere. Gina Lombroso tells women: "If we suffer, it is not be-cause we are different from him but because man does not realize in what way we are different.''21 Priests are not exempt from this common male ignorance of the female temperament. We exhort them to be Christian soldiers despite the fact that their destiny is physical or spiritual motherhood and that "woman attains her fullness as a mother whenever she holds our her hands to the weak and abandoned, to those who have need of care and pro- ~j. v. Bainvel, Nature et surnaturel (Paris: Beauchesne, 1920), 160. ~" John Fitzsimons, Woman Today (New York: Sheed and Ward, 1952), vii. aa Gina Lombroso, The Soul oI Woman (New York: Dutton, 1923), 94-95. tection."~z Moralists have sound reasons for counseling brevity in hearing the confessions of women, but it can be that they and we other priests are unaware of the fact that woman often dislikes to speak of her interior and that her diffuseness can frequently be merely the'inability to express her interior. "Furthermore, the feminine in-stinct is to hide deep emotions, and as woman can divine other people's sentiments she cannot understand that man cannot divine hers but demands that she put her most sacred feelings into words.''z3 We can and often do instruct and guide women with no attention to their distinctive temperament and thereby fall at least 'partially into the error underscored by Leclercq: "Every system, every institution, every social practice, every 'legal meas-ure that ignores what is specifically feminine in woman's make-up denatures the personality of the woman under the false pretense of developing it.''~4 Differences Between Man and Woman A detailed study of this subject must begin from the basic fact, evident objectively but ignored too much in practice, of the differences between man and woman. Plus XII instructed us: "'it is true that man and woman are, with regard to their personality, of equal dignity, honor, merit, and esteem. But they do not~ compare equally in everything. Definite abilities, inclinations, and natural dispositions belong solely to the man or the woman.''2~ Alexis Carrel, whom all quote on this topic, emphasizes the same principle in greater detail: "The differences ex-isting between man and woman do not come from the particular form of the sexual organs, the presence of the uterus, from gestation, or from the mode of education. They are of a more fundamental nature. They are caused by the very structure of the tissues and by the impregna-tion of the entire organism with specific chemical sub-stances secreted by the ovary. Ignorance of these funda-mental facts has led promoters of feminism to believe that both sexes should have the same education, the same powers, and the same responsibilities. In reality, woman differs profoundly from man. Every one of the cells of her body bears the mark of her sex. The same is true of her organs and, above, all, of her nervous system. Physio-logical laws are as inexorable as those of the sidereal world. They cannot be replaced by human wishes. We ~Fitzsimons, op. cit., I00. ~Lombroso, op. cit., 89. ~'Eugene Duthoit, quoted by Jacques Leclercq, Marriage and the Fam:si lAy l(lNoecwut iYoonr kto: Pthuset eGt,i 1rl9s4 o9)!, C29a2th-9o3l.ic Action, April 24, 1945, Acta Apostolicae Sedis, 35 (1943), 137. + + + Femininit~ and Spirituality VOLUME 20, 1961 241 4. + Joseph F. Gallen, S.]. REVIEW FOR RELIGIOUS are obliged to accept them just as they are. Women should develop their aptitudes in accordance with their own nature, without trying to imitate the males. Their part in the progress of civilization is higher than that of men. They should not abandon their specific functions.''26 Two other doctors, Strecker and Lathbury, are equally force-ful: "Will it never be learned that men and women can-not be reduced to a test-tube level? There are immense differences, including chemical ones and profound psy-~ chological differences which persist to the end of life.''27 These profound psychological differences evidently de-mand that the spiritual education, training, formation, direction, and government of religious women be dis-tinctively feminine. To ignore this principle is to re-tard and distort woman's spiritual growth.The sister is to develop herself, to sanctify herself, but in a dif-ferent and feminine way. "Like the man, the woman is.a human person, with all the dignity of a human being. But she is a human person in another manner than the man. She has, therefore, the same right as the man to unfold her personality, the same right to seek. after her perfection. Yet she is different, and as a consequence. her personality unfolds itself under other conditions. The rule of equality between man and woman is a rule of differentiated equality. The woman not only has an equal right with the man to the full development of her being; she has an equal right to develop herself in .a different way. To impose man's manner of life upon the woman, or to give her the same status, is to violate her right, which is to be different from him.''2s Man is Egocentric; Woman is "Alterocentric" Students of this question inform us that man is ego-centric, is centered on his own activities and pleasures, is interested in and devotes himself to things. But a very fundamental fact about woman is that she is "altero-centric"; she centers her attention, feelings, ambition, and enjoyment in other persons; she is not interested in things but in persons; her satisfaction is in other persons whom she can love and from whom she can receive love. A distinctive property of this attribute is that of great generosityl a woman has the capacity of giving and de-voting herself completely to other persons. "A woman is much more likely to become emotional about somebody: Her greater affectivity is towards persons; she is a more social person. She is interested in the living human being; ~eAlexis Carrel, Man the Unknown (New York: Halcyon House, 1938), 89-90. ~ Edward A. Strecker,. M.D., and Vincent T. Lathbury, M.D., Their Mother's Daughters (Philadelphia: Lippincott, 1956), 26. ~ ts Leclercq, op. cit., 292. not in things, actions, accomplishments, theories, sta-tistics, or impersonal plans as such.'~29~:"~To be religiously alive needs precisely those qualities~with which woman is so richly endowed, the .gift of personal' relationship, instinct for vita]ovalues, and :the capacity for giving one-self completely to another, ,to The Other.''30 If this personal relation is'so~ deewin the nature of~ woman, why is it that God is not-more prominent in the spirituality of sisters? If woman is~not interested in things, why.are rule, regulatibn, custom, practice, and observance so characteristic ~of her spirituality? Why do~s she look on a thing~ the.Holy Rule, as,the ultimate norm of her conduct and not merely as a means to s6mething per-sonal, identification with Christ? Why does she consider herfoundress as a lawmaker, dot 'asa spiritual mother, a giver of spiritual life? .Why does she narrow her vision to the details of the rule of the foundress .and forget the rule as the~path to the distinctive virtues of~the fouhdress? Why does she place so much of her spirituality iri ex-ternals and not in the _Persons of the Trinity; Who dwell ~¢ithin her,° and in Jesus ,Christ? Doesn't the womanly-aatfire, of a sister, her spirituality, apostolic efficacy, and aappiness demand that we decrease the insistence on ex- :ernals and. emphasize much more the~interior life? Isn:v , theological training necessary.so,that she will have the- ;olid truth that nourishes such a li~e?~ Doesn't that same ;enerous nature require that we abandon the spirituality ff uiere morality, sin a;ad no sin, of the mere practice of ~irtue; and that we emphasize the personal truths of the firitual life, the fatherhood of God, the love ofGod° "or each one of us, the indwelling of the Trinity, the~ ~erson of Christ, the Mystical'Body, the life of grace, and he motherhood of Mary? The spirituality of the sister hould be distinctively a person-to-person relation to God. ~piritual Motherhood The great ~characteristic of wom~n is motherliness. P~us' (II affirmed.~ "Every woman is destined to be a m(~ther, notl~er in the physical s~n~e o~ 'the word, or in a rriore p.iritual and elevated but no less true sense.''31 On an- )ther occasion, he stated: "But with you We see around J~ today a gathering q~ religious ~omen, teachers and thers engaged in ihe work0f Christian education. They re. m~thers, too, not by.{aaiure nor by blood but by the ~Lucius F. Cervantes, S.J., And God" Made Man and Woman 2hicago:-Regnery, 1959), 88. ~Eva Firkel, Woman in the Modern W~'rl~l (Chicago: Fides0~1957), a~Allocution to the Women Delegates o! the Christian Societies Italy, October 21, 1945, Acta ~postolicae.$edis, $7 (19~5), 287: Femininity an~ Spirituality VoLuME 20, 1961 ÷ ÷ ÷ Joseph "F~. Gallen, S.]. REVIEW FOR RELIGIOUS 244 love that they bear to the young.''32 Gertrud von le Fort expresses the same truth in womanly fashion: "Whereso-ever woman is most profoundly herself, she is not as her-self but as surrendered; and wherever she is surrendered, there she is also bride and mother. The nun dedicated to adoration, to works of mercy, to the mission field, carries the title of mother; she bears it as virgin mother.''a3 Eva Firkel asserts the same principle: "All feminine ac-tivity is shot through with protective motherly qualities, These emanate from every healthy woman, no matter whether she be married or single, whether she has children or not.''34 Here we touch the apostolic field more immediately. The sister teacher, nurse, social worker is not.a professional woman; for her these are a form and exercise of spiritual motherhood~3a If she does not under-take and perform them with the instinctive and spon-taneous devotion and.love of mother; if her relation to others in her work is not a complete motherly "other-ness," total and instinctive lack of self-interest and self-~ regard; if it is lacking in motherly generosity, tact, sensi-tivity ~to others and their 'sufferings and weaknesses, delicacy, sympathy, and compassion, she is not carrying out her apostolate according to the mind of the Church. The reason is that her.spirituality is not fused with a great endowment of her feminine nature. A mother is attractive and lovable. Even the very accurate and sharp-edged arrows against "Momism" have failed ,to lessen the truth that all the world loves a mother. It follows that the sister apostle should be attractive and lovable. As Mary, her own mother arid ideal, the sister should primarily attractoothers to God, not to herself nor for herself. The apostolic life also is a complete com-mitment and detachment; we are not in it for ourselves but only for God and souls. It is tobe remembered that' there is no imperfection in liking others and being liked by them when this is no obstacle to the greater sanctifica-tion of either, and much less if thereby we lead souls to God.' A sister can fail here. She can be unattractive in her. personality, conduct,, and manner to those for whom she is laboring, and especially to girls. The apostle sym bolizes the things of God; we cannot expect others be drawn to the things 'of God if they dislike the apostle. This apostolic loss is the primary.consideration. There is a secondary aspect but one that is Of great importanc.e. Isn't the attractive or unattractive Sister apostle a highly important, factor in the vocation problem with school ~Allocution to the Women o] Catholic Action of the Dioceses oJ Italy, ~October 21, 1941, Acta ApostolicaeSedis, 33 (1941), 457. =Von le Fort, op. cir., 7. ~Firkel, op. cir., 22. ==Von le Fort, op, cit., 87. girls and even more so with' nurses? I believe it is an incontrovertible fact that ~irls and young women will be drawn to a particular institute, generally speaking, in direct proportion to their liking for the sisters of that institute. There will be no profitand less sense in fight-ing this fact. We can state the present truth harshly but briefly: an unloved apostle very frequently at least means an unloved God; and we can add a second axiom: there is nothing in the love of God that ~should make us um loved by man. "Look at~Jesus, the :supernatural in-carnatedl Is he not,the ineffably beautiful and attractive ideal of human nature, isn't He, ag it~were, a living invitation to elevate ourselves to the supreme perfection of humanity?''s~'''Or Mary, is she not, after Jesus, the ideal of humanity,.and .should we not say, with due proportion, of her what we say of Him?''3~ If dislike, opposition, hos-tility, and enmity arise, the fault should not be in the apostle. The world hated Christ, our Lord, but the fault was not His. Woman is Made to Love and to be Loved A third characteristic of woman is that she is made to love and to be loved. Psychology and poetry emphasize this pervasive quality of the 'life of woman. "She is im-pelled by her very nature to share the joys and sorrows of others, she is made to love and to' be loved, and she can-not find her~ sufficiency in herself. That is' why a woman who is selfish in a self-centered kin~l of way is an anomal~, more distressing to encounter than a selfish man. She ha~ denied her nature f6r she :liag ceased to exist for 3thers, and in so doing she'has dried up at its source the possibility of those emotion~il experiences which ~are'vital _o her femininity.''as Man's spirituality may be founded :,n mere principle, supernatural truth, obligation, and _-luty; the spirituality of ~ womaff should be characterized ¯ y love of God. Man can work for others in an objectiye, letached, and impersonal manner; the apostolic woman nust work for others with love. Otherwise, she is Untrue o her feminine nature and is not utilizing that nature ully for God. As a woman, Janet Kalven, sums it up: 'Woman's essential mission in the world is to be for nankind a living example of the spirit of total dedication o God. To love God with her whole .heart, her whole hind, her whole strength, and to radiate that love to the ;,orldthis is the universal task ofwoman."s~ If woman's spirituality is to b'e dominated by love of ~ Bainvel, op. cir., 158. ¯ ~ Bainvel, op. cit., 159. ~s Fitzsimons, op. cir., 89. ~ ° ~Janet Kaiven, quoted b~ William B. Flaheity, S.J., The Destiny I Modern Woman (Westminster: Newman, 1950), 189-90. ÷ 4. Femininity and Spirituality VOLUME 20~ 1961 Joseph F. Gallen, $.]. REVIEW FOR RELIGIOUS 246 God, if through her "otherness," generosity, motherliness, and loving nature, she. is more capable than man of un-selfish and disinterested love of 'God, why should the mental prayer of a sister be an abstract discursive prayer, not affective prayer? a prayer of the mind and not of the affections? a mere abstract study of virtue and examina tion of conscience? Why shouldn't her feminine nature, which dislikes the abstract and is endowed with a livelie imagination, her logic, which is more of the heart than o reason, lead her naturallyr to affective .prayer? If he thought and speech are infused and even permeate with emotion in ordinary life, why should they be coldl intellectual and lifeless with God? "Even at the highes levels of the spiritual life this distinction is clear. In th writings of St. John of the Cross and of St. Teresa of Avil one can sense the two approaches: St. John in his writing remains always ~he philosopher, having made a complet gift.of himself in the abyss of faith, whereas St. Teres loves God tenderly and has made her love of Him as he heavenly spouse into a second nature.''40 Why shoul the sister's examination of conscience be a mere countin of defects and reading of an act of contrition? Why ar rule and observance so marked a note of her spirituality not consecration to God and .generosity? How many re ligious women undeista_nd that there is nothing purel negative in the spiritual life, that abnegation, self-denial mortification, and purification are only means to some thing positive, to the love of God? "For in Christianit there is no place for a love of death; death occurs to liv more fully. From the spiritual point of view, asceticis is not unlike what the. wrong.side~ of. a material is to it right side. There is no right-side without a wrong side but the wrong side is inseparable from the right sid and only subsists through it."~, ~ It has been aptly ren~arked that all schools of spiritu ality are distinguished by the emphasis they place on th love of God or on mortification and detachment as lea i.ng to~ the love of God. In the former, the love of Go draws the soul away from affections that would imped this love; in the latter schools, the. affections are turne away from other things to attain and increase the love o God. Both approaches should be used throughout lif but it seems to me that the affective nature of woma should more frequently incline to and follow the fir approach. Mortification and detachment are an essenti part of both systems.In the first, the love of God dra the soul to mortification and detachment; in the secbn ~ Fitzsimons, op. cir., 115. "tFran~ois de Saint-Marie, O.C.D., Chastity (Westminster: Ne man, 1955), 239. mortification and detachment are the means of attaining and perfecting love of God. Woman is Emotional Doctors Strecker and Lathhury mfiintain: "L'ife ~is lived largely not by the intellect but by maturely motivated emotions.''42 Emotion can not only be immature; it can also be wholly unreasonable, even though the first law of a human being is~to be guided by reason. This ir-rational characteris'tic is particularly true of fear in woman, and there is a danger that the spiritual life of the religious woman will be tyrannized and weakened by countless unreasonable and persistent fears. She can fail to distinguish between a fearful thought and a fear that has foundation, can allow the mere presence or recur-rence of a fearful thought to endow it automatically with objective validity, omit all reflection on whether the fear-ful thought 1.s supported by any tea_son ,n fact, pray for release from fear but fail to advert to the obvious fact that God cannot ordinarily be expected to do for us what we can do for ourselves. God not only gives us grace; He has also given us a mind that can ascertain whether a tear is unreasonable and~ a will that enables us to ignore the unreasonable fear. When it exists, this paralysis of fear proves that woman has not built her spirituality on her feminine nature. Love drives out or attenuates fear, and the spiritual life of a woman should be preeminently love of God. An incomplete and misguided spiritual forma-tion is a serious cqntributory factor to the habit of fear. Fear will readily and forcefully fill up the vacuum of an interior life in the externalist and devotionalist. The emotional nature of woman tends also to senti-mentality and to a shallow and superficial spirituality~ This is the cause of the widespread externalism and de-votionalism, of the endless non-liturgic~il vocal prayer, the prevalence of "novena" spirituality, 'the scurrying ~bout for additional Masses, and the sufficiently excessive ,ddiction to articles of devotion. An interior soul is one a, hose growing love of God, living of the participation of .he divine nature, divine adoption, and of the indwelling )f the Trinity have led to identification with Christ in hought, will, desire, and affection. Such a soul has little :apacity and less desire for devotionalism. Devotionalism s a symptom and proof of the lack of a true interior life. Fhe cure is a~ solid education at the beginning of the eligious life, a solid spiritual formation, and theological raining. An emotional nature is also impressionable, unstable, ,ariable. A formation and direction that are aware of "~ Strecker-Lathbury. op. cir., 1 I. 4- 4- ÷ Femininity and Spirituality VOLIJME ~0~ 1961. ÷ ÷ Joseph F. Gallen, ~gVIEW I:OR RELIGIOUS 248 these facts will strive to give the sister the strength and constancy of will that are more proper to man. A solid education at the beginning of the .religious life will again be a most effective auxiliary. Woman is Compassionate The next characteristic of woman is her love of the afflicted. She loves the weak, the sick, the suffering, the wretched, the oppressed, the disgraced, the victims of ill fortune; and her love does not distinguish between the worthy and unworthy. In the thought of Gina Lombroso, to woman whatever causes suffering and is avoidable is unjust, whatever causes happiness is just,4a Gertrud von le Fort concurs: "As the motherly woman feeds the hungry, so also does she console the afflicted. The weak and the guilty, the neglected and the persecuted, even the justly punished, all those whom a judicial world no longer wishes to support and protect, find their ultimate rights vindicated in the consolation and the compassion that the maternal woman gives.''44 Eva Firkel repeats the same thought: "A mother knows how helpless creature., can be; she will support, give and care, without troubling too much whether the objects of her love are worthy of it She will not constantly rub up against the defects ot others, but hide and mitigate them. One might also say it the other way round: wherever there is need for help motherly women will be found.''4~ Certainly an intui tively compassionate religious woman is a most attractiv~ apostle of the good news of God. She is a born shepherd of souls, the natural comforter of the least of Christ'., brethren. Nature has endowed her with a fundamenta! trait of the apostle of Christ, to comfort the suffering and her intuition leads her to seek them out and discerr them instinctively. There should be no limit to the degre~ of learning that sisters are to seek and attain; but, if the] are to be true to their womanly nature and to use it f01 God and God's Church, the apostolate of their institute. should always be characterized by works for the poor, tht working class, the lowly, the unfortunate, the handi capped, suffering, and despised. The gift of compassior should also tend to facility in affective mental prayer. Woman Wishes to be Appreciated for Herself Fitzsimons states: ". men are more concerned to shin, and be noticed for their achievements, for the things the. have made, the result of their creative effort, wherea women wish to be appreciated for themselves, for thei a Lombroso, op. cit., 256. "Von le Fort, op. cir., 80. ~ Firkelo op. cit., 148. own personality.''46 Woman also needs support and di-rection and she is highly, even fiercely, individual. "Al-though one often hears the contrary and in spite of the fact that there is more apparent monotony in women's lives than in men's, woman is.much more individual than man.''4r We certainly should not satisfy mere vanity, childishness, nor make the sister an immature weakling, However, the attributes described above evidently de-mand a greater care in the formation and government of a sister as an individual, a greater attention to persons rather than things in government, and a manner of government that tends more to recognition, enc0iarage-ment, and praise than to criticism and correction. Gertrud yon le Fort says of the maternal woman and thus of the maternal superior: "It belongs to the ominous errors'of the world, to the fundamental reason of its lack of peace, to believe that it must always uncover and condemn all that is wrong. Every wise and kindly mother knows that sometimes it is right to do exactly the opposite.''4s Correction is necessary, and too many superiors of both men and women neglect this obligation; 'but I am con-vinced .that very many superiors of sisters are too quick in their corrections and entirely too prone~ to correct publicly. A delay will usually render the correction calmer and more effective, and relatively very few defects de, mand a public correction. No superior has to correct im-mediately and publicly every defect that she observes in the refectory or community room. A sister should always be conscious that she is an .in-dividual in the mind of the superior and of the com-munity. A male religious can be left in great part to himself and his work; one of the most fervent desires of many religious men is to be left alone. This is not true of women. A greater recognition and esteem of the religious as an individual person is one of the ,purposes of renova-tion and adaptation. The spirituality of the sister is to be built on her individualized feminine nature. All spir-itual authorities warn that it is dangerous ,to try to di-rect all souls by exactly the same path. Woman as. a per-son is highly individual, but woman in authority is more prone than man to regimentation. God mad~ us inde-structibly as individuals; let us build on His handiwork, not attempt to destroy it. Woman has a Capability [or Details All students of woman proclaim her great capability for details. Nature has endowed her with this talent to ,e Fitzsimons, op. cir., 92. '~ Lombroso, op. cir., 86. ~ Von le Fort, op; cir., 81. + + + Femininity and Spirituality VOLUME 20, 1961 249 4" 4" 4" Joseph F. Gailen~ S,]~ REVIEW FOR RELIGIOUS 250 enable her to take care of a family and home. All also affirm that woman gets lost in details, that she dislikes the abstract and cannot analyze and reduce details to their principles; she occupies herself with the details and does not perceive the essential, and consequently .has difficulty in orienting her life~ The preoccupation with details tends also to a narrowness of outlook and a lack of breadth in ideas. "The foundress of a congregation said one day: 'Sisters often attribute the greatest importance things that are silly and no importance to things that truly great.'-49 The talent for details is undoubtedly asset to the sister in her apostolate, especially in works such as those of hospitals and institutions. However, is~also the cause of the excessive details in the religious. life of women, the hundreds of customs, observances, and practices, the spiritual dusting, the ascetical fussing, religious "redding up." Here woman is to be comple-mented by man~s logiC. Those observances are to be re-tained and chosen that are most efficacious in producing interior virtue, especially the virtues more necessary the religious life; and such observances are not to be un-reasonable either in number or detail. Woman's proneness to imitation multiplies these details. The individual sister takes them unthinkingly from other sisters, and one stitute copies them from another. Once they are accepted, the natural conservatism of woman opposes and resents any change. Esther E. Brooke rightly admires the ef-ficiency of woman: "Woman is the only creature on earth able to multiply nothing by nothing and get something out of it. She is inherently a bookkeeper with an ac-countant's delight in the profit column and a determined broom oto sweep away the loss.''50 It is at least impolite to spoil a well.turned sentence, but woman is also the on!y creature on earth who can multiply something something and get nothing out of it. The multiplication of details is an unproductive approach to an interior life. The bookkeeper may be good at figures but this does not necessarily nor ordinarily imply the ability to enrich Allied to her talent for detail~ is the tendency of woman to be busy for the sake of being busy. Simone de Beauvoir aptly observes: "The worst of it all is that this labor does not even tend toward the creation of anything durable. Woman is tempted--and the more so the greater pains she takes--to regard her work as an end in itself. She sighs as she contemplates the perfect cake just out the oven: 'It's a shame to eat itl' It is really too bad ~A. Ehl, Direction spirituelle des religieuses (Brussels: L'edition universelle, 1948), 79. ~Esther E. Brooke in The Spiritual Woman, Trustee of the Future edited by Marion T. Sheehan (New York: Harper, 1955), 17. have husband and children tramping with their muddy feet all over her waxed hardwood floorslTM This ten-dency seems to explain the over-emphasis on domestic work in convents, the chronic fever of housecleaning, and the innumerable woman hours~wasted in polishing0and re-polishing floors and furniture. It is also the reason why sisters cannot perceive-the contradiction-of a religious habit that demands a disproportionate amount of time to launder and of the~excessive emplbyment of novices and postulants in domestic work. ' ~ A similar defect is the literalness-of,religious women. They interpret a minor observance as rigidly and ab-solutely as if it were the prohibition of hating, God; it admits of no excuse or exception. In h~r meditation, the sister.may observe every step of a'method~of prayer but be unmoved by the fact~ that she is not praying: All her life she may mechanically recite twice a day the'acts ~f thanksgiving.and contrition in' the examen book but never think of giving thanks to'God, of being sorry for her sins, imperfections, and r6jections,. 0f grace-bbcause of motives that appeal to her individually. She may. be fiercely individual but she is~also a passionate routinist. The same concentration onlittle things'can b~ true.~of the apostolate. Our own spirituality conditions our ap-proach to the apostolate; if our spirituality is dominated by trifles, we shall preach and insist on ~trifles: in the apostolate. The life of the religious apostle is ~obviously to be dominated by. God, Who is infinite, and 'the,eternal value,-of a human soul,-not by ,trifles. Woman has ~ids in overcoming this addiction to detail. She .is more objective than man, she sees reality more clearly,~and she .is mor~ practical. If something does not work, she g~ves itup, even though she does not see the reason why it does not work. It is amplifying the obvious to state~that~a re-ligious life or an ,apostolate dominated by. detail does not work. It is a proper e~phasis,of important and prac-tical truth to add that a petty life,will not be. a happy life. Woman ~s Spi'ritUal ~nd her ~nlSuence~ is~ SpjrituaJ Marion T. Sheehan writes: "Man in his leadership oi society has a basic protectiveness and a supportive attitude toward life. His special prerogatives are.strength and ag-gressiveness. Woman has a sense of trusteeship of life in both the spiritual and physical meaning. The spiritual qualities in woman--her reserv~e, refinement, and com-passion- complement man's characteristics by modera-tion. The source of these complementary qua, lities is in her spiritu~al life. For centuries, man has publicly ackn.0wl- *~ Simone de Beauvoir, The Second Sex (New York: KnopL 1955), 454. + 4. 4. Femininity and, spirituality voLUME 20," ÷ ÷ ÷ Joseph F. Gallon, $.]. REVIEW FOR RELIGIOUS 252 edged this spiritual influence of woman by his expressions in art, poetry, and literature.''52 Woman is therefore more spiritual than man and her influence is spiritual. She should consequently be more prominent than man in her contribution to the note of sanctity in the" Church. W~e can readily admit that we have enough good re-ligious women; we may question whether we have a sufficient number of outstanding holiness. Learning and other gifts can be helpful, but only sanctity is true great-ness in the Mystical Body of Christ. Several authors state that woman geniuses are almost non-existent in history. Women are not found among the great theologians, phi-losophe~ s, writers, poets, composers, sculptors, painters, or scientists. Acompletely satisfactory .answer has yet to be found for this fact. No one merits the title of great and genius more than the saint. He has the talents of mind, will, and heart that conquer the measureless distance be-tween heaven and earth. He possesses the daring and originality to leap over reason into divine love. Can it be that the spiritual nature of woman is retarded because she is also too pedestrian? too restricted in her vision to the average,, the ordinary, the routine, the good? lacking in the vision and constancy demanded for greatness? Woman is likewise naturally more cultured and her in-fluence is more cultural than that of man. The Church may also ar.d justifiably look to religious women for a notable cultural influence. This is a wide field, and the cultural influence of the sister has been admittedly handi-capped by the lack of a proper education at the beginning of her religious life. To arouse sisters to reflection on this important matter, ,we .can be content with inquiring whether the statues in convents generally manifest the taste of a cultured person and whether the articles of de-votion made and used by sisters reveal the same taste. Must the inexpensive be tawdry and loud? Aren't Catholic repugnance and Protestant prejudice readily created and confirmed by some of the~se articles of devotion? "While he is still a child, woman.leads man to an understanding of art, to the integrity and power that goes into its crea-tion. She shows him that beauty is not only pleasing to the eye, but that through the eye it reaches every corner of the human soul. We may well ask ourselves.where we have failed in this sacred trust. Would so many of our churches be filled with the horrors they contain, the painted mon-strosities called statues which distract instead of embel-lish, which sicken instead of elevate, if the mothers of our priests and ministers had made the art gallery, the mu-seum, the concert hall as intimately part of their chil-~ Sheehan, op. cir., 155256. dren,s early training as the movies, the radio, the corn, ics?"53 Woman ancl Other Women One of the outstanding defects o~ woman, emphasized by practically all students of the subject, is the difficulty she has.in getting along with other women and'in friend-ship with other Women. Gina Lombroso again enlightens us: "Individually the.mani~ to be first prevents .the ~form-ing of real friendship among women, and hinders the'es-tablishment of that current of expansion and confidence among young girls and bider'women 6~hich would b~ of so much use and comfort in life: Woman does not-trust woman, because each one wants to be first and knowg that her best friend is ready to march'over her in-ordei" to be first, when her turn. comes.TM "Wom~n's inordinate self-confidence is, I believe, the Cause of w6men's lack of'con-fidence ir~ each other, as it is the reason for their failure to respect each other. :. This distiust is~the cause of the cordial animosity that reigns between women, and of the discredit which any woman in particular thr6ws,on-all~ women in general."5~ Woman is also more sociable than man, a more dependent', being; and more dependent on her environ~ment.These facts make common'life at once a necessity and a difficulty. ~The remedy is instruction and formation from the beginning of the religious life; to point out the difficulty to the young, to instruct them that their gifts of unselfishness, spofitaneous generosity, intui: rive perception of the difficulties~of others, iSf seeking the happiness of others are to be~ turned and devoted pri-marily to their own sisters. A happy community life is far more indispensable to a religious woman than to-a re-ligious man. It must have the climate that her nature de-mands and give her affection, satisfactory personal rela-tionships, sympathy, underst.anding, recognition, support, and help. The more she is a woman, the holier she is; but the more she walks alone, the less she is a woman. The current of resistance from woman to woman is also a basic reason for the relative unwillihgness and. slowness of sis-ters to talk about spiritual matters with their superiors. Spiritual direction presupposes mutual trust, and a su-perior of sisters will not attract confidences unless she~has given an almost bverwhelming and sustained proof of her spirituality, unselfishness, and trustworthiness. This mat-ter '6f~woman to woman also has deep apostolic implica-tions. In Christian education according to the mind of the Church, sisters are destined at least primarily as educators r~ Eloise $paeth" in $heehan, op. cir., 5. ~ Lombroso, op. cir., 57. ~ Lombroso, op. cir., $2-33. ÷ ÷ Femininity and , spirituality VOLUME 20, 1961 REVIEW FOR RELIGIOUS £54 of girls.A liking for our work and for those for whom we work is an important factor for success, and we do not in-fluence too many people that we dislike or who dislike us. Woraa.n. and Chastity ChastitLis a r~6c~e.~sity for the state of complete Christian per~fection:, It is also highly necessary for the apostolate of the nun. She is destined to be the spiritual mother of re. any "souls. In-.woman, chastity is a most extensive re-nunclauon. She re.nounces not only physical love but also the love of a husband and children. Because of her na-ture, these last two renunciations are~much deeper in woman than in man. They are the sacrifice of an affective life that is almost her very n.ature, almost herself. This re-nunciation must be complete anti absolute; she sacrifices forever.any affecti~)n that would impede the greater love of God and not merely the affection that would lead her into sin. The postulant, novice, and junior professed are to be pr~operly instructed on chastity. This is necessary from a physical and moral standpoint; .it is evoen more necessary from the spiritual aspect. Our consecration to God is, not to be blur~'d, confused, and diminished by artificial a_.n~puritanica! ignorance. The vow,, of_chastity is not merely to give up~marri.age; it is to give UP marriage, which is good and holy, for a greater_ good, .~the love of God_ and the virgi~nal love of s.o.uls.I.n his Encyclical o.n~ sacred, virgi.nity, Pius XII re-itera_ t~ed the traditional teaching of the Church the mo-t. ivg .t, hat leads a girl to the,religious life is love of God; her purpose is. to attain a, greater love of God in her own soul; and this greater and pure love is the source of her apostol~c.leal. Chastity is. not mere~ renuncia, tion, mere sacrifice; it is not mere.ly a moralistic and defensive virtue, not a mere exercise of vigilance. C.ha~s(ity is all of these things and demands all of them. Here~passion is strong and affections wayward and blind. Common-sense dic-tates constant vigilan.ce. The difficulty is that- chastity has been too much merely a negative and defensive virtue, the avoidance of sin and fidelity to the .precautions against sin. This is not in .agreement with the Pope's description~ that the motive of religious chastity is the love of God and its purpose the attainment of a greater love of God. Chastity must be made much more positive. Its purpose is union with G6d and a constantly increasing love oo~ God. This lov~ i~ spiritual. It is not in the same order as human lov.e, much less is ,it a disguised sexual love. The attainment of such a union demands that the spirituality of a sister be centered far more on the Person of Christ than in rule, ._regulation, and observance; that her mental prayer be centered on Him, not merely on abstract prin- ciplesl and that: it be distinctly affective. She. is to: e~.tehd this same approach to all other religious~exercises~ e.g,, .the examen, liturgical and other vocal prayer, and ~spir.itual reading. The close and intimate doctrines of our faith, such as the Mystical Body, the indwelling of the~Trg~nity, and the life of grace are to be made prominent in her life. She is to be drawn away from a concentration on the [earsome doctrines and is to base herspirituality primar, ily on the goodness and attractiveness of God, Whether or not a sister is attainihg the purpose o.[ ~haStiiy will be proved not by a mere absence of sin but by the Correlative virtues and signs that manifest an increased love of God. Is her prayer and life more familiar, closer to God? Is she less materialistic, less inclined to sensual indulgence, more mortified, more detached, of a more delicate conscience, nstinctively but not ~scrupulously apprehending sin and anything that could lessen her love of God? Is she a more ,piritually agreeable person? Although love of God is not ~n the same level as human love, by fidelity it becomes 3rogressively closer, more intimate, more real. It is the rue love of religious chastity only if it becomes increas-ngly less selfish, if its tendency is to give to God, not to ¯ eceive. This positive chastity produces the really apostolic woman, the sincere spiritual mother of mankind. A sister, )y the perception of the heart more than of the mind, will aave attained a knowledge and participation of God's ore for man; she will long to give to God and this she an do only by bringing herself and souls to a knowledge tnd love of Him; her peace and joy in the possession of god within her own soul will lead. her to the love of God n others who possess Him and to bring this possession to hose who are deprived of it; true love of God will urge ~er constantly to give to God; and her apostolate will hereby be maternal, because it will be distinguished by mselfishness, generosity, dedication, universality, and ~urity of intention. "Noble-mimled women, those in chom the spirit preponderates, succeed somehow in spir-tualizing the physical and in developing within them-elves an intensity and purity of spfritual love which pro-uces types of mystics, wives, and mothers who are the dmiration of: mankind."~ ?oncIusion Personal and apostolic sanctity are one. Our theme has een that the sanctity of the sister must be developed on er feminine nature and that sanctity implies no maim-ag or distortion of this nature bu.t its perfect develop- ~ent. Father Valentine, by a concentration on his main ~ Leclercq, op. cit., 296-97. Femininity and Spirituality VOLUME 201 1961 thought, may be underestimating learning and efficiency, but his words sum up and can aptly close this article: "One of the greatest needs in the apostolate is the woman. It matters little comparatively speaking whether she is learned or even efficient: but she must be a woman, as ma-ture, unpretentious, work-a-day, self-forgetful as the mother of many children, if she is to be worthy of the privilege of caring for souls in Christ's name.''57 m Ferdinand Valentine, O. P., The Apostolate o! Chasity (~ est-minster: Newman, 1954), 45. 4. ÷ 4. ANASTASIO GUTIERREZ, C.M.F. Teaching Brothers in the Church What I propose to say about the subject on which I was asked to speak by the presiding body1 can be summed up in the simple words: lay, teaching, religious. Anyone's rights and duties toward the Church constitute his juri-dical statug. The juridical pers¢.nality of these brothers can be no better defined than by the terms: religious, laymen, apostles. Religious The lay teaching brother is above all a religious. His rights and his'duties and at the same time his dignity flow especially from this character. First of all, there is no opposition between layman in its canonical sense and religious. Canon 107 teaches that there are in the Church by divine institution clerics and lay-men, and that both may be religious. This is why canon 488, 7°, defines the religious as one who has pronounced vows in a religious institute; and religious institutes~ may be, according to 4° of the canon, clerical or lay. Strictly, the religious state is no other than the means, perfect in itself, of professing socially and juridically the integral morality of Christ, His precepts and counsels, that is, evangelical perfection, the Gospel in its full integrity. It is obvious that this high duty of tending toward perfec-tion cannot be exclusively reserved for clerics, but that it must as well remain open to laymen. The religious state both considers itself as existing outside of the priesthood and actually does exist outside of the priesthood. In this connection it is proper to note that the .organization of the state of perfection arose in the Church as a lay state and that clerical religious congregations are not to be found before the latter part of the Middle Ages. Even the x This article is a translation of a talk given at the Second Congress of Major Superiors of Religious Orders and Congregations, October 29, 1957. Anastasio Guti~rrez, C.M.F., is a consultor of the Sacred Congrega-tion of the Council and an official of the Sacred Congregation of Relig-gious. vOLUME 20, 1961 257 ÷ ÷ ÷ A. Gugffrreg, C,.M.F. REVIEW FOR RELIGIOUS 258 mendicant orders, not to speak of the Benedictines, did not at first imply the priesthood. St. Francis of Assisi him-self never received the priesthood. Not only is there no opposition between the lay state and the religious state, but one may with good reason add that the elements proper to the religious state are found to be distinguished and delineated more clearly among lay religious, because if these elements are common to both lay and clerical religious, they are then more pure unmixed among lay religious. As a matter of fact, priesthood imposes numerous obligations of its own which coincide, at least partially, with those of the religious state: celibacy, canonical obedience, apostolic obligations, abstention from secular affairs that are formally for profit. The same thing may be said of its rights: the person of priest is sacred, protected by the privilege of canon 119; he enjoys as his full right the privileges of the clergy; is owed special honor aside from whether or not he pro-fesses the religious state. Religious priests share these rights and these obligations independently of their religious character. Actually, with respect to his rights, the lay religious a person worthy of honor in the Church, for, "the religious state., is to be held in honor by all" (c. 487); and this respect is due to religious as well as to clerics (c. 614). The person of the lay religious is sacred because of the public consecration of his life and person exclusively to the service. Even if his profession acts in many ways contract between the religious and his congregation, it cannot be reduced to the category of business contracts, private, voluntary relationships binding in commutative justice. Profession, theologically and also juridically is seen from its effects) is the consecration of a person and a human life to the exclusive service of God and to practice of the integral moral code of Jesus: ". besides the common precepts, the evangelical counsels are also be kept" (all of them, none excepted) ',by the vows obedience, chastity and poverty." (c. 487). Of course, the individual makes this consecration; but it is ratified by the Church. Such a profession is the religious' holo-caust, but a holocaust which the Church accepts officially and which she offers in turn to God in her own name. The profound and consoling meaning of the public nature the vows is in this, that public vows are vows accepted the Church. The immediate juridical effect of this public and official consecration, this public holocaust, is the sacredness of the person. The consequence of this character of sacredness is immunity, in virtue of which the violation of such a by exterior sin against chastity or by a real injury -119) constitutes a sacrilege. Moreover, this': sacrilege im-plies, on the part of the subject, a new sin against the virtue of religion; and for the other party, in the case of a real injury, brings with it excommunication (c. 2343, § 4). Under another aspect .the dignity of lay brotherd, pri-marily because they are religious, demands consideration by reason of the public nature of their state, in. the exact and strict sense of public. In the Church the religious state is a public state because religious constitute the sec-ond category of canonical persons (cc., 107, 487). Iri other words, by her public and organic constitution, the Church today is constitutionally composed of clerics, laymen, and religious (c. 107). All the faithful belong necessarily to one or other of these specifically distinct categories. It ought also to be noted here that the public character of the religious state does not come from the priesthood which is often joined to religious profession. It comes from the religious character, itself, in so far as there is question of a social and constitutionally organized profession of the evangelical counsels. That is why the:religious 'state even among laymen is a public state. What is called the "domi-native power" of superiors is supernatural, canonical (c. 101, § 1) and public. Also, this power is exercised in the same way as jurisdiction, according to a,declaration of the interpretative Commission of the Code and, recently, of the, Oriental Code of Canon Law. Religious superi6rs are ecclesiastical superiors (c. 1308, § 1; coll. 572, § 1, 6c) in those affairs which concern the state of perfection as such, and for many which relate merel~ to the simple Christian life of the religious. Among the rights and privileges of lay religious;finally, may be counted those of clerics themselves.The Church does not wish to treat religious differently frbm clerics, so in many respects: she puts'the consecration" conferred by religious profession and the consecration-of Holy Orders upon an equal ~footing. Moreover, this similarity~, of treat-ment is only right. Finally, let us consider only the duties of the lay re-ligious: To the obligations, of all the faithful ("besides those precepts common to all") and to those which are proper to all religious ("ev~angelical counsels, canonical religious discipline"), lay religious add the obligations common to clerics, according to the tenor of canon 592. This completes, in its fundamental outlines, the jurid-ical picture of the lay brother as a religious. Layman . . Let us now examine themeaning of the word layman. When we apply this designation both "to a.religious and to a person in the world," it is clear that we are using the + + + Teach~ng Brothers in the Church VOLUME 20, 1961 4. 4. 4. A. Guti~,rre~, C.M.F. REVIEW FOR RELIGIOUS 260 word in equivocal senses with very great difference in con-tent. It is terminology which certain authors, perhaps, are justified in criticizing. Applied to people in the worl'd the term layman in-cludes, canonically, a two-fold meaning, one negative and one positive. Negatively and in the unrestricted sense lay-men are those who are neither clerics nor religious. In a more restricted, but still canonical sense, they are those who are not clerics. This real but negative aspect is per-haps the one which first strikes anyone considering the or-ganic ~nd,constitutional structure of the Church. The lay-man as such can exercise no power, either of orders or of jurisdiction, these being ireserved to clerics, as stated in canon 118. With respect to the power of orders~ he cannot celebrate Mass~ consecrate or offer the sacrifice ',ex off~cio" (c. 802), nor perform any acts of public worship' (c. ,1256); he cannot administer the sacrament of penance (c. 871), nor confirmation (c. 951), nor" extreme unction (c, 938), nor in general the other sacraments (c. 1146). With respect to jurisdiction, the layman can have no share in it, neither in its teaching authority, nor in any of its governing au-thority, whether legislative, judicial, penal, or .executive, so long as these functions are free and discretionary. As a consequence, he is incapable of having an ecclesiastical office in the strict sense of the term (c. 145). This is the negative side of being a layman in the Church, a real as-pect which is fully applicable to the lay religious in'the more restricted sense of the word layman. This negative idea, which has prevailed down to our time, is incomplete, Postitively, the layman is characterized by a public juridical condition resulting from his own set of canonical rights and duties. But as a matter of fact this juridical con-dition is of little relevance here since in so far as rights and duties arise from this condition, they suppose a life in the world, which is the negation or the absence of the religious character. Neither are the relations between lay-men in the world and religious of interest here, nor matri-monial rights and family relationships, the rights of lay-men in a canonical process ,and in the admisistration of ecclesiastical non-religious goods, the whole section in the code "On Lay.Persons'~ (Book II, Part $), and right of lay association and so on. Here rather there arises spontaneously the idea of the constitutional character of the religious state in canon law. As baptism transforms man from citizen to Christian; and sacred orders, the Christian into the cleric; so profession transforms a member of the faithful into a religious. In, spite of its superiority, the religious state maintains itsi canonical,genus as a lay state. But the specific elementi religious, profoundly affects this generic element, as the species man is profoundly set off from the genus animal. Nevertheless, the following points, common to laymen in religion and laymen in the world, merit a particular emphasis. In relations with the hierarchy, "laymen have the right of receiving spiritual goods from a cleric accord-ing to the discipline of the Ctiurch, especially ~hos~ helps which are necessary for salvation" (c. 682).These are in particular apostolic preaching, divine worship, and the sacraments. Laymen can participate in the exercise of functions in the area of liturgy and ritual, such as active participation in the Eucharistic Sacrifice, serving Mass, acting as sacristan, choir member, organist; sexton, and so on important responsibilities which women ought not to exercise and upon which depend, in great measure, the full dignity of di~cine worship. They can also'participate in the domain of the apostolate. Here we approach the area of the third point of our triplet:' brothers, laymen, teachers; that is, religious as apogtles. Apostle The vocation of teaching lay religious is a canor~ical vo-cation that is essentially apostolic. Teaching constitutes their specific end, and it is clear that a specific end cannot be separated logically, psychologically, or juridically from the generic end. This is why it is that as their state of perfection, the re-ligious state, is public, so also their apostolic activity is not simply private activity which is praised and com-mended as private by the Church. It is certainly an apos-tolate that is in some sense official in the Church. Teach-ing religious have as it were a mission or a mandate of the Church, even of the Holy See if they are of pontifical status. The Roman Pontiff, writing to the Cardinal Prefect of the Sacred Congregation of Religious on March 31, 1954, about lay teaching religious expressed himself in this way: "Let them form in Christian virtue the students given into their care as the office entrusted to them by the .Church certainly demands." Evidently the apostolate of those who teach is reducible to the authority of the magisterium of the Church. The Roman Pontiff affirmed this in a recent address to the Second World Congress of the Lay Apostolate (October 5, 1957) in defining the nature of this apostolate and of the mandate of the Church. "In the present case there is no question of the power of orders, but of that of teaching. The depositaries of this power are only those who possess ecclesiastical authority. Others, priests or laymen, collabo-rate with them in proportion as this power has been con-fided to them for the faithful teaching and directing of the ~aithful (cf. cc. 1327, 1328). Priests and also laymen can receive such a mandate, which may be, according to the situation, the same for one as for the other. Nevertheless ÷ ÷ ÷ Teaching Brothers in the Church VOLUME 20, 19~1 261 4- A. Guti~rre~', REVIEW FOR RELIGIOUS 262 such mandates are distinguished by the fact that one group is of priests, the other of laymen. As a consequence, the apostolate of the first group is priestly, and that of the second is a lay apostolate" (Civilt~ Cattolica~ 1957, p. 183, n. 9). And again:, "We are explaining here the concept: of the lay apostolate in its strict sense, according ,to what we have :explained above about the hierarchical apostolate. It consists, then, in this fact, that laymen assume tasks which flow from the mission confided by Christ to his Church. We have seen that this apostolate remains always an apostolate of laymen and that it never becomes a 'hier-archical apostolate,' even when it is exercised by a man-date of the hierarchy" (ibid. p. 186, n. 22); This directly includes laymen living in the world, not clerics or reli-gious; but it may be understood of teaching religious. The Pope speaks clearly of a mandate, but the qualified sense which he gives to this concept is clear,,even for the designa-tion of a task that is very noble. This.power. to teach, received by a mandate from the hierarchy, is rooted in the authority of the magisterium. It is not strictly jurisdiction, and :consequently laymen do not become clerics by virtue of participating in ecclesiasti-cal power, because they. are incapable of jurisdiction (c. 118) as the Sovereign Pontiff has eneregetically affirmed. This is why the teaching office of laymen is not authorita-tive and cannot of itself oblige one either to intellectual submission or to moral practice, except in so far as this office faithfully reproduces the authentic rriagisterium of the hierarchy. Moreover, the Roman Pontiff adds: "As far as the value and efficacy of the apostolate that has been developed,by teaching religious is Eoncerned, it depends on the capacity of each one and his own supernatural gifts. The words of our Lord may well be applied to lay teachers, to religious, and to all those whom the Church has charged with;, the teaching-of the.truths of the faith: 'You are the salt of the earth, you are the light of the world' (Mt 5:13~14)" (ibid. p. 183, n. 9). In conclusion, the .mandate to teach religion confers upon the layman, an ecclesiastical power, but this power is not that of jurisdiction. Rather it must be said that it is a purely executive power, not a discretionary one~ a "mere mission to.execute" which laymen are capable of having: Since it is socially and publicly organized, this aposto~ late, even though it is simply executive, cannot escape be-ing one of the Church's broad commitments; for she is to a great extent responsible to the world for the accomplish-ment of' her mandate. So it is that .teaching laymen have a great responsibility. It is necessary to add that besides the efficacy of their mandate, religious have an intrinsic union with the Church and her interest, a perpetual, necessary, and in-tegral union, They are fully united to her in virtue of their state of life, even in virtue of religion or of the vow of obedience (c. 499; § 1). This is why the religious apostolate, apart from its public organization, is in itself superior by its nature to Catholic Action. Catholic Action groups turn over their cooperation and their activity to the Church, but these are always freely given and for the most part temporarily and partially. The Church, while she tends to hold Catholic Action within proper limits, actually places more confidence in religious in all areas of the apostolate. The object of this vocation is related to the nature of the apostolate of teaching, Concerning this object, the Church certainly commissions her religious to teach pro-fane disciplines in proportion as human progress fulfills the providence of God for the world and for man elevated to the supernatural order. As a matter of fact, she claims as her own the right of erecting schools of all kinds (c. 1375). And let us note that this is a deep and very extensive area in which the mission of lay religious coincides with that of lay Christians living in the world, one which we cannot develop here. But the principal object of the Church's mandate is the teaching of religion: the Church wishes religious to be her collaborators in her specifically divine and supernatural mission. Allow me to single out here three matters or conclusions of a practical nature: First, there is need for a demanding preparation in the teaching of religion. This is demanded by the Church and by the spread of the kingdom of God, both of which are very much bound up with the teaching of religion. It is also demanded by the current of the times. Superiors of teaching religious are much preoccupied with all this; and the Holy See has wished to put herself in the lead in this solicitude by creating recently at Rome the pontifical institute, Jesus Magister, for the higher scien-tific and religious formation of lay brothers, as she did three years ago in creating the institute, Regina Mundi, for religious women. Second, the schools of religious, even lay religious, are, rigorously speaking, "Church schools." If other schools can receive a mandate from the bishops, those of religious, especially, if they are of pontifical rank, have a mission from the Holy See. Thirdly, teaching lay brothers have the duty and the mandate to teach religion; but they have also a certain right. This is why it is that, under the supposition that they are well prepared, they cannot without injustice be deprived of this right and hin-dered from exercising it. According to canon 1373, § 2, the ordinary of the place must take care that religion be taught in secondary schools and places of higher education by zealous and learned priests. This does not apply to the colleges of religious, but to the schools of secular laymen + + + Teaching Brothers in the Church VOLUME 20, 196i about which the same canon, is speaking (cf. c. 1379, § 1). In each case it is incumbent on the ordinary of the place: to approve of the teachers (when they are not already ap-proved by institutes of pontifical rank) and of the religion books; to exercise vigilance for the faith and good morals; to make a visitation of the college in connection with the teaching of religion and of morals (c. 1373, § 2; 1381; 1382; 336; 618, § 2, 2°). In general he can examine teachers and forbid one or another to teach religion; but he cannot ab-solutely deprive a college of religious of the right to teach religion in order to confide this task to a priest. In this matter, for religious of pontifical rank, it is possible to bor-row a good practical juridical criterion from canon 880, § 3: "But in the case of a formal religious house, a bishop is not permitted, without consulting the Apostolic See, to take away at one and the same time the jurisdiction of all the confessors of the religious house." Conclusion From what we have said, we may conclude that the lay teaching brother represents an altogether special type of person in the Church. He is a person who, without be-longing to the class of clerics, enjoys its generic rights, ob-serves obligations common to clerics, and participates, in a certain measure, in the power of the magisterium of the hierarchy, in this way becoming a powerful and very effi-cient collaborator with the priesthood. This is said of re-ligious as such, that is, those entirely vowed to the state of total evangelical perfection and to the discipline of this state as the Church has organized it. Nevertheless, he has points in common with laymen living in the world in what pertains to the concept of a layman in the restricted sense of the word. In the Church, the lay religious represents, then, a special vocation, divine and canonical, tenderly defended and protected by the Holy See. A. ~,~l~rre~, (~.~.~. REVIEW FOR RELIGIOUS 264 MICHAEL NOVAK The Priest in the "Modern World Part of tl~e difficulty in establishing the role of the priest in the modern world is due to the historical changes in society: the separation of Church and State, pluralism, popular education, and the like.~ Part is also due '~o the spiritual, inheritance of the American C~ttholicisrh. What happens to the priest in America ;is important for the world because it is in America that the new forms of civilization are being nurtured and that a new Christian humanism is taking root, as both Christ.0ph~r Dawson and Jacques Maritain have noticed. But many things in our land conspire to confuse the role of the priest. The recent~ presidential campaign showed .that in many ~areas of our country the words "ecclesiastical pressures" conjured up an ominous and ugly image and that "priesthood" is still a word of super-stition. On the other hand, the Hollywood image, as in Going My Way, seems intent on proving that the priest is a "regul-.,- guy";: even in Pollyanna the fearsome min-ister had to be converted and become a friend of all. It is as though the psyche.of America, deeply scarred by its experiences with theocratic Protestantism in its early history and with the more or less autocratic clerical types which it knew in Europe, is engaged in a struggle to as-similate a difficult figure in its world view. Early propa-ganda explicitly described America as a new world and as a p.aradise; and perhaps implicitly as an es,cape from the sinful and tangled past of Europe. It was as- though America would be the land without original sin, the land of a new humanism built by reason in the high flood of the Enlightenment. In this view, expressed in the writings of Thomas Paine and the good but secular life of Benjamin Franklin and preserved in many of our academic environments, today, a role for the priest is difficult to find. He is a relic of the past, a past that is not admired. The modern Protestant, Michael Novak, who is studying at Harvard University, is living at William James Hall 109A, Harvard Univer-sity, ~Cambridge 38, Massachusetts. VOLUME 20, 1961 265 Michael Novak REVIEW FOR RELIGIOUS 266 proud of the influenc~ his congregationalist and indi-vidualist theory have had upon the formation of Ameri-can democracy, has more and more democratized his own clergy. The transition in Pollyanna from fire-and-brim-stone to friendliness seems to symbolize quite well spiritual and social ~volution of the Protestant clergy. But in Italy too ~he American priest and seminarian probably distinguishable from his European counter-parts by a humanness and humor of view that is quite As Father Ong has pointed out, the American pastor is also a building pastor, who knows the language of builders and fund raisers; he has thus kept himself the everyday world of men. His European counterpart often far more aloof, even austere. It is even likely that younger American priests inherit the congenial, friendly attitudes more markedly than their elders who are closer to Europe. But at what point can the young priest draw the line in being a regular guy? Where does his identification with the laity begin and where does it end? The modern emphasis upon the apostolate of the laity has also, like the [actors mentioned above, helped confuse the_role the priest. Externally, the expectations of people° around him, within the flock and without, have ,changed. his own spiritual development is pulled in way and that: to silence and to action, to human develop-ment and denial, to affability and'restraint. It is diffi-cult [or the priest to find himself. In nearly every culture but our own, the social sig-nificance of the priesthood was not only great but central. Whether by special talent of mind or imagination, physical appearance, or early consecration, a priest was chosen to stand apart~ from and above other men. His counsels were important if not crucial; often he was highest leader; if not, his knowledge about the past, opinions about the future, and symbolic power over unknown forces of life were essential to the man who was. The early priest seemed to have combined in his person the.roles of priest, prophet,~and king; in fact, it was into this pattern b[ symbolism that Christ Himself was born, though the three functions had by that time been separated in practice. The splitting of these [unc-tions began early, but the social symbolism remained in the days of Greece and Rffme the power of the priest in civic matters was very great. Only in early Christian culture did ecclesiastical affairs begin to stoutl y defended as independent of secular affairs, and historical process~o[ distinction begin. In the Nestorian councils, the Church fought bitterly for the right to her own doctrine and her own line of bishops, independently of questions of empire and political peace. In later times, emperors and kings grew restive under clerical power, and the people grew restive under the kings. A thousand years of political evolution have given .us democracies and republics in which the role of the priest has changed often and'nearly always in a .fashion that has delimited his functions more :and more narrowly. Still, even today, the stature of a priest as "another Christ" and as a man of education and authority is carried over to some extent into social and~civic matters. Thus the priest of today has behind him a long histo.ry in which he has possessed at least a twofold status.He has repre-sented not only the -spiritual authority of Christ (which extends to some temporal:spiritual or "mixed:' matters like marriage) but also the social authority of secular prestige and influence. ,Modern times, however, have marked a decline in this second status, for widespread higher education and the maturing of the modern fields of specialization have produced many other leaders than the priest: lawyers, .doctors, business and labor leaders, intellectuals and artists, the ministers of many religions, and even many from~among the ordinary public. The priest, then, can no longer take for granted his place of prestige in secular society; he is one among many and will have little more influence than his energy and talents .earn. Given the tradition of anti-clericalism, which lives on in its, own forms even in America, he will ha,~e even less. . Moreover, the leadership in education which the priest once held has gradually been lost since the Enlighten-ment. Modern education no longer follows the curricula of the medieval universities; most men seem to feel that our civilization, with whatever loss, owes many of its ad-vances, political, and humane as well as material, to the shift~ At any rate, the priest is no longer among the few who are educated; he is among the many; and the main-stream of education does not parallel his own but diverges [rom it. His education is now seen as specialized, with its own jargon and viewpoints. It is no longer a classical education, "universal" or "liberal" in Cardinal Newman's sense; rare is the seminary in which, the classes in Greek and in Latin are not simply a gesture towards a dying or dead tradition and in which classes in modern literature, history, and social studies have taken up the slack. The seminary is isolated; it is not ordinarily in a university milieu. The professors in the nonecclesiastical subjects are not ordinarily specialis~ts, producing and creative in their fields; sometimes they are teaching merely because as-signed to teach. The seminary library is ordinarily thin in literature, sociology, politics, psychology, economics; the periodicals are mainly religious, Catholic, and popu-lar. In the isolation of the seminary, the professors of 4- 4. Th~ Priest in th~ Modern World VOLUME 20, 1961 267 4. 4. 4. Michael No~ak REVIEW FOR RELIGIOUS 268 philosophy and theology rarely have an opportunity take an active contemporary part in modern political, literary, scientific, and even religious discussions. Their fields no longer represent leadership in modern intel-lectual circles; and even within their fields, Catholic work is, not without some justice, in poor repute. There are exceptions to these strictures, of course; but I be-lieve it will be found that they are exceptions in great part because they fulfill the criteria mentioned and have grown strong in swimming against the stream. The facul-ties of many seminaries are small, ingrown, overworked, and not contemporary in their outlook. A seminary stu-dent once said a professor of his had "one of the best minds of the fifteenth century"; and the humor of the lay in the ingenuity of expressing the professor,s com-petence together with his liability. Another change in modern civilization is that art longer looks to the Church for patronage; young artists, in fact, are often among the most anti-clerical, while priests are among the least appreciative of the arts, clas-sical and especially modern. Of course, ordinary people in general have lost touch with the arts, and it is to be expected that the priest rise always above his origins. Many of the difficulties in the matter of censor-ship arise from this alienation of artist from people, and artist from priest; where there is little sympathy, is blocked. In politics, too, the priest plays lesser part than he was wont to do; when he does try use influence by swaying others, even through non-violent picketing or letter-writing, it is resented. Perhaps springs from memories of the past, perhaps part from the ambiguities of role still inherent in situation. At any rate, in most lands the priest plays greater part in politics than other professional men other men in general, exception'made perhaps for influence and kind of his opposition to Communism. Just as men today are more educated than before, so the social arrangement is more sensitive. ~Powers are better defined, and organized pressures are more quickly felt and more deeply resented. Even on religious and theological subjects, the ordinary people hear many speakers, gain many ideas and in-sights, see many varied forms of worship, apart from what they learn from their own priest. The result is that our pluralistic civilization, the people are free in priest's presence in a way never experienced before. When they submit to him in doctrinal and moral matters, not because they are overawed by his social stature greater learning or because they have nothing else against, which to compare what he tells them. It is because they make an act of faith that his authority comes from Christ. It is because they possess the simplicity of free and willing obedience, precisely one of the notes most proper to the Gospels. The attitude of the laity towards the priest can perhaps be more definite and single-minded now than befqre. Western culture is perhaps losing the layers of non-essential clerical authority. It is true that in some lands the transition to this new freedom has at first been tragic. New freedom tends to be intoxicating; the old confusion of spiritual and social status is slow.to clarify. For a whole generation or two or more, the transition can wreak disastrous gaps in the prac-tice of the love that should be shown to God and neigh-bor. On the other hand, for those persons and those lands who do mature to such obedience in faith, the obedience of free men standing erect as Charles P~guy used to say, there is a great gain in clarity of motive and relationship. The priest does not rule the flock as a tyrant does his subject peoples, or even as a paterfamilias used to rule his slaves, but as a father does his grown and free sons~ "not as the rulers of the gentiles . " And perhaps it is true that the good father puts himself in second place. The peasant classes of Europe were wont to invest the priest with much more authority than this, perhaps a little as the rulers of the gentiles. In Italy it is still the custom .to kiss the priest's hand, while kneeling be-fore him, as it was once the custom to greet a liege lord; the respect of the Irish for the priest and, perhaps similarly, of the peopl~ of the Tyrol for their priests (the cultural leaders in the enduring attempt to maintain independence from England and Italy) is quite well known. But the descendants of these peasants, in America now, may well be beginning to deny to the ,priest some of the attributes, like quasi-infallibility, they once im-plicitly seemed to grant-him. They may reason that if the Popes have recently had to call for liturgical reform, for a revival of Thomism, and for several other new currents of activity, then things have not been all they should. When they see priests disagreeing among them-selves, they begin to understand the freedom that is al-lowed to prudential judgment of concrete situations, on which differences are bound to thrive. Thus, due to the social changes of the last centuries, not yet at their culmination in the civilization that is to take shape from our own, the role of the priest in a pluralistic land is trying. A vast range of excellences is required of him. His every fault grates on sophisticated, and specialized, nerves. The freedom of the layman is a heady freedom; habits of anti-clericalism persist, espe-cially where they are stimulated by habits of clericalism that have not yet disappeared. In a transition period genial equilibirum is hard to maintain. Only the sim~- 4. The Priest in Mo~ World VOLUME 20, 1961 269 4" Michael Novak REVIEW FOR RELIGIOUS 270 plicity of freely yielded intelligence, in faith, gives the priest effective authority, and even then not in his own name, but in Christ's. And yet this yielding is at the heart of Christianity, a splendid ever-renewed miracle. Priest and people take up mature relationship, as fallibl~ human beings, at this font. If the priest's relations with others were the only diffi-culty with the pressure of modern change, his lot would be easier than it is. His most painful' task is in the orienta-tion of his own inner life. It is often, though, it must be stressed, not always observable that the spiritual forma-tion given in the seminary has its roots in cultures far different from our own, ones whose obstacles to Chris-tian life and advantages for Christian life were different from our own. In such cases much of seminary spiritual formation is irrelevant and could not in fact be con-tinued except in the hothouse isolation of ithe seminary; in priestly practice it wilts away. Where the public prayers, rules, and mental attitudes inculcated in the seminary derive from the European piety of the last few centuries, they are not simple, in touch with contem-porary reality, or directly reminiscent of the Gospels. To the American of our day, they seem overlaid with un-congenial sentiment, a strange legalistic attitude toward God, and narrow suspicion. Not a few books on the seminary rule and on growth in spiritual perfection seem to delight in driving the soul to more and more precise observance; there is in them little sense of enlargement, wholesomeness, freedom, and love, such as one gets~in reading'the Gospels. They !cad away from the experience of God to the observance of discipline; yet they are not so demanding and deep-searching as the works of St. John of the Cross and St. Teresa, which may not be read with near the frequency or attention. It might even be said that by their dwelling on the observance of discipline they conduce to a comfortable mediocrity and the easy appea~:ance of platitudes on the lips. The young priest has to make'up his own mind on each of these questions, but the difficulty is that the more in-tent on spiritual growth he is, the more he may, have given himself to uncritical docility. His spirituality, there-fore, may end up being a borrowed light, never seized by his owri independent judgment and rooted perma-nently and pei~sonally in his own intellect and will. The danger 'is great that the Jansenist strain so deeply rooted in most of the national stocks from which Our priests spring will be passed on uncritically from generation 'to generation and that .some young American clerics will strain every nerve during their seminary days to convince themselves of last century European attitudes which they do not share. It*is a shame When afterwards, as priests, they scuttle much of what they spent years trying to learn because it is unrealistic. Then,. Comes the tempta-tion to throw out everything that they learned. The task of the seminarian to grow up into the stature of a full human being of the late twentieth century and to grow up into the stature of Christ, is terribly difficult, because, for the most part, it must be done without guides. The riches of spirituality in the American spirit have hardly been noticed, let alone tapped; often the typically American virtues are stifled or at least warned against, perhaps because of the misunderstandings about "Ameri-canism" a half-century ago. The. young American priest, when he is faithful to his own best insights and spirit, is a new kind of priest and is working out a new image of spirituality. Perhaps some day one of them will set the new way d~wn in writing, and tl~e man~ will not feel so much alone. As the external social events of the c'enturie~ have served to strip down the ~ole of the pries~t t9 its priestly, Christlike essentials, so perhaps the new kind of. holiness will be only "the more excellent way" of which St. Paul speaks,'less legalist, more fully hum~in because divine, rddolent of freedom and love. To mfi'int~iin such holiness in the complexities of our age will be witness indeed to Christ. It will reach to the heart of our civilizati~6n. 4. 4. 4. The Priest in the Modern World VOLUME 20, 1961 - JOHN C. SCHWARZ, S,J. Journey into God ÷ ÷ John C. Schwarz, $.J., writes from 899 West Boston Boulevard, De: troit 2, Michigan. REVIEW FOR RELIGIOUS 272 The Christian heart has always taken reverent inspira-tion from pilgrimage. But, in a certain real sense, the most sacred pilgrimage of all is traveled daily without a step taken or a sea crossed. This pilgrimage occurs i.n the Mass, a pilgrimage with vast practical significance for the dail,y life of the religious. Each morning at Mass the religious (and any partici-pant in the Holy Sacrifice, of course) travels a four-stage journey into God, a pilgrimage culminating in a renewal of abiding union wiih Father, Son, and Holy Spirit. This journey's firslt stage begins with the introductory psalm and succeeding prayers at the foot of the altar, at a respectful distance from God. God is truly present, but priest and peop, le stand off, as at the entrance of a sacred shrine. God is present, but somewhat remote. The Mass moves on. The Consecration ushers man into the second stage of his journey, for now the once remote Lord becomes close at hand, warm and near, yet remain-ing exterior. God has drawn near, but union with Him remains incomplete. In the reception of Holy Communion the Lord dra-matically enters the human body and soul, _establishing a profoundly intimate union. So long as the sacred species remain, the humanity of the Word Incarnate abides. This union, though no longer exterior, remains temporary. This has brought the pilgrim to stage three. The final stage of the journey toward and even into God begins at last when the humanity of Christ Jesus departs with the Eucharist. The divine Persons remain-- in a union both interior and permanent. Only rejection by serious, wilful 'sin severs this union. Father, His eternal Son, and Spirit now reside within in a deeper, greater way. And thus a silent journey terminates in God. Significantly t,his renewal of union with the Triune God will occur for most religious as they conclude the time of Mass and meditation, setting forth into another' apostolic day. In God's designs Ithe Eucharist daily provides a visible, tangible reminder of the Christian's personal union with the indwelling God. This sacred symbol of grace and indwelling Love is held by the celebrant °above the ciborium, with the words "Ecce Agnus Dei . " Moments later, Christ Himself 'enters the body of those who re-ceive. Sensibly seen by the eyes and felt upon the tongue, the host is the living symbol and reminder of what the eyes can not see nor the tongue feel: sanctifying grace and union with the indwelling Lord. So "Communion is both a symbol and a cause of the inner'union which is aimed at.~'1 Nor is this profound union a fixed, static relationship. "The Eucharist is a food and presupposes the existence of life,''-~ and all life implies growth. The life of grace, so intimately linked to the indwelling, is.no exception. In fact, as Canon Cuttaz notes in his excellent study of grace? "The purpose and effect of Communion are to intensify God's presence in the soul by increasing grace." The Holy Spirit, sent initially in Baptism, is sent anew to the .soul with every increase of sanctifying grace. Hence wholehearted selfgiving in the Mass and Communion is the basis for a new sending 6f the Spirit and a deepening of the Trinitarian life within us. At this point a word of caution is appropriate. The heart of the Mass lies, of course, in the sacrifice of Christ and our privileged participation in that Godward act, not in Holy Communion. For Holy Communion derives its full meaning from its function in the sacrifice (and not vice versa), and it leads to divine fulfillment in the souls of those who have offered themselves to God "through Him, with Him, and in Him." God's indwelling fulfillment of His own desire to live in the human soul expresses the final perfection of His love. ~Nhat further can even God do while man remains in his time of growth and probation? Raoul Plus ob-serves that "This is the last word in the great secret of the Christian life." One often hears a certain school, automobile, book, or church structure praised, as "the last word, the finest, the ultimate perfection, superior to all others. The revealed fact of God indwelling stands as the "last word in the great secret," the ultimate gift. Even the stigmata of a St. Francis or the appearances granted to a Berna-dette ranked far below the Presence in their souls. But man's capacity for dull insensitivity in the presence of divine generosity rates high on the list of earth's won- ~"Sanctifying Grace" by E. Towers in The Teaching o] the Catholic Church (New York: Macmillan, 1954), v. 1, p. 564. 2 What is the Eucharist? by Marie-Joseph Nicolas, O.P. (New York: Hawthorn, 1960), p. 91. s Our Lile o] Grace (Chicago: Fides, 1958), p. 167. The essay on the indwelling, Chapter 6, is of particular value. ]ourney into God VOLUME 20, 196]. 273 ÷ + ÷ John C. $chwarz, S.J. REVIEW FOR RELIGIOUS 274 ders. Imagine a man who barehandedly grasps a high-voltage cable exposed and sputtering, yet continues to converse amiably with bystanders while a stream of current charges through him! Transferred to matters spiritual, the image is not without value for stressing the fact that we comparably and steadfastly refuse to be impressed by the revealed fact of the omnipotent Creator's dwelling within us. Granted, voltage is felt, while God is noL Nevertheless, divine revelation confronts man with .the [act of the Trinity within when the soul possesses sanctifying grace. Such opportunity, provided by His presence, must be seized, utilized to the utmost; it should make a difference, shatter lethargy, produce results. Of what sort? Father Plus again: The imitation of the Lord Jesus should not be an imitation from without. We are not to copy Him in order to be able to reproduce Jesus Christ; we are to copy Him in order to be able to continue Him. Christ wishes to enjoy continuity in each one of us~ This is.the last word in the great secret of the Christian life . Our poor humanity is called to share, thanks to Jesus Christ and in Jesus Christ, the life of the three Persons.' The daily Mass-journey into God (or perhaps equally accurately, God's journey into the soul) provides a daily fresh start in one's continuance of Christ's life. Deliberate efforts at patience and love, at self-sacrifice and under-standing, at prayer and obedience, are merely efforts to present to Christ a mature and maturing personality which He can use. Refusal and culpable failure (that is, when cupable) in such efforts produce a serious restric-tion of Christ's intent to continue His life through this human being. A personality of harshness, 6f resentment, of careful focusing on the almighty minimum scarcely serves Christ's uses and designs, just as a child's violin, with three strings missing, would thwart even the great-est virtuoso. God must not be relegated to the shadows of the soul. Recently a portrait by the French impressionist, Cezanne, sold for $616,000 to a wealthy connoisseur and his wife. Will these new owners place this valued masterwork a shadowy cellar or storeroom? Yet God indwelling may be, in practical el~ect, reduced to a comparable insignifi-cance. Elizabeth of the Trinity, saintly young Carmelite of our own century, considered the Divine Guest as a singularly practical, albeit sublime, influence; practical results are expected: "He is ever living in ore: souls and ever at work there. Let us allow ourselves to be built up by Him, ' In Christ Jesus (London: Burns, Oates, and Washbourne, 1923), p. 26. May He be the soul of our soul, [he life of our life, so that we may be able to say with Paul I live, now not I." Perhaps the personal frustration vaguely felt by "shine religious springs from their practidal refusal "to be built up" by Christ, refusing'to relinquish habits,and attitudes ininiicable to Christ. One ffbui~ e~pect that the Infinite Lord can not be constrained without some degree of un-easy tension developing ~as a consequence." One is re-minded of the massive tension generated when aircraft engines are gunned to full power while the plane stands motionless, braked tightly, just before its take-off run down the airstrip. The plane thrpbs, with power con-strained. Then, engines subsided~ brakes released, the craft sweeps into smooth, swift motion down the airstrip and gracefully aloft. Engine powerhas been channeled into its normal fulfillment. Smooth performance results. Ten-sion resolves into flight. Perhaps the tension in some religious lives is, at least in part, comparable in origin, stemming at least to an extent from constraining the 'Lord :within. His dynamic life and love seeks cooperative expression in the life and love of a religious. Refusal to make a lifetime relation-ship out of this can 'produce only frustration and con-flict. ~ . ~." . ~ '" ' The four-phase Mass-journeys, into God brings ~the re-ligious once again to the .threshold.oLanother day where our_hUman efforts at charity will;as two voices harmonize in one song, blend into Christ's charity:Our human pa, tience, compassion, teaching, courtesy, gentleness; work, will blend into Christ's. ~.~ The Christ-union in this life, so, rich a delight, prepares the soul for a future prize indescribably richer so states Gerard-Manley Hopkins:° "r Be our delight, 0 Jesu now ~ As by and by our pri[e art Thou, And grant our glorying may be World with end alone in Thee. 5In asserting .the possibility of supernatural sources of tension, there is no intention of denying the importhnce and prevalence o[ natural soui'ces of tension, culpable and inculpable~, i:onscious and unconscious. ~ Translating :the "Jesu Dulcis Memoria." VOLUME 20, 1961 CARL LOFY, ,s.J. Finding God's Will Through the Discernment of Spirits Carl Lo~/, S.J., who is studying at the Univer-sity of Innsbruck, lives at Sillgasse 6, Inns-bruck, Austria. REVIEW FOR ~ELIGIOUS 276 In a book published to help commemorate the fourth centenary of the death of St. Ignatius Loyola? a group of leading experts~on Ignatian spirituality has gathered a series of essays which, taken as a whole, constitutes one of the most valuable contributions to this field in the past decade. The profound insights it furnishes into the most fundamental aspects of the Spiritual Exercises make the book required reading for anyone seriously interested in retreat work and/or Ignatian spirituality. The most im-portant essay is that by Father Hugo Rahner on the dis-cernment of spirits. Most of the other~ eight articles pattern themselves ar6und that of Father Rahner's, espe-cially Father Heinrich Bacht's discussion of the discern-ment of spirits according to the early Church Fathers and Father Karl Rahner's study of the dogmatic implica-tions of finding the wili of God through the discernment of spirits. Hugo Rahner's Article ' ~ugo' Rahner's article can be summarized under the following po!nts: 1) For St. Ignatius the most important part of the retreatwas the election. Everything else in the Spiritual Exercises either builds towards this or is meant to strengthen it. 2) Among the three times outlined by. the saint for making the election, St. Ignatius felt that the second (that is, when the soul is moved by consolations and desolations) is and should be the most common. 3) As a result, the rules for the discernment of spirits take a Ignatius yon Loyola: Seine geistliche Gestalt und sein Ver-miichtnis. Edited by Friedrich Wulf, S.J., Wiirzburg; Echter Verlag, 1956. Hereafter this work will be referred to as Ignatiu.~. on extreme importance, since it is precisely through these rules that the retreatant distinguishes the different effects (consolations and desolations) of God, the good angel, and the devil in his. soul; moreover, it is through such dis-cernment that~the exercitant comes to a certain' election concerning God's will for him. In all this St. Ignatius had to presuppose several points as e~cident. The first of these is that~God does have a distinct will for each individual. Secondly, it is not al-ways possible to know that will simply by applying gen~ eral moral principles to particular~ situations, To know that each of two acts would be prudent ~ind good ,does not yet assure one to which of these two God is calling him. Finally, God can and often does manifest His will for the individual through consolations and desolations. When He so acts, His will can be discovered by applying the rules for the discernment of spirits to the different consolations and desolations one experiences in his prayer as he considers against the background of the life of Christ the alternatives of election. Father Rahner insists that this should be the most common way of making the election. ~ ~ ' "Impliqations ol This~ View,~ Let us consider for a moment some of the implications of this interpretation. In most present,day practice2 it is taken for granted that the'third time for making the election (that is, when the person is not moved by~ the different spirits) iSthe most common. Why this is so is not immediately evident. Perhaps we are afraid to attribute our consolations and desolations to supernatural causes when we know today how much can be caused naturally by the subconscious forces at work in us. (Father Karl Rahner handles this p~obl~m explicitly in his article.) In any case, we tend rather to elect what we are going to_do for God rather, than to discover, what God wants of us. Confronted by a choice between two good or indifferent acts, we normally ask ourselves: "Where can I most 2See, for example, John A. Hardon, S.J:~ All My Liberty: The Theology oI the Spiritual Exercises 0Nes[minster: Newman, 1959), p. 66: "This [the third time for an election] is the most ordinary. time [or reaching a decision." Father Hardon reduces the first time to a "miraculous grace" (an opinion quite co,ntrary to that of both Father Hugo Rahner and Father Ignacio Iparraguirre [Ignatius, pp. 305 ands311]) and handles the second time in three sentences. For him the third time is also '~the most securE" time. "]'his is some-what difficult to understand since, by defimtlon, ~n the first time the person "neither doubts nor as capable of doubting' (Sptr, tual Exer-ctses, n. 175). For Father Hardon t.he third ttme ~s valuable as a check on the second time, which Father Rahner also admits (Ignatius, p. 311). Yet it is interesting to note that for St. Ignatius the second time is the check on the third time and not vice versa; on this see. foot-note 3. + ÷ ÷ The Discernment of Spirit~ VOLUME~ .20, 19~1 277 " 4. Carl Lo~y, S.]. REVIEW FOR RELIGIOUS 278 certainly save my soul? Where'can I be of more help others?~Along what lines d~o my talents run?" and so f6rth. All this is good, 'Fffther Rahner' would say, if we-have first tried the first two times of election and have dis- ,covered that the different spirits are .in fact not at work in us. Moreover, we should recall that St. Ignatius ques-tioned the earnestness of one who is :not so moved. other words, the presupposition that we are not and 'will not be moved by the different spirits is directly foreign to the saint's thinking, For St. Ignatius, the main task of.the exercitant is try to :get into vital, personal contact with God and this contact to ask God what He wants of him. Only God does not "answer" is the exercitant to consider quietly the. pros and cons; and~even in this case, after ar-riving at his decision, he is to ask God for confirmation in the form of consolation.3 Instinctively perhaps we find such language strange: ."How can God tell us His will through consolations and desolations?" And yet it re-mains true that Ignatius was convinced that God can and does "talk" to us through consolations and that ~e can interpret His "words" to us through the rules for the discernment of spirits. Once this fundamental position of the saint is accepted, ~°ne Sees these rules in their proximity to the election at the very heart of the Spiritual Exercises~ The same can also be said for our daily prayer as well. For, as Father Josef Stierli points' out in his article, "Ignatian Prayer: Seeking God in All Things," the search for God in all things is primarily a search for the will of God°in all things; only secondarily is it an affective con~ templation of Him in His creatures, In our daily prayer we are to ask~God what His will~i~ifor us, "not only in our state of life but also in. all particulars.''4 Father Adolf Haas shows ,us in his article, "The Mys-ticism of Saint Ignatius as Seen in His Spiritual Diary," how St. Ignatius did this in his own daily prayer. Here see the saint seeking, in the heights :of mystical union with the different Persons of the Trinity confirmation of his 8 spiritual Exercises, n. 178: "If a choice of a way of life has not been made in the first and second time, below are given two ways of making ~/ choice of a way of life in the third time." See also n. 180, where even in the third time of election we are told to "beg God our Lord to deign to move my will, and to bring to my mind what I ought to do in this matter fhat would be more for His praise and glory"--as 'though in one final attempt to r~main in the ~econd time. Only after this' request are we to "use the understanding to weigh the matter with care and fidelity." And after reaching a de-cision through this rational process, we are to "turn with great dili, gence to prayer in the presence of God our Lord, and offer Him this choice that the Divine Majesty may deign to accept and con-firm it if it is for His ~reater service and praise" (n. 183). ¯ Summary o] the Constitutions oI the Society oI Jesus, Rule 17. election concerning his order's poverty. "Eternal Father, confirm me in my election. Eternal Son, confirm me. Eternal Holy Spirit, confirm me. Holy Tri~nity, confirm me. Thou, my only God, confirm me.''~ The entire con-text of this prayer sho.ws, that Ignatius is here not seeking strength to carry out a.n'~ election already made, but the assurance that what he has elected is truly.the will of God. Confirmati.on means, therefore, the certitude, penetrating the entire personality, that one has really found Goffs will. It is--to use the phras~ found frequent!y in the letters of both St. Ignatius and St. Francis Xavier--"the grace to feel in the innermost part of ourbeing God's. will for us."O +, Role of the Retreat Director This interpretation of Father-Rahner, of course, raises serious dogmatic questions and difficulties. Can we really trust the rules for the discernment of spirits? Does God really make known to individuals His will for. them as' individuals? Are the first and second times for election really more secure than the more rational third time? What is the relation between God's will for~the individual and, the consolation experienced as confirmation? It was the task of Father Karl Rahner to answer these and other questions. He does so brilliantly; but .since his article will appear soon in English,7 we need, not discuss it here, especially since its complex reasoning processes would take us far beyond the scope of this present paper. What should be stressed here is that in the light of this interpretation ~ the role of the retreat director is seen under a new aspect. Retreat-giving need not involve so much the ability to give inspiring points' for meditation (Ignatius insisted that these be short and "to the point, that the main work be left to the exercitant"), as the ability to discern the spirits at work in the exercitant's soul in his search for the will of God. This is a pains-taking, delicate t~ask, not to be regarded lightly. Ignatius himself thought that of all the Jesuits of his day (over a thousand) he knew of only three who fulfilled his ex-pectation~ of,a good retreat master,s In this context the ~ Ignatius, p. 199. , 0 It:is astonishing to see how often this phrase occurs at the close )f the letters of both saints, In the original Spanish, Saint Ignatius )ften uses the word "sentir 'la voluntad de Dios," which means con-siderably more than "to know" and is better translated as~ "to feel" or "to. be deeply aware of." On this see Obras cornpletas~ de $. lgnacio de Loyola, edited by Ignacio Iparraguirre, S.J. (Madrid: BAG, 1952). ~ In the translation of the book Das Dynamische in der Kirche (Freiburg: Herder, 1958). a Ignatius, p. 257. ÷ 4- The Discernment VOLUME 20, 1961 REVIEW FOR RELIGIOUS last part of Father Bacht's article on the role of the re-treat director deserves careful study and restudy. Father Friedrich Wulf's article on Ignatius as director of souls is important in this connection, because it con-tains many remarkable, hitherto unpublished, texts which reveal the saint's personality. Here, too, we see the tre-mendous importance Ignatius placed on the discernment of spirits in his direction of others. The article furnishes rich food for thought for any spiritual director, Practical Importance of This Interpretation We have been able here to sketch only briefly the more important points of this book. There are many others. We can only encourage the reader to take the book and study it carefully; it is to be hoped that the work finds an early translation, for the ideas it contains are basic [or a proper understanding of the Spiritual Exercises and of Ignatian spirituality. Father Hugo Rahner's article is of special importance for it returns to the position of St. Ignatius that God really "talks" with us in prayer and in time of retreat, that He really makes His will known to us --His will for us as individuals. Retreat making is, there-fore, not so much a time of mere resolution making, as of finding God; not so much a renovation of spirit as an inner development in which the person strives for deep, personal contact with God and, in this contact, for God's will for him as an individual. This is the deeper meaning hidden in Ignatius' use of the word "election." This is a bold interpretation, but one which is receiv-ing more and more backing by recent research.9 It is an interpretation that deserves serious attention. One gets the impression at times that retreats are a trifle too volun-taristic, somewhat too impersonal, too separated from prayerful union with God. Do not many work out resolu-tions, make plans for the future, form new particular examens--all.quite independently of formal prayer? Of course, once we have made the resolutions and plans, we offer them to God, ask His grace to fulfill them, and so forth; but the resolution making process itself remains basically rounded-off in itself, shut off, completely (as it were) "our.own." Often we are n6t open to God during the process itself. "God, what will You have me do? What do You want of me?" Such an approach would open us to God within the very resolution making process. The latter would become, quite literally, a search for the will ~ See especially Gaston Fessard, S.J., La dialectique des Exercices Spirituels de Saint lgnace de Loyola (Paris: 1956) and August Brun-ner, S.J., "Die Erkenntnis des Willen Gottes nach den Geistlichen 3O0b u(n1g9e5n7 d),e ps ph. e1i9li9g-e2n1 2I.g Sneaeti ualss oy othne Lboibyloiolag,r"a pinhy G geivisetn u bnyd FLaethbeernll,l lv].[ Rahner in his footnotes, especially on pages 305, 312, and 313. o[ God. The dialogue with God would begin immediately (not merely after the formation of resolutions) and at a much deeper level of the indiyidual's personality. There would be (to use Browning's words) "no spot for the crea-ture to stand in," not even his good resolutions. For we are creatures in everything. We serve God only through His gift to us. He alone knows how we can serve Him as individuals with a radicality of dedication and surrender. He alone can break into the hard core that "protects" the inner core of a self and there touch us and so awaken us to life. It is possible and all too easy to form plans serving God which, although good, do not get down into the real self, do not take hold. of the Whole person, and which, when completed, contain the d.anger of being something "outside God," something strictly our own. To avoid this danger the use of the rules for the discern, merit of spirits in the second time to making an election can be of fundamental importance ~ind help. The Discernmt, nt o] Spirits VOLUME 20, 1951 281 WILLIAM H. QUIERY, S.J. Courage and Counseling William H. Quiery, &J., writes from Cam;, pion House, B29 West 108th Street; New Yolk 25, New York. REVIEW FOR RELIGIOUS 282 Nothing has quite the' force to convince us that we are human as the phenomenon of fear. And nothing can ap-pear to be so ridiculous. Bruce Catton, in his account of the early years of the Civil War, Glory Road, records an amusing incident of a panic-stricken squad of Union troops put to flight by a rumor of a Rebel~breakthrough some miles ahead. As the men ran in disorder past a farm-house, a calm old lady sat on the porch enjoying the spectacle. The soldiers were almost out of their heads in the grip of mob hysteria, and the woman stood up and called to them, "What in the world are you boys running from? They're only men!" The soldiers had no answer for the jibe, of course. Each of them knew that he wasn't acting with cool reason at the moment. The enemy hadn't been seen and counted and a quiet estimation made of their striking force. The Northerners were simply running, that was all. It was the best they could do at the time. Terror had them by the throats. All the unknowns were jumbled and lumped to-gether and blown up into something like that horrifying ghost that children see leaning over their beds at night. That's what was chasing the squad of Yankees. Most of us have little trouble understanding this sort of panic because we have found ourselves in somewhat sim-ilar circumstances, in the grip of unreasonable fears and emotions. Everyone is acquainted with worry and anxiety and tension, at least of a minor sort: the "formless fears" of C. S. Lewis. What makes such fears particularly mysterious and exasperating is the fact that frequently.! enough we are fully conscious that there is nothing to be anxious about, or certainly nothing in the situation that calls for quite the emotional response we find ourselves giving it. We wonder where our courage is at times like these.' Yet strange to say, we have not lost our major life-ideals in any way: We would rather die than desert our cause, and we would never calmly choose to be traitors no mat-, ter what the threat. Still we find ourselves unnerved by ~' / a set of circumstances of small moment and reacting childishly while we know we are not childish at heart. And I am not speaking here of a. problem which i consider to be a specifically religious one.~.It would not be correct to say that there are special threats in the re-ligious or ,priestly life viewed in its spiritual aspects. For our consecration to God is nora gamble. On the contrary, vows are m.eans of making perfection of life more easy and secure. ~One. of the purposes of the vows, according to St. Thomas, is. to eliminate the "main 6bstacles to a perfect love and service of God, to,guarantee, as.much as is pos-sible on this earth, a secure hold on some of the most powerful spiritual means the Church knows of. If we are subject to worries and fears.of variou~ ~.kinds to a somewhat greater extent, than ordinary people, the reason is probably the simple fadt that we have taken owa rather ambitious form of life, that otir aim is high, that we make a more self-conscious effort right from the beginning to fill out and make use of our share of human talent. Our.,counterparts on the :non-religious level are the~politicians and the doctors and the scholars, yes, and those bent on heaping up a material fortune. It ivwith this group that we might find a compai~able level of tension~ anxiety, and worry: From this point of view, then, we, should not be sur-prised to discover that part Of the price of our spiritual ambitions will be some sort of, interior susceptibility to inner conflicts and phobias.~But we have far more reason for trying to control and limit our anxieties and fears ~ttian~ have other ambitious people. Out,target is not an earthly one, but the glory .of God and the sanctification of men. It will be a'great loss if we are kept from that. The panic of the Union troop was not a logical and calculated response to a threat, and this is the case'.with human fears generally.oOur responses are seldom exactly what they should be; and I am not referring to any sort of psychotic or compulsively neurotic reaction, but~just to the "off-balance" emotional reactions that perfectly normal people experience. For iristance, there is nothing unusually abnormal! in a religious who is worried, even greatly~ worried, abouf some truly risky situation: whether,~f0r example, a certain studefit should be. expelled for the good of the others or for the relief of the teacher. The trouble b~gins, though, when the legitimate and reas'6n~able worry develops into a permanent hnd troUblesome, anxiety that louvers his ef-ficiency and impairs the effectiveness, of his work. It is perfectly normal and rational to' experience the sensation of loneliness when one actually is ;ilone. The presence of God, for. the ordinary person, simply does + + + Courage and Counseling. VOLUME 20, 1961' 283 ÷ ÷ ÷ w. H. Qulery, s.l. REVIEW FOR RELIGIOUS 28~4 not compensate for the absence of human companionship. Holiness does not change the social nature of man. But loneliness becomes an unreasonable thingwhen it carries us into a paralyzing depression despite all we do to pre-vent it. Such self-pity is not deliberately chosen. We not turn it on as we might a TV set. We should not be surprised, then, if it does not fade out with a simple flick of a switch. The ambitious role we have chosen in life often calls for public service. Religious frequently work in the public eye, teaching, lecturing, or representing their group in panel discussion or at a civic council of some kind. Every normal person will feel some sort of nervous excitement or self-consciousness in public appearances, particularly at first. But these normal emotional reactions can become unreasonable bullies. They can scare us out of our job and our vocation altogether; or, what is bad enough, ruin our performance. Nor does it satisfy us to say "God will supply" and done with it. We are not entitled to leave things to God until we have exhausted all our ordinary resources and our ingenuity as well. In action, it is a good rule to act though everything depends on our own work (as though God will not supply), provided we pray as though every-thing depends on .God. Other instances of normal emotions which get out hand are easy to find. To hesitate makes sense when much is at stake and when we are :all too conscious of our falli-bility. But excessive hesitancy and indecision can sap strength and waste our time. Again, discouragement an .understandable thing in view of our daily failings; but unfortunately this very subtle and dangerous emotion (Is it not a form of fear?) can grow into a sentimental resignation to mediocrity of a ruinous kind. Again, sense of guilt is common and healthy, scruples a torment-ing excess. Embarrassment is everyone's lot at one time another, but a perrilanent timidity is usually a limita-tion. All of us feel emotion at times; almost all suffer from excess of it at least occasionally. Under stress we feel con-fused. Some exasperating inner battle is'going on and must bear.it at least for a time. It is on such occasions, when we have only a blurred view of our value scale, that we make hurried and faulty decisions. If the instances emotional pressure are froequent, we may find ourselves regularly ,doing quite childish ,things. We know what right, but by a weird subconscious illogic, we do not feel that it is the right thing to do---at least not ~his time. We know we should not be timid or unnerved or so worried' as we are. It may even be clear to us that our state of mind is ridiculo~us, that we will laugh at ourselves later on. But at the time, it does not ]eel ridiculous at all. 'It is not a laughing matter. The philosophers can explain it all to us in technical terms. The mind, the); say~, exercises only political con-trol over the emotions. But what concerns the average person most is what in the world [o do about it.'What kind of interior politics will get the constituents back, into line? Prayer and the sacraments, mortification, sublima-tion, distraction, advice-seeking, rest--alL.of these we en-list in our cause and still we find ourselves over-reacting to minor threats, slipping into unreasonable depression, or harrassed by toll-taking inner unrest. Courage alone is not the cure. Nor,:in fact, can we-talk of a L complete cure in this world for this weakness in our make-up. A cure will only come in heaven with the restoration of the gift of integrity which the first human being lost for the whole family that follows him. A partial solution to this type of problem may very well be counseling--and that is.the burden of this article--but not just any kind~ of counseling will help. These are cases where information is not lacking--the sufferer ordi-narily knows the pertinent facts or at least knows where they can be found and so there is very little to be gained in having them told to him all. over again. And since the person's desire to get over the problem is very great to be-gin with, the type of counseling which includes strong urging on the counselor's part is .likewise of little use. Now this particular area is one that the so-called "client-centered" or "non-directive" or "self-directive" counseling is admirably suited to take care of. In practice such coun-seling has been found to help with many kinds of prob-lems, from normal everyday decision-making to the give-and- take of classroom discussion, from the troulSlesome minor f~irs we are discussing here to more serious per-sonality conflicts. Client-centered counseling is by no means a modern in-vention. In fact, some Catholic authorities claim that it is very similar to the approach'bf som~ traditional spir-itual directors. However, a new surge of interest has taken place in the field since the earlg. 1940's. Responsible for much of this new interest is Dr. Carl Rogers. His bobk, Client-Centered Therapy (New York: Houghton Mifflin, 1951), is probably the most important book in the field today. In 1952 Reverend Charles A. Curran of Loyola University, chicago, published his well known book Counseling in Catholic LiIe and Education (New York: Macmillan, 1952), in which he demonstrated the relation of such counseling to Thomisti~ psychology and ex-plained how these psychological counseling skills can be 4- Courage and Counseling VOLUME 20, 1961 ÷ ÷ ÷ w. H. Q=,iery, s.1. REVIEW FOR RELIGIOUS 286 applied to specifically Catholic problems. This book is still the standard Catholic~ treatment of the matter, and though directed primarily to psychologists, would be valuable reading for anyone interested in learning more about the subject. . In the past fifteen years the seeds sown by these write

Issue 1.4 of the Review for Religious, 1942. ; A. M. D. G. Review for Religious JULY 15o 1942 Direction by the Confess0r" ~ " " ¯ ¯ ¯ ¯ ¯ ¯ The Editors Self-Knowledge . Patrick Perfection and the Relicjious . Augustine Klaas Mqral Beauty in Our Duties to God "~" Gera~d Kelly The General Chapter of Affairs ~ Adam C. Ellis The Precious Blood . Malachl J. Donnelly The Rural Life Apostolate . John, L. Thomas St. Boniface and Giff-Excl~anges . ~., Gerald Ellard Book Reviews Questions Answered Decisions of the Holy See VOLUME I NUMBER 4 FOR RI:::LIGIOUS VOLUME I JULY -15, 1942 NUMBER 4 CONTENTS SPIRITUAL DIRECTION BY THE ORDINARY CONFESSOR The Editors . ,218 BOOKS RECEIVED . 222 SELF-KNOWLEDGE--Patrick M. Regan, S.J .:. . . 223' FRANCISCAN ,STUDIES . 232 PERFECTION AND THE REIAGIOUS--Augustine K]aas, S.J. 233 MORAL BEAUTY IN OUR DUTIES TOWARDS GOD Gerald Kelly, S.J . 244 PAMPHLET REVIEWS . '. . " . 252 THE GENERAL CHAPTER OF AFFAIRS IN A RELIGIOUS CON° GREGATION--Adam C. Ellis, S.J" . . 253 THE PLACE OF THE PRECIOUS BLOOD IN THE SPIRITUAL LIFE Malachi J. Donnelly, S.J . 259 THE CATHOLIC RURAL LIFE APOSTOLATE---John L. Thomas, S.J2.63 GIFT-EXCHANGES IN THE CORRESPONDENCE OF ST. BONIFACE Gerald Ellard, S.J . 271 BOOK REVIEWS : MARCH INTO TOMORROW. By the Reverend John J. Considine, M.M. 281 WATCI21 AND PRAY. By the Reverend J. E. Moffat, S.J .281 IN THE SHADOV~ OF OUR LADY OF THE CENACLE. By Helen M. Lynch, R.C . " 282 I PRAY THE MASS. By the Reverend HugoH. Hoever, S.O. Cist. 283 MODICUM. By the Reverend Athanasius Bierbaum, O.F.M. ". 284 HOMILETIC HINTS. By the Reverend Albert H. Dolan, O. Carm. '. 284 QUESTIONS AND ANSWERS: 24. Indulgence on Day of Investiture or Profession . 285 25. Obligation to Perform Penance for Violating Rule .285 26. Community. Prayers when Chaplain Opens Tabernacle . 286 27. Vows when in Danger of Death . 286 DECISIONS OF THE HOLY SEE OF INTEREST TO RELIGIOUS287 REVIEW FOR RELIGIOUS, July, 1942. Vol. I, No. 4. Published bi-monthly: January, March, May, July, September, and November, at The College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kausas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine Ellard, S.J., Gerald.Kelly, 8.3. Copyright, i942, by Adam C. Ellis. Permission is hereby granted for quotations of reasonable length, provided due credit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S. A. Spiri!:ual Direction by !:he Ordinary Con~:essor THE EDITORS 448 ' UR confessor never say, s a word to us. He just gives absolution, and lets us go. He seems to have no time for us." Thus goes a complaint which, though not exactly common,, is frequent enough to indi-cate a problem that calls for a solution. The problemm a very important one in the religious lifemmay be clearly stated in two brief questions: Does the Church wish ordi-nary ~onfessors to give spiritual guidance? If so, why is this office at times neglected? There seems to be no valid reason for. hesitancy con-cerning the answer to the first question. The Church does wish that, in general, the ordinary confessors should give spiritual direction. The law that these confessors be care-fully selected indicates that they should be able and willing to give direction; the law limiting their number indicates the desirability of uniformity of direction. This does not mean that the ordinary confessor must give spiritual direction to each of his penitents every week. But surely it means that at times during the course of a Yea'r all religious will have the opportunity of benefiting by his counsel. Otherwise large numbers of religious will find their opportunities for direction limited almost exclusively to the time of their annual retreat. Such once-a-year direc-tion was never the ideal; and in these days of large retreats it is even less desirable than formerly. The second question is not so readily answered. We know that some rellgi0us, disappointed over. the fact that the confessional has not proved to be the source of guidance 218 "DIRECTION BY THE CONFESSOR they had expected, are in~lined to. answer: "The confessor isn't able to give direction. He's not sufficiently interested in.us to give ~us his time~". Reasons such .as these may be valid for some cases--though certainly it is not for us to pass judgment on any individual case. It is possible for a priest to be incapable of fulfilling an office to which he has been ai0pointed, and it is possible that capable priests will neglect their duty. Such. failures will never be wholly elim-inated so long as God chooses to carry on His work by means of human instruments. If inability or negle.ct of duty were the only possible explanations for deficiency in regard to spiritual direction, there would be no good reason for the present editorial. But we. are convinced that in many cases there is an entirely different explanation. We think that a situation may fre-quently arise in which the confessor is both able and will-ing to give direction and the community is eager ~o receive it, yet no direction results. Consider, for instance, a case like the following: Father A is a zealous and capable priest. Any of his intimate friends would consider him well-equipped for the office of ordinary confessor of religious. He knows how to direct souls in the practice of virtue, how to encourage the downhearted, how to help those in occasions of sin, and so forth. He has a great esteem for .religious; he knows that the Church wishes them to receive direction and that of all people they are perhaps the most deserving and apprecia-, tire of any spiritual help a priest might give them. He has resolved that, if ever he is made an ordinary confessor, he will do all he can to live up to the Church's ideal. To this end, he has at times made a particular study of the prob-lems that might be peculiar to religious: for example, dif-ficulties with obedience and common life, temptations 219 THE EDITORS against vocation, discou.ragement over lack of'progress in general and over "failure in prayer" in particular. The time comes when Father A is appointed an ordi-nary confessor." Full of zeal, he takes his place in the con-fessional for the first time. One after another the penitents come, and, almost before he realizes it, .Father /~ hears a voice say, "I'm the last one, Father." As he leaves the con-fessional, he notes that he has heard about twenty confes-sions in twenty-five minutes. The speed of this first experience is not lost on Father A. He is chagrine.d at the thought that he seems to have fallen into the one fault that he was always Warned to avoid: he had given little more than absolution--scarcely a word. of counsel or encouragement. He consoles himself, however, with the reflection that this wasonly the first time and that in future .there will be more opportunity to help. Yet week follows week; and there never seems to be any "opportunity to help." Alarmed by his repeated failures to give direction, Father A pauses for self-examination. All his fine ideals seem to have been merd theory. No one asks for direction; no one seems to need encouragement or special :guidance. Perhaps he should take the initiative and give some hdvice, even though none is requested? He has read about this often, yet he finds that now When he faces a practical situ-ation h~ is puzzled. What should he say? In the average confession there are a fewsmall things that might be termed ordinary human failings, even of the saints. None of these things seems to be an apt starting point for any kind of per-sonal advice; yet Father A wishes his counsel to have some kind of personal bearing. He does not wish to impose his own ideals on other souls. He would feel very "artificial" in giving general advice that he feels sure the penitent knows already. 220 DIRECTION BY THE CONFESSOR The self-examination proves of no help. Father A de-cides to wait a little longer. But in the meantime the delay is having its effect on the community. Almost without their realizing it, the members begin to .think of their confessor as "an absolving machine.'~ Those Who have real problems take them to an occasionalconfessor or simply save them for the annual retreat. We have outlined one way in which it can happen that, though a community wants direction and the confessor wants to give it, nothing comes, of it. The community and the confessor are like two friends who have had a quarrel and then go for months without speaking, though each one would be delighted to renew the friendship. ¯ There may be many other ex~planati0ns for lack of direction by the ordinary confessor; yet we believe that cases like that of Father A are not uncommon. In other words, we think that often the only reason why direction is not given is that the community and the confessor fail to ';get together." The confessor does not know how to make the approach: the community does not make it for him. Such a situation is deplorable; there should be many ways of avoiding it. Surely this is a problem, a problem of sufficient importance for sincere and wholesome discus-sion. We think that our REVIEW offers an apt medium for such discussion; hence, now that we have at least par-tially outlined the problem, we turn to our readers and ask for suggestions. We are willing to allow some space in subsequent issues of the REVIEW for communications on this subject, and we hope that our readers are sufficien.tly interested in the matter to discuss it among themselves and to send us any suggestion they deem helpful. This is not a contest. It is a cooperative movement for progress in the use of an important means to peace of soul and self-sanctification. Concerning the communications THE EDITORS sent to us, we wish to make the folloWing observations: :1) Letters will be welcomed from anyone: priests, in-dividual religious, or religious communities. 2.) We seek positive suggestions, not mere negative criticism. By positive suggestions we mean anything that may throw light on the problem outlined and make for a better understanding between confessors and religious. 3) The subject of the confessional is always a delicate one; hence we wish it clearly understood that we are con-fining this discussion only to the gendra! point of spiritual direction, methods of giving it, of profiting by it, and so. forth. 4) Communications, will be printed without names and without reference to places. 5) The communications should be as brief as the sub-ject- ma~ter will permit. We may find it necessary to edit them a bit, even to digest them. But the substance will al-ways be given. 6) Address communications directly to The Editors of REVFEW FOR RELIGIOUS, St. Mary's College, St. Marys, Kansas. BOOKS RECEIVED (To be reviewed later.) OUR MODELS IN RELIGION. Marist Brothers. Poughkeepsie, N. Y. THE DIALOG MASS. By Gerald Ellard, S.J. Longmans, Green ~ Company. New York. THE SOLUTION IS EASY. By Mark Schm~d, O.S.B. Frederick Pustet. New York. 222 Selt:-Knowledge Patrick M. Regan, S.J. ALL Religious realize the importance of self-knowl-. edge in the spiritual life. Though one can make some progress toward perfection .without adeep fund of self-knowledge, still it is safe to say that a comprehensive knowledge of one's personal talents or lack of them can be a powerful foice for advancing the soul in sanctity. We are filled with admiration of Christ in all His words and works, but we must remember that one of the secrets of His influ-ence over the hearts of men is His absolute, unerring cer-tainty about Himself, His mission, the prophecies concern-ing Him. This looms large in the narrative of His life, help-ing to explain at every step the reason for His perfect man-ner of acting. A boy of twelve, His explanation of the tragic sorrow He had brought Mary and Joseph, the simple declaration that it was His Father's business, cannot but convey the strong impression that He was so infallibly sure of Himself that neither sorrow, tragedy, nor any calamity could be allowed to interfere. In His dying hour, "all is consummated" is the public avowal for all men of all time that He knew to perfection every step of the way, that nothing unforeseen had ever happen.ed in His life. But Christ is not only to be admired, He is also to be imitated as far as possible; hence with His grace our kn0wledge of self will contribute its share to our success in the work of life. ' On the other hand the .New Testament is careful to re-cord not a few of the tragedies that followed on the lack of self-knowledge. Even after all Christ's training, .Peker had so little Understanding of himself and his weakness that not even a divine revelation of his impending fall gave him 223 PATRICK M. REGAN pause. Had he just a glimmer of self-knowledge, the warn-ing ofChrist would have struck home. How well Judas might have profited in acquiring an insight of his own char-acter, had he but heeded the loving instructions and friend-ly warnings of the most perfect of all spiritual directors. Numerous other examples might be cited to show how our Divine Lord esteemed self-knowledge and the importance He attached to it. And justly so, since it is a fundamental necessity of the spiritual life, without which perfection be-comes so difficult as to be practically unattainable. It is se!f one must pilot alone to the shores of eternity, and to do it securely and with a degree of success, one must make cer-tain he knows that self quite thoroughly. Even from a purely natural sta.ndpoint and on its own merits, this science of our own personality is most desir-able. One can hardly pick up a modern magazine or book without finding references to its need and desirability; hence the numerous plans for developing personality, and charts for rating it. Again,.to cite but one example: in a large city a very capable psychologist of reputation and experi-ence has a large clientele of business men who seek her aid in getting an insight into their characters. One of them, echoing the opinions of the rest, declared: "I know my business, Father, she has the stuff; it is not a racket, for-tune- telling, or anything of the sort; the vision she gave me of myself was i~asily worth the twenty-five dollars she charged, for it was worth thousands to me in my business." Advantages t:or the Religious. It is a great advantage to know yourself,, even in a par-tial, elementary way. Though to a religious it may not be worth much money, still it can save, much valuable time, pre.vent tragic mistakes, relieve one of.much worry and anxiety. How many ~eligious pursue a will-o'-the-wisp 224 SELF- KNOWLEDGE for many a year, which they fancied a necessary virtue or accomplishment. How precious.little, after all, is needed' to sanctify yourself, provided you are certain of what tab ents you possess and make efficient use of them. In this connection the recollection of St. Joseph of Cupertino im-, mediately flashes to mind. His biographers tell us his utter lack of human,knowledge kept him out of one religious order and caused his dismissal from another; yet he built his sanctity on this very defect. One talent--he realized his .great deficiency; b.ut with that one talent he reached the heights. It is not how many talents one has received, but how skillfully and efficiently he uses them that sanctifies. Religious are always eager and zealous to acquire self-knbwledge, t14ough not always so eager and zealous for the work entailed. An instruction or exhortation on the sub-ject so deeply interests them that they will almost certainly seek a special conference with the director for further per-sonal instruction. Regtettably, however, far too man~ labor under the delusion that the director can furnish a perfect insight into self for the asking, that out of the abundance of his genius.and experience he will unfold their whole souls before them to impart comprehensive enlight~ enment on their own mysterious selves. Would the task were so easy! Such an attitude betrays a misunderstanding of spiritual direction, shows a leaning toward excessive passivity and lack of initiative in the spiritual life; every-one should expect to shoulder himself a good. portion of the burden of his own spiritual direction. Yet this very ¯ defect brings out another advantage of self-knowledge. One who has made progress along that line will be able to cooperate intelligently with helpful advice imparted, ia fact will be more capable of enlightened reception of direc-tion offered. Countless persons would quickly reach heights of perfection, if mere passive, receptivity of spiritual guid-. 225. PA'~VRICK M. REGAN ante were sufficient; they are expert at doing just what they are told, provided they do not have to think for themselves in the process or take the initiative. If Providence would furnish tl~em direction requiring nothing more than .that they follow it blindly, they would soon be perfect. But God ordinarily demands that we do some of the leading,, some of the guiding ourselves. The more perfectly one knows his soul, the more perfect will be his performance ~in guiding it and being guided on the. path of sanctity. How necess.ary is self-knowledge for a religious appears from another angle .to which atter~tion is called by Rev-erend Mother Stewart, R.S.C.~I.: "In general, books for spiritual training direct their treatment against strongly-marked and outspoken faults, and take for granted that severe treatment and explicit methods will deal with them. But a whole class of subtle faults that grow up in the shade are not taken into account. Now, in books for spiritual training, it is quite possible to break down a nature of less resistance, by guiding it along lines destined for one of stronger make, and leaving it without knowledge of prin-ciples for its own guidance. It may remain ignorant of its own faults and defects, because they have not come within the scheme that was drawn up for others." (Tbe.Societ~ of tt2e Sacred Heart, p. 82.) Since we cannot demand Pen-tecostal miracles from the Holy Spirit constantly, we must conform to the ordinary way of Divine Providence, and temper and adapt the general doctrine according to our own needs and 'capabilities. This requires a knowledge of our own individual selves. Still another advantage is that when one knows himself, not perfectly it may be: but sufficiently for forming a work-ing hypothesis at least, he will not dissipate his energies, pursuing what may be impossible for him, or quite un- 226 SELF-KNoWLEDGE necessary in his particular vocation. He will also have a strong in~entive to strive .hard to, advance, his goodquali-ties encouraging him tO make sacrifice, his defects urging him forward to strengthen the weakness of character. What is more, he will get at the root 6f the trouble, instead of spending much time and effort on surface symptoms only; it will be pride, envy, sloth, or some other fundamental tendency that he will effectually check, and with each con-quest many surface manifestations such as uncharitable-ness, impatience, intellectual dishonesty, and the like will vanish. Finally, this understanding of self will help very much to understand others, to grasp their problems, sympathize in their troubles, and thus promote the spirit of charity in the soul. One cannot understand the heart of another who does not first understand hisown. There are few religious who do not, at some time or other, have to make some con-tribution to. helping other souls by means of direction. The long, trying novitiate of learning to dirett ond's own soul is the very best preparation for aiding others to advance in God's service. It is the best antidote to a shallow, super.- ficial view of lif~ and of those who share life with us, since it widens and deepens our outlook on everyone and every-thing we meet along the way. Nature ot: SelF-Knowledge. Precisely what is this self-knowledge of which we hear so much? Fundamental as it is, a starting point in our spir-itual life, we should aim at clear ideas of what it is and wl~at it involves. It is the understanding of a particular person, my.self, whom I know through my virtues and defects, my natural and sup~rnatura! talents, my likes and dislikes, m~r own personal life history. We may expand these ideas further. It is' tl~e understanding 6f my own per- 227 PATRICK M. REG~q sonality, especially in the light of the fact that there is ab-so! utely no possibility of there ever being another person-ality exactly like mine anywhere in the whole of cidation. Since my personality is such a unique thing, so different from every other, so isolated from all others, I am the only one, except Almighty God, who can hope ever to acquire a very intimate knowledge of myself. From another point of view, self-knowledge may be said'to be an understand-ing of my life, but not just that; it is seeing my life with a particular pattern or design running through it, my own personality. Hence it is much more than knowing what is found {n spiritual books about the principles and practice .of. asceticism. These stop short at the threshold; I alone can enter in to apply the knowledge to self, observing the effect on all that lies hidden within. Moreover it is much more than knowing faults, defects, sins, virtues, successes; it is the understanding of the person who has these defects and achieves these successes, and the intimate personal explana-tion of them. Many are prejudiced against self-knowledge, even fear to undertake the task of acquiring it; they. misunderstand it. It is not to be confused with morbid introspection-- that avid, uncontrolled interest in self which excludes all else and can be so harmful. No; the. acquiring of self-knowl-edge postulates not only looking inward, but also consid-erable looking outward to God, to our neighbor, and to our models, the saints. Nor does ~he study of self neces-sarily mean constant, cold analysisof selfl for the Very reason that it can also be accomplished by noting the vir-tues of others that impress us and reveal how much we fall short of perfect design in our own lives. Self-analysi~ can be a considerable aid to self-knowledge but it does not lead to it infallibly. Some are expert at analyzing themselves, 228 SEL~-KNOWLEDGE but their self-knowledge is mediocre; while others have a deep knowledge of self, with very little power of self-analysis. Difficutt~/ Perhaps for the majority of people the greatest prejudice against self:knowledge is founded on the difficulty of ac-quiring it. Studying self is something like studying a great painting or other work of art: no matter how expert your. judgment, as long as you are dose to it, you see only the details, hence are incapable of appreciating the whole. His-. tory furnishes the same phenomenon: we are too close to present e~cents to fo~m a true estimate of them in their his-torical perspective. That is e~actly the problem in the pres-ent case: to get far enough way from self to admire the beauty or observe the blemishes in that work of art, A valuable suggestion comes from our Lord Himself in His admonition: "First cast out the beam from .thy own eye, and then thou wilt see clearly, to cast out the speck from thy brother's eye." It is also possible to withdrawfrom self.in several waysto observe self through the eyes of oth-ers; these we leave to a more specific treatmen~ of methods of learning self. Christ's admonition calls attention to a basic difficult~ in the labor of gaining knowledge of self: very likely for years we have been nourishing a flattering opinion of self without even suspecting how dark the picture.°is, so that it is far from easy to face the unpleasant reality. Self-love jealously guards its own achievements, by demanding repression of what is painful, and by enlisting self-deception to hide the reality from us. What chance, then; has self-kriowledge, the truth that disregards praise or blame, the essence of humility that unmasks self for what it really is? Finally, proficiency in this science requires such perse- 22'9 PATRICK M. REGAN vering effort that the tedious task is.ultimately either aban-doned altogether, or only half-heartedly performed. The effort is wearing, too, in that we must observe not only sins and defects which are mentioned in confession, but also other things--talents, likes, dislikes--which not only are not matter for confession but have been ignored so long that they have become part of us; perhaps even, we have never adverted to them. When we are on our guard, how well behaved we are, how humble, how meek, how retiring our evil tendencies, pride for instance, But when. the will is off guard, the mind not intent on self and motives (which is about ninety per cent of the time), how unconscious we are whether it is pride, sloth, or perhaps even a virtue pro-pelling the stream of our thoughts. In a word, it all seems so difficult and complicated, we want to .give up before we ever get started. Simplification. But the difficulty and complexity must not be overrated. After all, weknew eno.ugh of our own intellectual, moral, and physical endowments when we entered religion to make a decision without qualification or condition; affecting the whole of our natural life. Moreover, to acquire a knowl-edge of self sufficient for all practical purposes is far from an impossible assignment. We should expect that; surely God would make such a valuable asset in the spiritual life quite accessible to all.earnest seekers after perfection. As a matter of fact, the whole pro.cess can be considerably sim-plified. For instance there is a remarkable unity in the spiritual life, on which fact we may base our plan for sim-plification. Withthe virtues, for instance, the acquiring of one in its perfection will involve the acquisition of nu-merous others. Thus St. Paul, writing on charity (I Corin-thians 1.3 ), speaks of it as being patient, kind, not envious, 230 . SELF-KNOWLEDGE not .pretentious, humble, not ambitious, not .self-seeking, not provoked, thinking no evil, not rejoicing over wicked-ness, rejoicing with the truth, bearing with all things, be-lieving all things, hoping all things, enduring all thingi. Surely Paul must mean that genuine charity brings in its train all these other virtues. And anyone who has taken St. James to heart on the control of the tongue; will have more than a theoretical knowledge that "if anyone does not offend in word, he is a perfect man" (James 3:3). It is well also to keep in mind with regard to our faults that their number is not infinite, nor even legion; in fact, all are aware-that they can be reduced to the seven capital sins, as they are called. Some of us may be prejudiced or even frightened by such terms as "capital sin," or "ruling passion." In this case, let us dispense with such terms and choose something like "predominant tendency." Surely none will find it beyond him to admit that one result Of original sin has been that we have strong tendencies toward evil, no matter how far we have advanced in perfection. However, we are not so .badly off that all seven of these tendencies strive together and constantly, like an insuper-able force, to drag us to the lowest depths Of every sin and degradation. Many spiritual writers maintain thereis one evil ten-dency that predominates, .one at the root of most of our defects and imperfections; that, if we work diligently at controlling this one, we need scarcely expend any time or energy on the rest. Thus the:Directory of the .Spiritual Ex~rcises of.St.Ignatius (d -13). bid.~ ~he retreat-roadster: '-'. give l~im.[the retreatant] also the particular, ex-amination; explaining tb hima.t, the Same time that in every man there is Usu.a!iysome .one fault 0ilsin @hich is th~ chief one, and is the cause and root ofmany others. And although 231 PA'~RICK M. REGAN in some persons there may be several chief sins, yet it is best to choose some one, and bend all our efforts to rooting it out." Thus the task of planning our spiritual campaign is greatly simplified: it hinges on determining what ten-dency to. evil dominates us in the various-acts of daily life. This should not be too hard to determine. Surely it is at least the "beam th'at is in your own eye." Yet to some it may still appear too hard a task to be.described as simple. More specific methods of determining the predominant ten-dency would be a great help, and these will be furnished in a future article. Meanwhile, taking a.lead from St. Thomas, who traces a!1 seven capital sins back to pride, no one will be far wrong who decides that pride is his predominant ten-dency. Studying and observing .self with God's grace and 'understanding, wisdom and other gifts of the Holy Spirit, he is due for a revelation how much pride really does domi-nate his whole character. He will be astonished at the amount of self-deception that has crept into his life, moti-vating his actions. If he alternates this observation of the depths of pride in his makeup with several weeks of the practice of humility, he. will perceive himself actually mak-ing unexpected prggressi as he draws toward the goal of honesty with self. Once he is honest with himself, he is ready to undertake in earnest the acquirement of a deep knowledge of self. Franciscan Studies Franciscan Studies is a quarterly review of the sacred and secu-lar sciences that serves as the official organ of the Franciscan Educa-tional COnference. Publication of the Studies began in 1920, but it was only recently that they were converted into a quarterly review. The review, is characterized by thorough scholarship. The annual subscriptign price is 5 dollars. Further information may be obtained from The Secretary, Franciscan Studies, S~t. B0naventur¢ College, St. .Bonaventure P.O., N.Y. 232 Pert:ect:ion and !:he. Religious Augustine Klaas; S.3. THE ultimate goal of.life is our maximum union with / God in the Beatific Vision. Since sanctifying grace is the measure of this divine union in heaven, it must be our ceaseless endeavor on earth to augment it as much as possible in our souls, by the worthy, reception of the sacra-ments and by meritorious activity. Hence, our spiritual perfection may be said to consist in a firmly rooted disposi-tion t~o do the-maximum supernatural good of which we are capable, both the good that is of precept and, what is more difficult, the good that is of counsel.This maximum good, however, we are to accomplish, not in a wholly indi-vidualistic way, but normally as corporate members of Christ's Mystical Body, the Catholic Church. At first sight, the effort to do the maximum good would seem to be impracticable. A successful modern play exhibits the havoc wrought in one family by a teen-age youngster who sets to work with determination to do as ¯ much good as possible on every occasion. The results of this youthful resolve are indeed neive-wracking for the other members of the family and highly humorous for the audience, since teen-age youth is not noted particularly for prudence and good judgment. The effective performance of the. greatest possible good requireS the balanced exercise of the virtues, above all, the supernatural ones, both theo-logical and moral. The theological virtues--faith, hope and charity--and the moral virtues clustering about the 1This is the second of a series of three articles on Perfection. The firs~article, which dealt with Perfection in General, appeared' in the March issue. The present article treats of the Essence of Perfection. Though a part of a series, the article is complete in itself.--ED. 233 AUGUSTIN~ KLAAS cardinal ones of prudence, temperance, justice and forti-tude, all perfected and. directed by the gifts of the Holy Spirit,omake up our spiritual perfection. Do we not judge of a person's perfection mainly by his exercise of the vir.- tues? The Church estimates the heroic perfection of one she wishes to raise to the honors of the altar by thoroughly investigating his practice of the virtues, according to the procedure drawn up by Pope Benedict XIV. The saintly Contardo Ferrini, to mention only one example~ notes down with customary perspicacity his "continuous approximation to infinite perfection," by means of "growth in virtue: vigor of faith, joy of hope, fervor of charity, profound humility, angelic purity." Spiritual perfection and a permanent disposition to exercise the vir-tues to the utmost are one and the same thing, for it is by the strenuous practice ~of these varied virtues that we do all the good of which we are capable, and thus achieve the greatest possible increase of sanctifying grace, the measure of our eternal bliss in heaven. Among all the virtues that grace the soul, is there one more important than the rest, one that embodies the very marrow of perfection, one which, if practised faithfully. will bring in its train all the others? What virtue contains the essence of perfection? III. Ped, ection, Its EssencemFalse Notions Before we select the virtue containing the true essence of perfection, we must consider some errors. We shall not. dwell upon the opinions of those pseudo:scientists and philosophers who consider all virtue, but especially that found in the saints of the Catholic Church, as just so much hypocrisy, abnor.mality, or perversion. Their ignorance, prejudice, and lack of scientific method are appalling. Nor shall we delay to discuss the errors of those who contemn 234 PERFECTION AND "THE RELIGIOUS ~the characteristically. Christian virtues .because theii mis~ taken ideologies have led them .to place what they call perfection in the wrong virtues or .in pseudo-virtues. Such are, for example, in our own. day, the Communists and the Nazis. " The virtues lauded by these ideologists are those~of pagan materialism. Some err i.n overemphasizing the pas-sive virtues, and then we have Quietism; while others stress unduly the active ones, and ther; we have what. Leo XIII called Americanism. Both these extremes have. met with positive disapproval, by the Church, because fundamentally they disturb the delicate balance between divine grace and human nature. We shall not delay on these. " What we are chiefly interested in are the ordinary mis-taken notions of the essence of perfection found among Catholics and even sometimes among .religious, at least in practice: They. are generally a matter'of, misplaced empha-sis, In the case.of religious, these errors are occasionally the result of faulty information imparted, to them in their earlier years, or ~more often, I am inclined to believe, they are due to a wrong interpretation, of ideas and practices found in the biographies of the saints. Although there has been great improvement in recent years,~ still many of these lives of the saints leave much to be desired from the point of view of accuracy and perspecti.ve., To secure interest and dramatic effect, things wholly accidental are played up undu!y, to the obscuring of essentials; certain particular means, espe.cially of a heroic kind, are over-stressed to the minimizing and.~even obliterating of the saint's all-important purpose. Thus, the striking and extraordinary tend to throw the spiritual .life of the saint completely out of f0c_us and hence it is .no. wonder-that ~the essence of per-fection is often, misconstrued by the uncritical reader. ~ Wha~e~cer the cause may be, i.tis a fact that some think that perfec.tion consists in long pr.ayers, particularly, ificon- 235 AUGUSTINE KLAAS templation, with accompanying ecstasies, revelations, and other charismatic gifts. Or again, some consider perfection as essentially a matter of penances and mortifications, with emphasis on the heroic ones and still more emphasis on what they like to call "the folly of the cross." It is true that heroic penances and extraordinary gifts of contem-plation are intimately connected with spiritual perfection and that they abound in the lives of the saints, but they do not essentially constitute perfection. They~ are effective means to perfection, but, after all, only means. The stead-fast use of them may indicate a high degree of perfection already achieved, but definitely they are not the essence of perfection. Others are inclined to place the essence of perfection in spiritual or even sensible consolations and. consider the presence of these as indicative of spiritual perfection attained. The greater the consolation, the greater the per-fection, so they think, forgetting that one can be perfect without great consolation. At least, perfection is entirely independent of the fluctuations of spiritual and sensible consolation. Then, there are those who, like the Pharisees of old. place perfection in the meticulous outward observance of the letter of the law--a certain kind of extreme formalism. Our Lord has expressed in no uncertain terms His estimate .of this type of pseudo-perfection (Matthew 23:23-28). Neither is the observance of the three evangelical vows of poverty, chastity and obedience the essence of perfection. These vows are a most important means to perfection, and centuries of religious life bear witness to their efficacy; but they are not the only means, for there are numerous saints in heaven who never took these vows. And I dare'say that there are peopl~ in the world who, without the. vows, are living lives of greater perfection than many religious do 236 j~,. PERFECTION AND THE RELIGIOUS with them. Nor does. spiritual perfection consist in works of zeal, the intense exercise of the spiritual and corporal works of mercy, This restless apostolic activity may :be motivated by great interior perfection, but it does not con-stitute perfection essentially. Nor is perfection a kind of liturgical estheticism. These liturgical "thrills'.' are not necessary, though the right, intelligent use of the liturgy is a means to spiritual perfection sanctioned and often praised by the Church. Finally, we come to the good people who seem to equate perfection with the gaining of the maximum number of indulgences, or with the joining of as many religious societies and sodalities as POssible, or with making a record number of novenas, or with the greatest and most varied accumulation of medals, prayer-books, rosaries and holy¯ pictures. They forget ~hat there were thousands of saints in the Catholic Church before most of these things came intouse. St. Francis de Sales, in a famous passage often quoted, pillories the common inclination to judge of perfection according to one's own Pa[ticular character and tempera-. ment. He shows clearly that overstressing the wrong virtue as the essence of perfection frequently has Unfortunate reac-tions in the practice of the other virtues. The passage appears in the first chapter of his Introductior~ to the Devout Life. I cite it, asking thereader to remember that for St. Francis the words "devout" and "devotion" are the equivalent of "perfect" and "perfection." "Aurelius was wont to paint all the faces in his pic-tures to the air and resemblance of the women whom he loved, and so each one paints devotion according to his own passion and fancy. He that is given to fas.ting holds him-self for .very devout, if he do but fast, though his heart be full of rancour: and though he dare not moisten his tongue in wine or even in water for fear of transgressing s'obriety, AUGUSTI'NE KLAAS yet he scruples not to plunge it in the blood of his neighbor, by detraction and calumny. Another will account himself devout for reciting a great multitude of prayers every day, although afterwards he gives his tongue full liberty to utter peevish, arrogant, and injurious words among his famil-iars and neighbors. Another will readily draw an alms out of his purse to give it to the poor, but he cannot draw any gentleness out of his heart to forgive his enemies. Another will forgive his enemies, but will not make satisfaction to his ~reditors, unless forced by the law to do so. And yet all these persons are, in the common est.imation, held to be devout, though .they are by no means so. The servants of Saul sought for David in his house; but Michol having laid a statue in his bed, and having covered it with David's apparel, made them believe that it was David himself sick and sleeping (I Kings 19:11-16): even so do many per-sons cover themselves with certain external actions belong-ing to holy devotion, and the world believes them to be truly devout and spiritual; whereas in reality they are but statues and phantoms of devotion." The various opinions cited above err by overstressing things good in themselves and highly commendable when used prudently and wisely. These practices have their place in the quest for perfection, but their place is that of means to an end. True perfection consists essentially in none of them. IV. Perfection, Its True Essence The true essence of Christian perfection is charity-- the supernatural love of God for Himself and of all else for His sake. But this charity, containing the very marrow of perfectign, is not a low degree of charity, but maximum charity. A great sinner newly converted to a better life has the .charity that necessarily accompanies the state of sancti- 238 PERFECTION AND THE RELIGIOUS lying grace, but no one would say that he is very perfect. This minimum degree of charity is not sufficient, nor indeed is that charity enough which coexists with a habit of delib-erate venial sin and unmortified passions, it is maximum charity which constitutes the essence 0f.spiritual. perfection. St. Paul eloquently stresses the primacy of charity in the spiritual life. He calls it the. "bond of perfection" (Colossians 3:14) and the "fulfillment of the law" (Romans 13~10). Without it, he declares other virtues, even though heroic, to be as nought: "And I point out to ¯ you a yet more excellent~way~ If. I should speak with the tongues of men and of angel~, but do not have charity, I have become as sounding brass or a tinkling cymb~E And if I have prophecy and know all mysteries and "all knowledge; arid if I have all faith so as to move mountains, yet do not .have charity, I am nothing. And if I, distrilsute all my goods to f~ed the poor, and if I deliver~my body to be burlied, yet do not have charity, it profits me nothing . So there abide faith;hope and charity, .these three,; but the greatest of these is charity" (I Corinthians 13). St. ,lohn, too, sings a paean in praise of charity in his Epistles: "God is love, and he who abides inlove abides in God, and God in him" (I ,lohn 4:16). But it is from the lips of Our Lord Himself that we have in clear and unmistakeable language the doctrine of maximum charity as'the essence of perfection. I cite the text from the Gospel of St. Matthew (22:34-40) : "But the Pharisees,-hearing thfit he had silenced the Sadducees,' gathered together. And one of them,-a doctor of the Law, putting .him to the test,, asked him, 'Master, which is .the great commandment in the Law?; desus said to him: 239 AUGUSTINE KLAA$ "Thou shalt love the Lord thg God "with thg whole heart, and with thg whole soul, and with thg whole mind. This is the~greatest and the first commandment. And the second is like it, . Thou shalt love tl~g neighbor as tbg. self. On these two commandments depend the whole Law and the Prophets.' " The Fathers of the Church. have many passages con-firming and elucidating the same doctrine of charity. Let us hear St. Augustine, who says in his treatise On Nature and Grace: "Incipient charity is incipient justice; advanced charity is advanced justice; great charity is great justice; perfect charity is perfect justice.'" St. Thomas Aquinas in the Summa Theotogica (II-II, Q 184, Art 3) notes that "primarily and essentially the perfection of Christian life consists in charity, principally as to the love of God, secondarily as to the love of our neighbor." And in his treatise on the Perfection of Spir-itual Life (Chapter I) he states that "the spiritual life con-sists principally in charity . . . He is simply perfect in the spiritual life who is perfect in charity." Suarez likewise teaches this (The Religious State, Chapter I, Section 3) : "The perfection of a thing consists in its union with its last end. Our last end is God, Who is manifested to us by faith. Our perfection therefore consists in union with God: and it is charity which unites us with God. The essence of sanctity and perfection,, and the perfection of Christian life, consists therefore in .charity and the perfec-tion of charity." Of the more modern theologians we may cite Tanquery (The Spiritual Life, p. 158): "But what degree of charity is required for perfection? . Charity so 240 PERFECTION AND TIIE RELIGIOUS well established in the soul as to make us strive earnestly and constantly to avoid even the smallest sin and to do God's holy will in all things out of love for Him." ¯ - It is now clear that. the essence of spiritual perfection is charity, the maximum charity of which we are capable according to our particular capacities of n~iture and of grace. What does this maximum charity include? It includes, .of course, the infused virtue of charity, but this alone is not sufficient: A newly-baptized child has the. infused virtue of charity, but it cannot be said to have attained to the perfection we are considering. Neither does a.high degree of infused charity suffice. A religious, for example,: may l~ad a very fervent life for many years and then unfor-tunately fall .into a state of tepidity and laxity in which he may commit many imperfections and venial, sins. If he does ¯ .not sin mortally, he will be possessed :of a great amount of sanctifying .grace and concomitantly a high degree "of infused charity, but no one would say that such a religious is leading a life of.perfection. Charity as an infused virtue is required but is not sufficient to constitute the. essence, of perfection. ¯ In addition to the highest degree of infused charity of which we are capable, there .is required also the maximum activity/of charity. There must be in the s0ul a permanent disposition to perform as many acts of supernatural charity as we can and, in fact, do govern all our actions by the vir-tue of charity. Charity must rule our actions as intensively and as extensively as possible. Does this mean that acts of the other virtues, such as faith, hope, humility, penance and the rest, are to be excluded? By no means. A priest in a Certain widely-read modern novel is likely to convey a wrong impression when he says: "If we have the funda-mentals, love of God and love of our neighbor, ,surely we're 241 AUGUSTINE. KLA/t$ all right." As though the possession of the true faith, for .example, were of minor.importance! No--faith, hope and the other virtues cannot be left out; they must be prac-tised, but they should be practised as much as possible from the motive of charity. As Suarez so cogently remarks: "The perfection of Christian life includes not only the per-fection of charity, but the perfection of the other virtues; charity being their end and crown, .or complement of per-fection . Other virtues contribute towards perfection as they are the instruments of charity; and to charity, as it is essential perfection; they add an accidental perfection." That is why St. Paul says (I Corinthians. 13:4-7): "Charity is patient, is kind; charity does not envy, is not pretentious, is not puffed up, is not ambitious, is not self-seeking, is not provoked; thinks no evil, doesnot rejoice over wickedness, but rejoices ~vith the truth; bears with all things, believes all things, hopes all things, endures all things." In a word, the other virtues may be said to belong to the integrit~t of perfection. Charity at a maxi-mum is its essence and charity must rule all the other vir-tues like a queen. If charity abounds in our souls as an infused virtue, if charity .governs our actions as intensively'and as exten-sively as possible, then indeed we shall be perfect. Then we shall be doing the maximum good. Observe a child who. loves its mother with all its heart. Doesit not strive ear-nestly to avoid whatever will displease her, and does it not do positively all it can to please her, out of love for her? So shall we avoid the slightest sin and imperfection and do all the supernatural good we can, if we love God with our whole heart and soul and mind. Love is the keystone of perfection. He is perfect who isperfect in charity. St. Francis de Sales neatly sums UP our doctrine on the 242 PERFECTION AND THE RELIGIOUS relation of charity to perfection, which he .calls dev0.t!o.n; "True and living devotion presupposes the love. of God; nay rather it is no other" thing .than: a true love of God; yet not any kind of love; for, in so far as divine love beautifies our souls, and makes us pleasing to his divine ¯ Majesty, it is called grace; in so far. as it gi~ces us strength to do good it is'called charity; but when it.reaches such a degree of perfection that it makes us not only do good, but do so carefully, frequently, and readily, then it is called devotion . And since devotion consists in a certain excelling degree of charity, .it not only. makes us ready, active and diligent in ~observing the commandments of God; but it also prompts us .to do readily and heartily as many good works as we can, even though they be not in any sort commanded, but only counseled or inspired .,. In fine, charity and devotion differ no more, the one from the other, than the flame from the fire;, inasmuch as charity, being a spiritual fire, when it breaks out into flame, is called devotion: so that devotion adds-nothing to the fire of charity, sav~ the flame which makes charity ready, active, and diligent, not only in observing the commandments of God, but in practising the heavenly counsels and inspira-tions" (It~troductior~ to the Deoout Life, .Chapter I). So far we have considered perfection in general and in its all important essential element, charity: In a con-cluding article we shall apply these thoughts to the reli-gious state. How is the religious to do the maximum good and practise the maximum charity? 243 Moral Beaub/ in our Duties toward God Gerald Kelly, S.3. IN HIS TREATISE on the Blessed Eucharist, St. Albertus Magnus offers this humble apology for the limitations of his work: "Even though we do the best we can, yet in treating of God and the mysteries of God we but babble like babes." In this respect, anyone who tries to work out a scheme for the positive and insp.irational treatment of the Commandments that enunciate our duties toward G0dwill very likely feel a certain kinship to the great Dominican scholar. These Commandments touch on sublime truths, "on-God and the mysteries of God," and it is difficult to speak or write of these truths in words that offer more than a glimmer ofsatisfaction. Because of the difficulty of treating the, subject ade-quately, I prefer to consider the present article merely a series of "notes" on our duties to God. The ideas are not fully developed; but they do, I hope, offer some material for that prayerful study of the Decalogue which, according to The Roman Catechism, is so desirable. Perhaps too, the general plan given here will be of service to teachers who desire material for presenting the positive background of .the various Commandments before explaining the prec.epts. and prohibitions contained therein. Reason and Faith Our duties toward God are epitomized in the first three . Commandments of the Decalogue. These Command-ments, in turn, are summed up and perfected in the first of the two Great Commandments. In terms of the virtues, these Commandments refer principally to acts of Faith, 244 MORAL BEAUTY IN DUTIES TO GOD Hope, Charity, and Religion. The following notes will show, in a somewhat sketchy fashibn, how the practice of thes~ virtues.is associated with the Commandments, .and will indicate, at least imperfectly, their power for contrib-utifig to the moral beauty of the universe. Our duties toward God flow from definite relation-ships that exist between.ourselves and God. The first step in the appreciation and observance of such duties must be a knowledge of these relationships. This knowledge is obtained through reason, and especially through Faith. Even .reason alone can tell us much about God and our-selves; from the visible things of this world, as St. Paul declared, it can penetrate to the invisible things of God. Reason can discover the existence of God and can paint a very sublime portrait of His perfections. Nevertheless, much more important than mere reason, is the knowledge that is ours through F~aith, In the first place, though reason can (perhaps I should say could). attain to a vast fund of knowledge about God, yet it is a simple matter of fact that the difficulties are so great that unaided reason falls into many and grievous errors in its search for God. The knowledge of Faith is free from these errors. Furthermore, even the most highly developed human reason, working under the most favorable natural circumstances, is held within decided limits in its quest for the truths about God. It cannot penetrate the veil of mystery; it cannot even suspect the reality of the inner life of God or know of the divine scheme which actually pre-vails in the universe and which is expressed in the mysteries of the Supernatural Life, of the 'Incarnation, and of the -Redemption. These truths are known only through revelation, and they become our own personal knowledge only when we accept God's revelation by making an ac't of Faith. 245 GERALD KELLY 'Faith, then, is the first step in the appreciation and .intelligent observance of our duties toward God. By Faith we know what God really is and what we are. It is scarcely necessary to enumerate here the sublime truths of Faith. They are contained substantially in the Apostles' Creed; they are unfolded in word and gesture and song in the liturgical ceremonies by which the Church teaches her chil-dren. But it should be mentioned here that any growth in Faith, any progress in the knowledge of God and' His perfections which comes through reading or study or prayer is not only a fine practice of the Commandments but isalso a most excellent preparation, for .living in the spirit of the Commandments. And as for .teaching, we teach the Commandments best when we ourselves know God inti-mately and when we impart this knowledge to our pupils before telling them that they must do this, they must not do that, and so forth. Through Faith we are made aware of a vast number of relationships that exist between ourselves and God. He is our Creator, our Helper, our sovereign Lord, our Redeemer, our Best Friend, our Father, our Goal; and so on. Yet, if we carefully examine these relationships, we shall find that, roughly speaking, they can be grouped under two heads: some emphasize our union with and similaritg to :'God, others emphasize the distinction and distance between ourselves and God. Suppose we consider first the relationships of distance~ and distinction. These present a grand picture of God as the Being of supreme excellence and absolute dominion and ourselves as creatures who d.epend utterly upon Him. This is a true picture; it is decidedly appropriate that we ~recognize it and lead our lives according to it. Down to the very core of our being we are creatures; and any act of 246 MORAL BEAUTY IN DUTIES TO GOD Ours which expresses this relationship to God is in perfect harmony With our natures.¯ : ¯ ¯ .Creqturely .Acts Among these creat.urehj acts, the simplest and most ¯ fundamental is that of adoration. The essential charac-teristic of adoration is perfect homage, the homage due to God alone. It is the acknowledgement of God's supreme excellence and-our absolute dependence on Him. It may be expressed internally by a simple act of the will, or it may be externalized by various gestures, such as the genuflec: tion; or it may seek outlet in the other forms of worship known as the prayer of praise, the prayer of petition, the taking of vows and oaths. Basically, these various acts are but modifications of the one fundamental act of worship. The prayer Of praise is adoration with emphasis on the acknoxvledgement of God's excellence; the prayer of peti-tion is adoration with insistence on our dependence. A vow ~is adoration expressed by partial or total consecration of oneself to God;an oath is adoration in that it pays tribute to one aspect of divine excellence, God's infinite truthful-ness. The worship of God must be not only personal and individual, but social as well, for we depend on God not merely as individuals but also as a community. And social worship demands a fixed time for its exercise and. definite forms for its manifestation. Hence the propriety of days set aside as God's days, days on which acts of reli-gion and rest from 'merely. secular occupations play the principal part. Hence too the need of that chief of all social actsof worship, sacrifice, a commonact of adoration by.which the.whole community, through its legitimate .ministers, makes an offering to God as an agknowledgement ¯ of His :supreme,dominion over the community"and of 247 GERALD KELLY the complete dependence, of the community .on, God. Social worship, from the very fact that it is external and common, must be regulated; and what norm is more appropriate than that which Almighty God Himself has established in giving us the Holy Sacrifice of the Mass and in founding the Church with power to regulate this act of worship and to establish minor forms? Adoration in all its forms is reserved to God alone. But it is natural enough that in the sphere of religion we should find a condition similar to that which exists in practically all secular governments and which, if history, tells us rightly, is well-nigh as old as government itself. Earthly rulers have their ministers, and it is an accepted custom among men to pay honor to these ministers according to their dignity. In much the same way, God has communi-cated His excellence to creatures in varying degrees-~-a fact Which forms the basis for the special acts of veneration that we pay to Mary and the saints. This seems so reasonably in accord with human practice in other matters that one is apt to wonder why people at times strongly object to it. We honor Mary and the .saints because they reflect the divine excellence in a special way; we direct petitions to them because we know that God, Whose special friends they are, wishes to honor them by granting His favors through their intercession. God, the saints of God--and now a brief word about reverence for the things of God. As we pay Him supreme worship, it is surely the appropriate thing to show a special reverence to all the things connected with that worship: for the house of God,~. for the Sacred vessels, for the persons consecrated to Him, for the Word of God, and of course for the~Holy Name of God. All these things represent God, and in honoring them we honor Him. :The acts of virtue thus far enumerated are more fully 248 MORAL BEAUTY IN DUTIES TO! GOD explained in any theological treatise on thevirtue of reli-gionI. These acts, like the virtue of justiceamong human b~ings, all emphasize the distinction between ourselves and God. As such, they are distinctively creatttrety acts. Love and Hope Yet, though we are distinct from God, we are not wholly different from Him; though an infinite distance separates us from Him, yet in a true sense we are one with Him. Even reason tells us of ~ similarity to God that is ours in the possession of intellect and free will, and of a special yearning for God which is a property of our Spiritual and immortal souls. But Faith, in giving us.a knowledge of the supernatural order, tells us of a similarity to God and of an ultimate assimilation to God which reason could not so much as suspect. We are children of God, share~s in His own Divine nature, members of the Divine Family, with the destiny of sharing His own happiness in the Vision Beatific. The distance of creatureship is bridged by the inti.m.acy of friendship; and, though submissive worship is never to be neglected, yet in the present order it yields the primacy to filial love in our dealings with God. Since God has chosen to deal with us on' terms of loving friendship, it is most appropriate that we live according to this relationship. To do so is to live a life of Charity. This expresses itself in various ways: it rejoices in the perfections of God; it labors for the fulfillment of God's designs; it accepts God's gift of Himself and gives self in return to God. It flees from sin, strives for closer union with God and for perfect conformity to the will of God. Especially does it contemplate God-made-man and strive, as all true love 1For a splendid treatment of the virtues, confer The Fullness of Life by Walter Far-rell, O.P. Confer also The Catechism of the Council of Trent (The Roman Cate-chism). 249 GERALD KELLY does, for perfect imitation of Him and for~,the growth of His kingdom in the hearts of men . : Though our union with God has already begun, it is still imperfect and breakable. ~ To preserve it and increase it unto the perfection of heaven is difficult; without the help of God, it is impossible. But God in His fatherly goodness has promised not only this help but a reward as well for our cooperation. Since we know His goodness and His power and His unwavering fidelity to His promises, it is fitting that we trust Him, that always in perfect confidence we stretch out our hands to Him as a child reaches but for ¯ his parents. Such is the worship of Hope. Devotioia All the acts thus far enumerated are in perfect accord with the Commandments that contain our duties to God. To perform such acts, to cultivate such virtues, is to live in the spirit of these Commandments. This is not a dry, mechanical process; these acts do not issue from a sterile soul. They presuppose inthe soul a certain disposition that theologians call deootion. Perhaps it is well for us, particularly if we be educators, to realize that many people have.a false idea of religious devotion. They look upon it as something sentimental, something highly emotional, something they might want to experience only when their friends-are not present. That is a silly notion. In all Other affairs deootiorl has a lofty signification. Men speak with respect and awe of the soldier who is deooted to his country, of a husband devoted to his wife, of parents devoted to their children, of a doctor devoted to his duty, and so forth. In all these uses, devotiorl means something solid---a spirit of self-sacrifice and of true heroism. Yet, in the religious sphere the word has a "fluffy" 250 MOR~L BEAUTY IN DUflES TO GOD ~onn0tati0n;the mere accidentals are ffequently mist'aken for. the isubstance. ~ )kS a matter of~ plain .fact, religious ~devotioriis ~he highest of all forms Of :devoti0n. It is a. ready will to wor-ship God, toserve and love Him as. He deseives. It is the most appropriate and the h0blest form of hero-worship. Itis God-worshipmthe perfect willingnes~ to acknowledge God for what He is and ourselves for what we are. It is the first fruit of a lively Faith; and the very Soul of all the other acts of virtue, enumerated here. A life lived, according to the pattern sketched in this article is a beautiful life. The .greater the number of men who lead such lives, the more does moral beauty shine resplendent in the universe. To labor for this in ourselves. a.nd others is our apostolate. The Church and Moral Beauty 0n¢ concluding word: Nothing so strikingly illustrates the true beauty of worship as the living Church herself. It sometimes impresses and consoles our people when we show them that through membership in the Church they help to conserve this beauty in the world and are thus contributors to a spiritual achievement of almost unbelievable gran-deur. Thoughout the world they have built magnificent churches where the one true Sacrifice, as well as other forms :of worship, is offered. This worship is onduct~ed wi.th exquisite pageantry and with the finest of this world's goods. Daily and hourly in the. name of the Church, there ascends to God the most reverent of all prayers, the Divine Office. Our Catholic people have a wealth of reli-gious festivals in honor of God and His Mysteries; they venerate Mary, the Mother of God, and the angels and saints, His special friends; they cherish the written word of .God and reverence the living teaching authority that He 251 GERALD KELLY established. They have doctrines and a Moral Code of -tranScendent b~auty. They have a priesthood dedicated 'wholly to ,priestly work. Thousands of their men and women are consecrated to Goal by vow. In toil and sacri-rice, they have built countless schools to safeguard the reli-gious education of youth; and there is no work of mercy e~cluded from the~stupendous program of ~harity that~the Church is ever conducting. All those things blend together to form the sweet incense of worship that is constantly being offered to God through the Holy. Catholic Church. It is a living, expres-sion of the first table of the Decalogue and of the Great Commandment of Love. PAMPHLET REVIEWS Martyrdom of Slovenia, by dohn LaFarge, S.d., is a p.amphlet .re-print of three articles from America. It gives a graphic picture of Catholic Slovenia, peaceful and progressive before the German inva-sion but now subjected to terrorizing persecution. Proceeds go to the general relief of Slovenia. The pamphlet may be ordered from American '.Slovene Parish Relief, 62 St. Mark's Place, New York City, N. Y. Price: 5 cents each. Meditorials, by Paschal Boland, O.S.B., is a small booklet of brief, well,expressed thoughts for 'prayerful .reflection. It may be obtained from The Grail, St. Meinrad, Indiana, 10 cents a copy. ,252 The h,p!:er o[ At:t: irs in a Religious Congregation Adam C. Ellis, S.3. ~i A_ FTER kh~ cl~apter of elections, is finished, it is c~s. ]-~ tomary to hold a chapter of affairs (business l~apte.r) under the presidency of the newly .elected superior general. In this chapter the more important matters con-cerning the welfare of the institute as a whole are consid-ered. Agenda ~t: the Chapter.of Affairs ~ We may conveniently divide the subject-matter of this, business chapter into three classes:. 1 ) affairs which require the permission or approval of the Holy-See; 2) other important matters pertaining to the general welfare of the institute as a whole; 3) propositions ,~ubmitted to the general chapter by individual houses and subjects. I. Affairs which require, the permission of the Holy See: Such are, for example: the division of a congregation into provinces; the revision of the boundaries of provinces already established, as well as the establishment of new provinces (canon 494) ; the establishment of houses in mis-sion territories subject to the Sacred Congregation of the Propagation of the Faith (canon 497, § 1) ; the erectibn of new novitiates, or the transfe~ of .an existing novitiate to another house (canon 544); the assumption of a debt, or the sale or mortgage or property, when the amount exceeds 6,000 gold dollars (canon 534). 2.-Other important affairs: Under this head would come. questions of finance, of discipline, and of good works. A word about each. Questions of Enance. Under the old law the Holy See ~253 ADAM C. ELLIS 0r,.the ~Bishop determined the amount of the dowry, the amg.unt:eadh :houie was to.contribute to the support of the general curia an~d of lnembers'in trai.riing, and so forth. The present policy of the Sacred Congregation of Religious is to allow~the general chapter of a congregation approved by the Holy See tO determine these amounts, thus avoiding the n~cessity, ofrecuiring to. the HolySee for dislSenshtions required b~r .the changing financial status of an~ institute. He'nce the gener.al chapter will determine the following points: the amount of the dowry to be required of postu-lants; the amount of money each house is to contribute to the motherhouse for the support of the superior general and his officials, and for the support of novices, religious who ~ire studying, and so forth; the amount of money the supe-rior general may spend with the consent of his council, as well as the amount he may sper~d without such consent: similarly the amount which provincial superiors may spend with and without the consent of their respective councils: the amount for which local superiors must obtain permis-sion of the superior general for extraordinary expenses as ¯ well as to contract a debt. Matters of discipline will deal with the observance of the constitutions and customs, the development of the ¯ spirit of poverty, obedience, and the like, as well as the suppression of abuses which may ~have crept in. ~ ¯ Good works embrace the particular end for which the congregation was established: teaching, the care .of the sick, and the like. Hence the general chapter may discuss the work-that is being done, new works to be undertaken within the limits of the purpose of the institute, changes, which may be~desirable,~new methods to be adopted. 3. Propositions of individuals: Every ,member of the institute, as well as the individual houses~with their mem-bers, has a right to, submit propdsitions for the" considera- 254 CHAPTER OF AFFAIR8 tion of the general chapter. Individual communities and their members will submit their propositions through the delegates who represent them. These propositions should contain suggestions for the betterment of the congregation as a whole, and should not be devoted to the private affairs of. individuals. All propositions submitted should be caref~ly collated, and submitted to the general chapter in the manner described below. Pretiminarg Work o~: Committees ~ In order to save time and to dispatchthe business of the chapter of affairs in a competent manner, it is desirable that one or more committees be appointed either by th~ chapter itself or by the superior general and his council. In a small congregation one committee will suffice; a larger ~ongrega-tion, especially one divided into provinces, will find it helpful to appoint several committees: for- instance, one .for finance, a second for discipline, a third for propositions, another for good works. These committees will hold pre-liminary meetings in which they will discuss the matters submitl~ed to them, word them in a brief but clear state-ment, giving reasons for and against their acceptance. The committee on.propositions will consider all the propositions sent in and collate them, p.utting a~ide for the time being. those of minor, importance or of a personal nature. A list of even these latter propositions should be read to the chal~- ter at some time or another before its close. The chapter will then decide whether or not it wishes to consider any of them. Some of the propositions will have been included in the matter of other committees and may be omitted. Discussion ot: Proposals The superior general will read aloud the proposals formulated by the committees, together with the reasons 255 ADAM C. ELLIS - ¯ for andagainst them, one question, at a time. Discussion is now in order. Every meinber of the chapter has the right to speak on the proposition if he wishes to do so. Usually the capitulars are asked in order of seniority to express their opinion: They should address their remarks to the president of the chapter. After all who so desire have expressed their minds in turn, the president may call for final remarks before the proposition is put to a vote. Each speaker should first obtain permission from the pre-siding officerl then state his opinion calmly, objectively, and briefly. The president will then sum up the arguments, pro and con, arid put the proposition to the chapter. Manner of Voting in Chapter of Affairs All ques.tions are decided bya majority vote, that is, by one more than half the number of capitulars present. AI.1 matters of greater importance should be decided by secret ballot. Though any individual capitular is not obliged to vote, he should at least turn in a blank ballot. In minor matters, or when it is evident from the dis-cussion that there is little or no opposition to a proposal, the vote may be taken by holding up hands or rising to express an affirmative vote. Any member of the chapter, however, may demand a secret ballot on any proposition. When this occurs, the president will put the matter to a vote, and if the majority of the chapter vote for a secret ballot, it must be taken, otherwise a standing vote will be sufficient. I~ case of a tie vote on any proposition, the president of the chapter may decide the matter if he wishes to do so: It may be well to remark here that it is not necessary for the general chapter .to pass on all the proposition.s sub-" mitted to it. Instead, it may vote to allow the superior general and his council to decide the matter ,in question. 256 CHA~TER OF AFFAIRS This will be the case especially when~ further information.,is:. needed upon a certain subject, or when future: circhmstances may alter the state of the question proposed. :. Changes in the. Constitutions The general chapter has no power to change the con- ", stitutions or to inteFpret them.~ Hence, if it seems desirable. for the general welfare of the institute that such a change should be made, or if some point in the constitutions is not clear, the chapter'of a pontifical institute may vote to ask the Holy See to change the constitutions which it has .approved, or to interpret such constitutions. In the case of a diocesan congregation, such a pet)ition should be addressed to the Bishop of the diocese. But if the congregation has houses in more than one diocese, the Bishop of the diocese in which the motherhouse is situated will have to obtain the consent of all the other ,Bishops in whose territory the con-gregation has houses before he can make any change in the constitutions (canon 495, § 2). Ordinances oF the General Chapter While thi~ general chapter of a religious congregation has no Idgislative power, and cannot, therefore, make laws in the strict sense of the term, it has dominative power over all the members of the institute (canon 501, § 1), and may issue ordinances which are binding upon all, provided such ordinances are not contrary to any laws of the Church or fo the constitutions. Such ordinances should be few in num-ber and really necessary for the spiritual well-being of the institute. They. remain in force until the following general chapter, and are binding upon all the members of the insti-tute as soon as they are promulgated by the superior gen-eral. No legislation imposes a time limit .upon the general 257 ADAM C. ELLIS : dhapter of, affairs., But underI normal, conditions, ,especially ¯ for.a congregation whose constitutions have been approved by the Ho. ly See, this chapter should be completed in.three or four days. Rarely would all the subjects mentioned in this article be discussed in the same chapter: in fact, it may even h'appen that theosubjects proposed for discussion are so few that the chapter can finish its business in one or two .sessions, A majority vote of the chapter members is suf-ficient for adjournment. When the chapter of affairs has concluded its business, a short special session should be held for the signing of the minutes. Every member of the chapter should be present in order to ~ffixehis signature thereto, and these minutes should be carefully preserved in the general archives. The members of the chapter should remember that they are bound by secrecy regarding the matters discussed in.chapter until the promulgatibn of the results of the chapter are made by the superior general. Even after such promulga-tion they should observe secrecy as to details regarding names and matters discussed or voted upon in chapter. Confirmation of Acts of Chapter of Affairs In the case of a pontifical congregation, the acts of the chapter of affairs need not be submitted to the Holy See unless the constitutions require suclq confirmation. In the case of a diocesan congregation, the local Ordinary may reserve to himself the right to confirm tl~e acts of the chap-ter of affairs. If he has not done so, there is no obligation .to submit the acts of the chapter to him for approval. In .both cases, however, as was stated above, individual propo-sitions implying a change in the constitutions or an inter-pretation of them must be submitted to the Holy See or to the Bishop, as the case may be. 258 The Place ot: :he Precious Blood in I:he Spiritual Lit:e Malachi J. Donnelly, S.J. IT IS A COMMONPLACE that the frequently occurring cloys the~ inquiring mind. The infrequent rainbow will stir the s6ul to its depths, the ever-recurring sunrise leave it cold and unaroused. But, who will say that the bow in the skies outshines the brilliance of the early dawn! Even so in the spiritual life, it is often enough the unusual rather than the solid doctrine that attracts our moth-like, unstable souls. The sure cure for this human weakness is frequent meditation on the fundamentals of our Faith. The many facets of the Catholic jewel must be examined up-close. Our goal must be not knowledge, but realization. As the author of the Spiritual Exercises puts it: "it is not an abun-dance of knowledge that fill~ and satisfies the soul, but to feel and taste things internally." The purpose of this essay is to set forth a few doctrinal observations concerning the Precious Blood, in the hope that frequent meditation on them may enkindle within our hearts a great devotion tb that red stream of divine love which wrought our salvation. It is a dogma of our Faith (hat the Son of God assumed as His very own a complete human nature. This is a fun-damental principle in considering the Precious Blood. Scientists tell us that the blood-stream is devoid of life. Hence, did we not have the defined truth that the Word possessed a complete and integral human body, we might wonder concerning the union that exists between the Pre-cious Blood and the Son of God become Man. But our 25.9~ ~ALACHI J. DONNELLY Faith teaches that the Word assumed not only flesh and soul, but also the human blood-~treaml ~' Scripture speaks of the flesh and blood of our Lord in the same terms: "Therefore because children have blood and flesh in common, so he .in like manner has shared in these; that through death he might destroy him who had the empire of death, that is, the devil; and might deliver them, who throughout their life were kept in servitude by the fear of death" (Hebrews 2: 14-15). Again we read: " . . . . the Church of God, which he has purchased with his own blood" (Acts 20:28). St. Peter writes: "You know that you were redeemed from the vain manner of life handed down from your fathers, not with perishable things, with silver or gold, but with the precious blood of Christ as of a lamb without blemish and without spot" .(I Peter 1:18-19). Scripture, then, is too explicit to allow any doubt about the intimate union between the Precious Blood and the Person of the Word. Wk have it,therefore, on the word of God that our sal, vation was accomplished by the Blood of the Lamb. To this Blood is ascribed an infinite value, for the notion of redemption and satisfaction as effec~ed by 3esus Christ is inseparably linked with infinite value. Now, if to the Blood in itseff is attributed the infinite price of our redemp-tion, this is possible only if the Blood is hypostatically, or .personally, united to the Person of the Son of God. From the words of several General Councils defining that our Lord had a corriplete and integral human body, from the testimony of Scripture which attributes our kal-vation to the Precious Blood (the Scriptural testimony was repeated by Clement VI in his Jubilee Bull of 1349), we may conclude that to the Precious Blood may be accorded the same worship that is Offered to the Sacred Heart of Jesus. For both were personally united to the Son of God. 260 THE PRECIOUS BLOOD IN THE~ SPIRITUAL LIFE Let us turn to the Mass. When the priest at the altar says those memorable words, "for this is the chalice of my blood" and so forth, what ieally happens? To answei this we must go back to the. Last Supper, for what ,Jesus did at the Supper the.priest does at the Mass. When, on that most solemn evening, 'jesus took the ctip of wine into His holy and venerable hands and said: "All of you drink of this: for this is mybloodof the new covenant, which is being shed for many unto, the forgiveness.of sins" (Luke 26:2), what really.took place? Now, 'jesus, as the Son of God, can tell naught but the truth. When, itherefore,. He said, "this is-my. blood," a gieat and Wonderful change took place, th~ one and only event of its kind in the history of the world up to that time. What He held in His hands; after these words, was no longer: wine. No, it was a cup that con-tainedHis, most Precious Blood. Beneath the'appearances of wine was contained, as the Council of Trent teaches,~ Christ's own.Blood--and with the Blood, His Body,. Soul, and Divinity. At the Supper the Blood was shed mystically or sym-bolically by the separate consecration of the wine and biead. By this the bloody death of the morrow was symbolized. At the Mass the same holds true, for the Mass reenacts what Christ did at the Supper. The Mass and the Supper are, after the rite of Melchisedech, an unbloody sacrifice: the-sacrifice of the Cross is according to the rite of Aaron, a bloody sacrifice. After the Supper, 'jesus continued to offer Himself to His eternal Father. The bloody sweat in the Garden, the scourging, the crowning with thorns--all were outlets for that great sacrificial .stream of love in the red current ~of which the sins of the world were swept away" as driftwood in a swollen river.' 7Fhen on Calvary, in asublime finale of divine love, the Sacred Heart was emptied~of that most 261~ MAI~ACHI! 3. DONNELLY precious burden, the cleansing Blood of the immaculate ¯ Lamb of God.In this bloody consummation: of the Savior's .sacrifice our.redemption was achieved. It but required the extrinsic a~ceptance on the part of God, that the sacrifice be fordver complete . By the Resurrection the Precious Blood was again united to the Sacred Body and in the Ascension ,lesus was taken-into Heaven, where, as '.'the ¯ Lamb that was slain," He forever pleads our cause. In the Mass, as the Council of Trent teaches, we have the same sacrificial Victim as was immolated on Golgotha: and the same One now offers by the ministry of priests, Who then offered Himself on the Cross, the sole difference being in the. manner of offering. No longer is the Precious Blood drained from the Sacred Heart, but forever will that red current flow through the living Body of 3esus. In the Mass, as at theSupper, there is the mystical, or symbolical, shedding of the Blood in the separate consecration of wine. The species of wine, in its sacramental signification, more directly signifies the Precious Blood; although, of course, we must ho!d that the whole Christ is (equally) present under the sacramental veil of either species. In our spiritual life, then, it is dear what an important role devotion to the Precious Blood should play. The spir-itual life is possible only through Grace. Grace, however, is had only through tapping tl~e great reservoir of the merits of Christ. And the merits of Christ have been won by the ¯ shedding of His Precious Blood on the altar of the Cross. ¯ From His pierced Sacred Heart poured forth the scarlet laver that satisfied for our sins, reddemed all men, merited grace by which we are justified. Indeed, we have been redeemed at a great price. Would. that we could all "feel and taste internally" those words of St. Peter: "You know that you Were redeemed . notwith perishable things, with silver or gold, but with the precious blood of Christ." 262 The Catholic Rural Life Apostolate John L., Thomas, S.J. THERE are at least two reasons why religiousshouldbe ¯ well-informed regarding the Catholic Rural Life Apos-tolate. First, it is an apostolate, one of the very impor-tant forms of Catholic Action being conducted in this country today. Secondly, many religious, particularly those teaching in the rural schools, are actually engaged in the work of the apostolate and are in a position to accomplish great good in its behalf. For these reasons, a brief exposition of the Rural Life Apostolate seems appropriate here. Since the best expres-sion of the apostolate in our country is found in the work of the Catholic Rural Life Conference, I feel there is no better way to present the position of the Church in the rural crisis than by explaining the organization and aims of the Conference. The Catholic Rural Life Conference Tile Conference started in 1923 as a voluntary asso- Ciation to cooperate with the Rural Life Bureau of~the National Catholic Welfare Council. Six Bishops and sixty delegates, from eighteen dioceses met at St. Louis to discuss plans for the future. Since then thi~ conference has ignr othwen" ctoou bnetr yo.ne of the outstanding Catholic organizations What are the problems it attempts to solve? They can be put under three heads. First--pastoral and missionary. Eighty per,cent of our Catholic population live in the large cities. This means that the remai.ning twenty per cent are spread throughout the rural sections. Or for. every 263 ,JOHN L. -THOMAS 800,000 Catholics in the cities there are only 200,000 in the country. Hence, facilities for a Catholic education are frequently lacking. Perhaps we can realize the problem better this way. There are about 18,150 parishes in the United States. Only 8,000 of these have parochial schools. This.means 10,000 groups without schools. Furthermore, of the 2,952 counties in the United Sta.tes, 1,022 have no resident priest; 500 more bare none in their rural sections. The Conference is striving to remedy the disastrous effects of these conditions--that is, it is making the Church more effective by building up parochial schools, when this can-. not b~ done it promotes vacation schools .where e~ch year ¯ over one quarter of a million children are given, a religious training. Study clubs and correspondenc,e courses are used to instruct those who can be reached in no other way. It should be noted here that the Conference is the only agency under the huspices of the Church thathas specifically inter-ested itself in the rural Catholic.school. Advantages to Church The second task of the' Conference is to demonstrate the advantages rural welfare brings to the Church. Since the Catholic population in the United States is eighty per cent urban and Since the larger cities fail to reproduce themselves by thirty per~cent, ~it is clear that the continued existence and prosperity of the rural parishes are necessary for the physical existence of the Church in this country. Whether we like it or not our large cities are the grave-yards of the race. Even at the present birth rate, for every 10 adults in the city there will be only 7 in the next genera-tion, 5 in the third, and 3 ~ in the fourth, a decline of two-thirds in a century. For the country the rate runs: 10, .13, 17,, 22, giving an increase of one hundred percent in a cen- 264 THE RURAl. L~FE APOSTOLATE tur~y. And the Catholic Church is s.trong in the cities! Her strength is her weakness. Of course, there are individuals .with ostrich_-like instincts who refuse to look at these facts. Others contend these figures are not true for Catholics. Hard, cold facts, however, prove there is little or no distinction between the drop in the urban Catholic birth rate and that of others. As a prominent weekly somewhat cynically remarked: "Despite the Catholic drive for big families and no birth control, United States' Catholics are not fully reproducing themselves except in the country parishes--and more than eighty per cent of the Catholics of the United States live in cities." Leclercq, in his excellent Work, Marriage and the Family, clearly points out the seriousness of this prob-lem for the West in general: "The second half of the 20th century Will witness the population battle. On its out-come, more than on any other factor, will depend the future of civilization." Bishop O'Hara, treating this same subject, says: "The misfortune of the Catholic Church in America is that it is not strong in the country, that it is not at the natural source of population. The result" is that it is not the bene-ficiary of that natural process but has to fight its way against the decadent influences of the city in building up a people to the Lord. The most shortsighted should see how its influence would be multiplied if, instead of having .roots in merely a few hundred strong country parishes, it could possess several thousand such sources of population-." Monsignor John "Ryan has said in this regard: "To the extent that the Catholics migrate to the city more rapidly than non-Catholics they render inevitable a decline in the Catholic population and its influence upon American life." Besides being the source of population the rural parish is the milieu where the Catholic religious ideal of the family JOHN L. THOMAS finds perhaps its strongest support. This is the contention of the many Bishops and religious leadei~ in. the field today. As Father LaFarge has stated, the strength Of ~he rural, life mbvement is its stubborn insistence on the one fundamental point at issue in ,the world today: "How can best condi-tions be provided fo:r the religious salvation of the indi~ vidual family?" Bishop Vincent Ryan expresses the same general idea: "Essential for the preserVation of our civilization are the sound principles of rural living advocated by the Confer-ence." And Bishop Muench: "True civilization is rooted in' family culture. Without it civilization cannot endure; without it civilization will decay and .die. Alive to th~s great truth the Conference bends all its activities towaid the preservation arid promotion of family culture." Monsignor Ligutti, writing on the work of the Con2 ference echoes the same sentiment: "The Conference con-tends that for the full development of the human person-ality .and the greater good of the family, rural living with its WholesOmeness, integrity, ~ and responsibility is the most desirable mode of life. The Conference contends that the welfare bf the Church and the maintenance of a democracy depend on a balancebetween people in cities and people on theland--a 50-50 ratio rather than the 80-20 ratio of today." ¯ ~Bishop O'Hara has well summed up this point: "The Conference aims to build up in ti~e United States 10,000 strong country parishes and to anchor on the land a larger percentage of the strong, vigorous and intelligent boys and girls, who were born there." He goes on to say that the Church'sinterest in.agriculture arises from the altogether unique relationship ~which exists universally between the agri~cultural occupation and the central institution of Christianity, nay, of all civilization, namely, the family. 266 THE RURAL LIFE APOSTOLATE Now since the learning and experience of these Cath-o! ic leaders enables them to speak with authority, it must be evident to all that a primary source and ideal of Cath-olic parish life is the rural parish. And the aim of the Conference to convince leaders among the clergy and lay-men of this truth and to build up a rural youth convinced of the dignity of their calling, is a noble apostolate indeed. Catholic Agrarianism The third task of the Conference is Catholic agrarian-ism-- that is, to work not'merely to prove the value and dignity of rural life, but actually to conserve and promote rural life. Here the question is not what rural life can do for the Church but what the Cl~urch can do for rural life. As Father LaFarge.has pointed out: "There is a real threat of revolt among rural groups today.Communism can penetrate and demoralize rural America." Pius XI has indicated this danger on a general scale: "The greatest care must be exercised in behalf of the humble classes, especially the farmers and laborers. The Church is concerned at the great dangers by which their souls are increasingly men-ace&" The cause of the danger in this country--its primary source--is farm tenancy. Vanishing ownership is the menace stalking through rural America today. In the last 55 years tenancy has increased from twenty-five to forty-two percent.of all farmers. It is still on the increase. In other words nearly half of the farmers do not own the land that they work. We have only to reflect how simple it' would be for these tenants to become tenants of the govern-ment rather than of some insurance company or. bank, to .realize how easily the change could be made to the Soviet plan viewed with so much favor by many leaders today. That these conditions are contrary to the social 267 JOHN L. THOM,~S teaching of the Church is.clear from what~ Leo XIII has written: "Our first and most fundamental principle, wl~en we undertake to alleviate the conditions of the masses, must be the inviolability of private property. The law should favor ownership and its policy should be to induce as many people as possible to become owners." Pius XI, after speaking of "the immense army of hired rural laborers, whose condition is depressed in the extreme, and who have no hope of ever obtaining a share in the land,", says: "Unless serious attempts be made, with all energy and without delay, to put them [principles leading to wage: earner ownership] into practice, let nobody persuade him- . self that the peace and tranquillity of human society Can be effectively defended against the forces of revolution!" He has given the reason .for the seriousness of the agrarian problem eisewhere, saying: "Land is a nation's primary wealth andagriculture its most natural, vital, and impor-tant industry." Consequently, trouble in this field means a disruption of the very foundations of society. His Holiness, Plus XII, says of land and the family: "Of all the good~ that can be the object of private ownership none is more conf6rmable to nature . . . than the land, on the holding of which the family lives and from the products of which it draws all or patt of its subsistence . As a rule only that stability ¯ which is rooted in one's own.holding makes of the family the most vital and perfect and fecund ~ell of society . If today the concept of vital spaces is at the center of social and political aims, should not one, before all else, think of the vital space of the family and free it from the fetters of conditions which do not permit even to formulate the idea of a homestead of one's own?" , Therefore, Catholid agrarianism in the United States has a twofold job: To promote the ideal Catholic rural 268 THE RURAL LIFE APOSTOLATE community, and to propagandize for those essential norms of social morality which govern rural welfare wherever found, and which can be subscribed to by all persons whose minds have not been corrupted by atheism and materialism. These two aims interlock. Since the Catholic rural com-munity cannot function in a vacuum it must unite with other upright rural forces which are working for the com-mon end of social justice. It does this by organizing cooperatives,credit unions, study clubs, and by promoting a spirit of brotherhood and neighborliness. It maintains friendly relations with other rural life associations and endorses and sponsors all projects looking to the true uplift of the rural population. This leads to frequent contact with non-Catholics and opens up .an immense field for true conversions. Several Bishops have stated that they consider no field more fruitful in con: versions than this apostolate. Conclusion These, therefore, are the main rural life problems the Church must face: 1) pastoral and missionary; 2) edu-cating to values of the rural parish as the source of Catholic population and ideal family culture: 3) Catholic agra-rianism working for ownership of the family-sized farm. The efforts being made to meet these problems are clear from the four working aims of the Conference: 1) to care for the underprivileged Catholics living on the land; 2) to keep on the land Catholics who are now there; 3) to settle more Catholics on the land; 4) to convert the non-Catholics nowon the land. This is the rural life apostolate. These are its prob-lems and its aims. Itis an apostolate to save the Christian family, to .work for conditions which render the existence of the Christian family possible, and to reeducate people to 269 JOHN L. THOMAS ~the true values in life, that is, a reaffirmation of the impor- .tance and primacy of the human person threatened on all sides. .~ It is an aposto!ate that demands work. and study. Pius xi, pleading for more social action in generaLhas written: ,"No easy task is here imposed on the clergy, wherefore, all candidates for the sacred priesthood must be ,adequately prepared to meet it by intense study of social matters.'[' What is said here of candidates to the priest-hood must be applied to all teachers in Our Catholic schools for they tbo must be prepared to instruct Christian youth 'in the true principles ofCatholic action as outlined by the Church. Since the rural life movement is one form of this Catholid social action strongly urged by-the hier-archy today, it too must be studied and promoted by all Catholics. ~ It must be obvious to everyone that much can be accomplished for this apostolate iri our schools. Not, necessarily, by the introduction of new courses, and new textbooks, however. Rather, a sympathetic and intelli-gent understanding .of the importance and seriousness of the problem will enable the capable teacher to reorientate existing courses. At any rate, efficient teachers,~and we have many of them--will find some way to achieve the aims desired. Pius. XI, in regard to the whole social question of which this apostolate necessarily forms a part, has written these stern words: "No stone, then, must be left.unturned to avert these grave misfortunes from society. Towards this one aim must tend all our efforts and endeavors, sup-porte. d by assiduotis and fervent prayers to God."'"And he adds a thought that must be uppermost in the mind of each 6f us: "For with the assistance of Divine Grace, the destiny, 9f~ the human family lies in our ~hands." 270 Git:!:-I::xchanges in t:he Correspondence of $t:. Boniface GERALD ELLARD, S.J. NO OTHER literary likeness, they say, ~can compare with a collected correspondence for providing a realistic .portrait of their writer; equally true, i.t.~). would seem, that not even thebest of letters can dispense with gift-giving in some fashion as a natural expression of ~,. friendship. "Love consists in mutual exchange on either side," as tl~e whole world knows. How this tendency of nature is to be supernaturalized is a page of the science of the saints that all engaged in the pursuit of perfection must carefully study. Happy those in whom this "supernatu-ralization process" is effected as completely and as grace-fully as in the case of St. Francis Borgia, of whom it is recorded to his credit that he "retained through life the most tender and active affection for his children. A packet of their letters to him from 1566 to 1569 has been found, full of minute detail . Presents go to and fro. The General sends his son a map, and a watch . His daughters, in the charming and unchanging manner of nuns, send him jam.s and sweets and syrup of orange-flowers and corpobals and beg 'one little Hail Mary' . . . This article proposes to select from the extant corre-spondence of the great Saint Boniface, Apostle of Germany, passages in which his genius for human friendship is illus-trated by the exchange of gifts. For antiquarians, of course, these letters have a many-sided and engrossing interest; but for putting Boniface before us in his best human light, for making him a living and loving friend among friends high and low, this little store of gifts cancels out the differences 1C. C. Martindale, Captains o[ Christ (London: Washbourne, 1917), 44, 45. 271 GERALD ELLARD of twelve hundred years; we see him twin of any twentieth century noble friend. Bishop Daniel of Winchester, who had once been Boniface's "beloved master," in his old age addressed him as "my hundred-fold dearest friend"; in fact, ohe might say that the entire Boniface correspondence glows with the ardor of the love he'evoked. Still, the great-est monument of his lovableness is, I think, the fact that in " a correspondence extending ovei thirty-five years, roughly half of the personal letters:speak of the receipt or despatch Of some "gift, small indeed in itself, but token of a great affection," as the Bishop of LeiceSter once phrased it. Let us see Boniface in the midst of'his gifts; no picture of him is better! Desire/:or Books . There are gifts and gifts, but those Boniface received most gratefully were books. The r.e~luests he made most frequently were for more and more books, the latest books, the best books, in "all the branches that bore upon his sacred ministry. His letters show how he came by them. In one of the very first letters of the corrd'spondence, an English nun by the name of Bugga writes to Boniface, or Winfled, to congratulate him that the death of King Rathbod (719) opened the door of the Gospel in Frisia. She continues: "Know also'that the Sufferings o/: the Mart~trs which you asked me to send you I have not been able to get, but as-soon as I can I shall send it. And you, my best beloved, comfort my insignificance by sending me, as you promised in your dear letter, ~ some collection of the Sacred Writings. "I am sending ygu by" this same messenger fifty solidi and an altar-cloth, the best I can possibly do. Little as it is, it is sent~with great affection:''-°~ ~Epist VII: the letters are quoted, unless otherwise stated, as translated in The Let-ters of Saint Boniface° XXXI, Records of Chrilization, (New York: Columbia University, 1940). In the remainder of this article, these letters will be referred to by Roman nu~merals placed .after each quotation: ~ . , 272 ST. BONIFACE AND GIFT-EXCHANGES Another .life-.long friend of Boniface was the English Abbess Eadburga; to whom he wrote, about the time he became archbishop: "May He who rewards all righteous acts cause my dearest sister to rejoice in the choir of angels. above because she has consoled with spiritual light by the gift of Sacred Books an exile in Germany" (XXII). 2ustly famous in the annals of his mission is the request of Boni-face that this same Eadburga prepare for him a copy of the Epistt~s ot: St. Peter in letters of gold: "I pray to Almighty God, the rewarder of all good works, that He may repay you in the .Heavenly mansions and eternal tabernacles and in the choir of the blessed angels for all the kindnesses you have shown me, the solace of books and the comfort of the vestmentss with which you have relieved my distress. "And I beg you further to add to whatyou have done already by making a copy written in gold of the Epistles of my master, St. Peter the Apostle, to impress honor and rev= erence for the Sacred Scriptures visibly upon the ca.rnally-minded to whom I preach. I desire to ha~e ever present be-fore me the words of him who is my guide upon this road. I am sending by the priest Eoban the materials for your writing" (XXVI). ¯ Saint Peter's Epistles. in gold lettering on the finest parchment were doubtless very imposing, but Boniface felt very keenly the lack of a ~handy code of canon law to appiy the lessons of Holy Writ according to the mind of the Church. Not a few of his requests touch upon his uncer: tainty concerning marriage within the forbidden degrees of kinship. TtJis i~ reflected,, for instancd, in an urgent request of Archbishop Nothelm of Canterbury for a papal docu-ment he had already sought fruitlessly, at Rome: a"Vestimenta'" in the original, usually rendered as we have given it, but ~ometimes translated as "garments." Here I depart from the Columbia University rendering. 273 GERALD ELLARD "I beg that you will procure for me a copy of the letter containing, it is said, the questions Of Augustine, the first prelate and preacher of ~he English, .and the replies of the sainted Pope Gregory [the First]. In this writing, it is stated, among other things, that marriages between Chris-tians related in the .third. degree are lawful. Now will you cause an inquiry to be made with the most scrupulous care whether or not that document has been proved to be by the aforementioned father, Saint Gregory. For the registrars say that it is not to be found in the archives of the Roman church among the other documents of the aforesaid Pope" (XXIV). Reverence for Bede Among the writings attributed to Boniface are fifteen sermons, but their genuinity is.questioned because-they "contain no quotations, from Holy Scripture . and the books for .which he asked, such as the Spiritual commen-taries of St.Bede, would seem to-point to a different man-ner of preachi"ng. "* The critics are sceptical if these ser.- mons¯coutd be by Boniface in view of such passages as this, written to a~former pupil of his, now an abbot (we know not where), Dudd by name: ¯ "Try to support me by pouring out your prayers to God and help me with the Sacred Writings and the inspired treatises of the Holy Fathers.- Since a spiritual tract is well known to be a teacher for those, who read the Holy Scrip-tures, I beg you. to procure for me, as an aid in sacred learn-ing, apart bf a treat{seupon the Apostle Paul, which I lack. I have-tracts upon two. Epistles, one upon Romans, the other upon First Corint.hia,ns, Further, whatever you may findih your church library which you think would be useful to me and Which I may not be aware of or may not .4Day-Bet~en, .$a_int Boniface (MilwaUkee: Bruce, 193~), 166. . : 274 ST. BONIFACE AND GIFT-EXCHANGES. have in written form, pray let me know about it, as a loving son might do for an ignorant father, and send me also any notes of your own" (XXV). Then there was his epistolary campaign, so to speaL to get something of the writings of Bede, of whom the more he heaid the more eager he became to read. First he mentioned the matter somewhat casually in a long and very weighty letter to Egbert, Archbishop of York, near which city Bede had recently died. The letter opens with a grace-ful acknowledgment: "When I received your gifts and books I lifted my hands and gave thanks to Almighty God who ha.s given me such afriend in my long wanderings " and then passes,to its serious business. At the end. comes the reference to the "lector Bede": "I beg you also to have copied and sent to me some of the treatises of the lector Bede whom, as we learn, divine grace has endowed with spiritual intelligence and permitted to shine forth in your country, so that we too may profit by the light of that torch which the. Lord has granted unto you. "Meanwhile, as a token of fraternal love, I am sending you a copy of some letters of Saiht Grdgory which I have obtained from the archives of the Roman church, and which, as far as I know, have not yet reached Britain. "If you so order, I will send more, for I have received many of them. I am sending also a cloak and a towel for drying after washing the feet of the servants of God" [as the ceremonies of Maundy Thursday prescribe] (LIX). Archbishop Egbert sent on "gifts and books," but fresh canonical problems having cropped up meanwhile, Boni-face appeals for fresh guidance "to his friend in the embrace of 1Qving arms, his brother in the bonds of spiritual broth-erhood"-- and then reverts once more to "Bede, the in-spired priest": "Now we exhort you with eager desire to comfort our ¯ ° 275 GERALD ELLARD sorrow, as you have done before, by sending us some spark from that light of the Church which the Holy Spirit has kindled in your land: namely, that you will be so kind as to send-us some portion of the treatises which Bede, that inspired priest and student of the Sacred Scriptures, has put forth in his writings. Most especially, if possible, his.Lec-tior~ ar~l t:or the Year, which would form a convenient and useful, manual for us in our preaching, and the Prooerbs Solomon. We hear that he has written commentaries on this book" (LXXV). This letter from Boniface, a life-long abstainer, closes with the note: "We are sending you, by the bearer of this letter, two small casks of ~ine, asking you, in token of our mutual.affecti0n, to use it for a merry day with the breth-ren." The.next request was addressed directly to the Abbot of Bede's beloved Wearmouth: /" "Meanwhile we beg of you to.be so kind as to copy and send us some of the treatises of that. keenest investigator of the Scriptures, the monk Bede, who, we.have learned, shone forth among you of late as a lantern of the Church, by his Scriptural scholarship . . . "As a token of our deep affection we are sending you a coverlet, as they call them. here, made of goats' hair, and beg you to accept it,-trifle though it is, as a reminder of me" (.LX). When advancing age had dimmed the apostolic Arch-bishop's sight, he was stillbeset with countless ecclesiasti- . cal problems--and an insatiable desire of sacred learning. In a long letter of inquiries to the patriarchal Bishop Daniel of Winchester, Boniface's pen touched the old man's heart with this passage: "There is one solace in m~i mission I should like, if I may be so bold, tO ask of yOur fatherly kindness, namely, 276 ST. BONIFACE AND GIFT-EXCHANGES that you send me the book of the Prophets which Abbot Winbert of reverend memory, my former teacher, left when he passed from this life to the Lord, and in which the six Prophets are contained in one volume in dear letters writ-ten in full. If God shall incline your heart to do this, you could not give me a greater comfort in my old age nor bring yourself greater assurance of reward. I cannot procure in this country such a book of the Prophets as I need, and with my fading sight I cannot read well writing which is small and filled with abbreviations. I am asking for this book be-cause it is copied clearly, withall letters distinctly writteri out. "Meanwhile I send you by the priest Forthe~)e a letter and a little gift as a token of my sincere affection, a bath towel,° not of pure silk, but mixed with rough goats' hair, to dry your feet" (LI). Correspondence with Rome Boniface was on truly filial terms with several Popes, especially with Gregory III and Zachary. When the last-named was raised to the supreme pontificate in 742, Boni-face's felicitations were supported by: "some trifling gifts, not as being worthy of your Paternity, but as a token of our affection and devoted obedience, a warm rug and a little silver and .gold" (XL). In the face of Boniface's silence in the matter we might add that he also sent some couplets. proof that the schoolmaster of old had not lost his delight in versification. Did Boniface ask for books at Rome? Quite frequently, it would seem, but not always with immediate success. Pope Zachary sent him, ,on request, a carefully-marked copy of the Canon of the Mass, so that Boniface's "Holi-ness would know where the. signs of the Cross should be made during the recitation of the holy Canon" (LXXI). 277 GERALD ELLARD Such a request was not,hard to fulfill, as every altar had its Missal, but when Boniface asked Zachary's Cardinal-Dea-con Gemmulus for a copy of the Registrum (Correspond-ence) of Pope Gregory I, a vast collection of documents, that official pleaded ill-health for delay in complying with the request, sending .some exquisite incense meanwhile: "We are sending by youraforesaid priest some cozum-bet of a marvelous fragrant odor, which you may offer as incense to God at Matins or Vespers or at the celebration of the Mass" (XLIII). By and by came many letters of St. Gregory I to Boniface, as we have seen above. Before continuing our theme, we might recall in pass-ing that the earliest lives of St. Boniface reflect about as much concern, at the time of his martyrdom, for the recov-ery of his numerous books, as for the honor of hi~ sacred body. Whatever may have happened in the Hitlerian up.- heavals, several of Boniface's own books have been pre-se) ved at Fulda through all the intervening centuries! His influence has gone out through those books to the endless glory of Christian culture. To return now. to our gifts of fragrant spices: The same Cardinal-De,icon mentioned above, in giving Boni-face an account of the Roman Synod of 745, in which some of his most vexatious problems were handled, speaks with joy of having been visited by English nuns "with introduc-tions to us from you," and then adds that note without which these letters would be incomplete: "We have received also the gift you sent us--a.silver cup and a piece of cloth, a gift doubly precious to us as coming from so honored a father. Though we cannot repay you in kind, still we send in exchange" of loving remembrance four ounces of cinna- " mon, four ounces of costmary, two pounds of pepper, and one pound.of cozumber'" (L). Sweet ~as these spices ,were, the letters accompanying 278 ST. ~36~qIFAeE AND GIFT-EXCHANGE8 them were of the plainest garden variety, so to speak, in comparison with those sent Boniface by a later archdeaconl the Greek Theophylact, whose flowery epistles are the de-spair of translators. One wades through a good deal of high-water rhetoric before landing on this bit of welcome simplicity: "A little gift of blessing as a souvenir of our friendship: cinnamon, spice, pepper, and incense in a sealed packet" (LXVIII). But the "ambrosial goodness" makes for sticky going in the letter that concludes with this Hel-lenic honey: "With these preliminaries we greet your most holy, nectar-sweet divine fatherliness and pray that with God's favor you may receive your eternal reward and may win the desired verdict as your welfare may require. We are sending you a little gift of. spices, cinnamon, and storax, as largesse from the Blessed Apostle Peter and. beg you gra-ciously to accept it" (LXIX). If the "duration" of today lasts very long, perhaps we shall revive thi~ custom, among our very dearest friends, of sending a little packet, well-sealed, of spices and pepper. A letter from some of Boniface's priests to his friend, Abbess Cuniburg, says most respectfully: "Some little gifts accompany this letter: frankincense, pepper and cinnamonma very small present, but given out of heartfelt affection" (XXXIX). To a Cardinal-Bishop of Italy Boniface once sent "a bath towel, a face towel, and a little frankincense." Again: having a ,request as urgent as it was delicate to make of a priest named Herefridmnamely, that he personally read to his royal master, King Ethelbald of Mercia, a scathing re-buke of his vices--he ends his appeal with this gift-offer-ing: "We are sending you, as a token of sincere affection and of our blessing, a napkin with a little incense" (LVI!I). And we may. well bring thislitany of gifts to 279' GERALD ELLARD a close by recording that on another occasion Boniface him-self dispatched to this same King Ethelbald: "as a token.of true affection and devoted friendship., a hawk andtwo falcons, two shields and two lances;~ and we beg you to accept these trifling gifts for the sake of our affection towards you" (LV). "Your generous gifts, and affectionate letter," "this little gift, unworthy of you,'" "these little tokens of affec-tion," "that I may have you always with me," this was the language of those holy human friendships in Christ cher-ished by St. Boniface, Apostle of Germany, with such pon-tiffs as St. Gregory II, St. Gregory III, and St. Zachary; with such prelates as St. Egbert of York, St. Nothelm of Canterbury, .and St. Cuthbert of the sameSee; with such missionary-bishops as St. Lul, St. Eoban, St. Witta, St. Burchard; such abbots as St. Wigbert, St. Sturm, and St. Wunibald;. such nuns as St. Eadburga, St. Thecla, St. Wal-burga, and the dearest of them all, his kinswoman, St. Lioba, whom Boniface wished to have buried even in his own grave at Fulda. Saint Boniface, befriend us, and forget not the-land of your labors! 280 MARCH INTO TOMORROW. By the Reverend John J. Consldlne, M.M. Pp. 87. The Field Af-~r Press,. New YorE, 194.2. $2.00. With the daily press and current books, so filled with the marches and exploits of death-dealing armies, it is pleasure unbounded to read the history of a corps of gallant soldiers whose campaign is designed to bring lasting peace and life eternal to as many peoples as it can conquer. "March into Tomorrow" is the Maryknoll odyssey from the meeting of Fathers James Walsh and Thomas Price in Montreal in 1910, to the present day when over four hundred men and women, in the midst of total war, are being all things to all men of the Far East, sacrificing all and counting as gain only the benighted souls they can save for Christ. It is a personal introduction to the Maryknoll battalion of Christ's far-flung army of heroes, their hardships, their methods, their small victories. Enriched as it is with interesting pic-tures and enlivening episodes from the lives of the missionaries, it is a book to be read and kept as a priceless document of Catholicism,s progress today, and as a record of a completely American endeavor in the spreading of Christian culture and civilization.--W. M. GENG-LER, S.J. WATC~H AND PRAY. By the Reverend J. E. Moffat, S.J. The Bruce Pub-lishing Company, Milwaukee, 1942. $1.2S. " " This little work was conceived and planned as a help to religlou~ in making their monthly recollections. The general theme running through the whole of it is death, its significance for religious, and the preparation that they should make foi'it. Corresponding to the months of the year, there are twelve chapters. Each of these could be used for spiritual reading at the time of the monthly recollection, and at the end of each there is a brief outline of the reflections arranged in the form of points for meditation. In keeping with the gravity of the general theme, death, a very serious and earnest tone characterizes the thought and feeling of the work. One Who ~makes use of these readings or meditations will be readingor meditating, to quote a phrase that recurs in them, "in the light of the candle of death." Most of the subjects are suitable for any month, but there is a 281 BOOK REVIEWS certain amount of adaptation in them to the time of the year. Thus, for January, the chapter is entitled "Thoughts for the NewYear"; for December, "Sursum Corda," reflections on the eternal reward that religious may look forward to; for November, "Have Pity on Me, at Least You, My Friends," on purgatory, or on being delayed in one's journey toward life everlasting. Naturally enough, death sug-gests the divine judgment that follows, and this is handled in the chapter for October, "What Did You Treat of in the Way?" Perhaps the most concrete and the most highly encouraging of the subjects treated is that for September, "I Will Spend My Heaven Doing Good upon Earth." Vividly to visualize the death-scene of St. Therese of Lisieux and to realize the significance of that celebrated program for life after death should be a great consolation for any fervent religious and a most potent incentive toward becoming more fervent and.holy and supernaturally effective. Religious who make their monthly recollections in accordance with "Watch and Pray," and take its clear and practical lessons to heart, may feel sure of a peaceful and fruitful life, a happy death, and a very rich eternity. ¯ G. A. ELLARD, S.J. IN THE SHADOW OF OUR LADY OF THE CENACLE. By Helen M. Lynch, Religious of the Cenacle. Pp. x;i; -I- 249. The Paulis÷ Press, New YorK, 1941. $2.00. The seal upon the cover of this well-written book contains some adapted words of Scripture which epitomize the work of the Reli-gious of the Cenacle throughout the world, but more particularly in America during their first fifty years just completed: "They continued with one mind steadfastly in prayer with Mary" (Acts 1:14). Under the saintly guidance of Father John Peter Terme, the Vener-able Mother Th~r~se Couderc, a truly humble woman, valiantly founded the new society amid many difficulties and contradictions. The first Cenacle, St. Regis House, opened its doors at La Louvesc, France, in 1826. The work soon became international. In 1892, Mother Christine de Grimaldi, with three companions, arrived in New York, .there to establish the first Cenacle in America, another St. Regis House, with many a hardship and privation. Thence the society spread, until today there are no less than seven busy Cenacles in the East and Middle-West. The Religious of the Cenacle can be 282 BOOK REVIEWS justly.proud of this concrete result of fifty years of determination, steadfastness, and prayer in the shadow of Our Lady of the Cenacle. What is the work of the Cenacle religiofis? In the words of the author, they "devote themselves to spiritual works of.mercy, through Retreats for Women and the teaching of Christian Doctrine to adults and children." Their women's retreats have made them pioneers and 'leaders in the retreat movement and in Catholic Action in Ameri-ca. Pius XI, himself the director of the Milan Cenacle for thirty-two years, once addressed these words to Mother General Marie Majoux in a public audience: "You will have realized that in preparation of that encyclical (Mens Nostra-~on retreats) We had the Cenacle in mind. It was there ~ indeed that We learned by experience the great good which" is effected by the Spiritual Exercises." The harvest of good reaped by the Cenacle Retreats is indeed great. Thousands of women have been led by them to lives of greater perfection. The Cenacles have been the nurseries of hundreds of vocations, some to almost every religious congregation. Hence, all religious will join in congratulating the Cenacle for what is narrated in this modest but splendid anniversary book. Eileen Duggan, the New Zealand poet, writes of Mother Th~r~se Couderc: "She whom they called the silent Mother, the woman in the corner, has withthe faggots of her humility, made a fire that will last and whose burning brands will start strange wood in countries she was not destined to see." The strange wood of America has caught definitely that fire and its flame will spread still more mightily as the,years march on to the century.-~A. KLAAS, S.J. I PRAY THE MASS. A Sunday Missal arranged by ÷he Reverend Hugo H. Hoes, er, S.O.Cist., Ph.D. Pp. 447. Catholic Book Publishing Com-pany, New York, 1942. $.35 to $3.50. This new missal contains the Masses for all the Sundays and principal feastdays of the year, as well as the Nuptial Mass and the Mass for tl~e Dead. The Introduction contains a brief explanation of the meaning of the Mass and a description of the vestments and sacred vessels. It also includes a liturgical calendar good for ten years.: In the supplement are morn.ing and evening prayers, and good sug-gestions and prayers for Confession, Communion, the Way of the Cross, First Friday, and Benediction of the Blessed Sacrament. The headingl in the book are printed in red; the translations of 283 BOOK REVIEWS the New Testament are taken from the Revised English E~dition. Before each Mass is a brief, well-chosen "Thought for Today"; after the Mass, a "Thought for th~ Week." This missal offers everything that could be desired in a small book of this kind. As indicated above, the prices .range from $.35 to $3.50. The volume sent us for review is bound in black imitation leather and is priced at $1.10. It would be appropriate for anyone who is not inclined to extravagance. MODICUM. By the Reverend Athanasius Bierbaum, O.F.M. American Edition by the Reverend Bruno Hagspiel, S.V.D. Pp. ix + 204. St. Anthony Guild Press, Paterson, New Jersey, 1941. $1.00. This small book contains twelve monthly recollections for priests. The author has made a fine choice of subjects fundamental to priestly life, and has developed each subject in a complete, orderly, and interesting fashion. His choice of Scripture texts and other quo-tations is apt, and his applications are thoroughly practical. With Modicum, we might mention another small book for priests by Fathers Bierbaum and Hagspid, Seekinq Onlg God. This latter work, published in 1938, is an excellent little treatise on the interior life for priests. Modicum is clothbound: Seeking' Onl~t God is paperbound. Both books should be helpful to priests seeking aid for self-sanctification. They may be obtained from the publisher or from The Mission Procurator, Techny, Illinois. HOMILETIC HINTS. By the Reverend Albert H. Dohn, O. Carm. Pp. 71. Carmelite Press, Encjlewood, N. J. 50 cents. Priests and seminarians interested in a scientific study of preach-ing will find this booklet helpful. As the author states ifi the Intro-duction, the book contains all that his experience tells him it is "'nec-essar~ for the student to know abou

The Mercury November, 1909 HELP THOSE WHO HELP US. The Intercollegiate Bureau of Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Mak^« °f CAPS AND GOWNS To Gettysburg College, Lafayette, Lehigh, Dickinson, State College, Univ. of PeMi -ylvania, Harvard, Yale, Princeton, Wellesley, Bryn Mawr and the others. Class Contracts a Specialty. Correct Hoods of Degrees To The Class of '10. We have begun our college campaign for next Spring and Summer. Over 25,000 employers look to Hapgoods for their men in sales, offices and technical positions in all departments. Most of these Arms use college men. They arrange with us to cover the en ire college world for them. We have a unique preposition of in mediate interest to any college man who will be open for a propo-sition. Let us tell you about it. Write to-day. TXL _,_^ _j c^ 17^ ,-~ " TIM JVJtTJOJVJJ, ORGJJYMZJITtOJV Of HfipGrOQEltB, BMUMM- BUOHMUBS. Commonwealth Trust Building, Philadelphia, Pa. HOTEL GETTYSBURG, Headquarters for BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES $2.00 PER DAY. -/i/very G-ttaartea. B. B. Cqwoll, Proprietor. All our drugs aud chemicals are sold to you under a positive guarantee, pure and full strength. H. C. LANDAU, DRUGGIST. EVERYTHING A FIRST CLASS Drug Store should have Opposite Eagle Hotel. lfm0Vmmt*f^mt^mftlwt^n GETTYSBURG COLLEGE Gettysburg, Pa. - LIBRARY - I WE RECOMMEND THESE FIRMS. Established 18S7 by Allen Walton. ALLEN K. WALTON, Pres. and Treas. ROBT. J. WALTON, Supt. HUMMELSTOWN BROWN STONE COMPANY QUARRYMEN and Manufacturers of BUILDING STONE, SAWED FLAGGING and TILE. Waltonville, Duphin Co., Pa. CONTRACTORS FOR ALL KINDS OF CUT STONE WORK Telegraph and Express Address, Brownstone, Pa. Parties visiting quarries will leave cars at Brownstone Station on the P. & R. R. R. For Artistic Photographs —GO TO— TIPTON The Leader in PHOTO FASHIONS Frames and Passapartouts Made to Order. D. J. REILE, Clothing, Gent's Furnishings Sole Agent for the CRAWFORD SHOES, 13-15 Ohambersburg St. Come and Have a Good Shave or Hair Cut —AT— HARRY B. SEFTON'S BARBER SHOP 35 Baltimore St. Barber's Supplies a Specialty. Also choice line of Cigars. R. E. ZINN & BRO. DEALERS IN Groceries and Choice Provisions. Carlisle St., Gettysburg. THE GETTYSBURG DEPARTMENT STORE Successors to the L. M. Alleman Hardware Co., Manufacturer's Agent and Jobber of ' HARDWARE, OILS, PAINTS AND QUEENSWARE, GETTYSBURG, PA. The only Jobbing House in Adams County. PATRONIZE OUR ADVERTISERS. * 2 a, ft ft * « « » » *w ft *« a * * «« ft * ft ft .-■> a» * « Seligniqq ARE GETTYSBURG'S MOST RELIABLE TAILORS And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. Give Them a « »»« *««* » « ft Your Patronage * « *»« » a »« »a * » «» ft ** ft »« « « ft «««»« * « ft « e» ft « ** »« « «« «« « ft * » « ft »* PATRONIZE OUR ADVERTISERS. A Special Proposition Is open for the first person ID any com-munity who will deal with us for a Piano or Organ. WEAVER ORGANS AND PIANOS have no question mark to the quality. I IIII I .__ _ _ Z WEAVER ORGAN AND PIANO CO., MANUFACTURERS, I YORK, PA , U S A. MAIL THIS COUPON TO US. Send me special proposition for the purchase of a Piano. Name Address m * .-I-. •I" •■!•■ T\ •*■ ± Students' Headquarters —FOR— HATS, SHOES, AND GENT'S FURNISHINGS. Sole Agent for WALK -OVER SHOES ECKERT'S STORE. Prices Always Right He Lutheran PubliGatiori Society No. 1424 Arch Street, PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Colleges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and develop one of the church in-stitutions with pecuniary ad-vantage to yourself. Address HENRY 8. BONER, Supt. THE [UIERCORV The Literary Journal of Gettysburg College. VOL. XVII GETTYSBURG, PA., NOVEMBER, 1909 No. 6 CONTENTS. THE WBONG OP WASTE 2 DAVID M. CRIST, '10. FEESCOING A LOST ART 3 ELMER STOUFFER, '11. A HALLOWE'EN STOEY 7 SAMUEL BOWER, '10. THE VOTEE'S DOMINANT PBINCIPLES: WHAT THEY SHOULD BE 12 ROT V. DERR, '10. IS GEEMANY A MENACE TO THE WORLD'S PEACE? 15 C. M. ALLABACH, '11. A NAEEOW ESCAPE 16 R. L. MCNALLY, '13. THE "BACK HOME" BOY 20 EDWIN C. MORROW, '12. THE EVOLUTION OP THE BEAST 22 EDWARD N. FRYE, '10. THE SPIEIT OP THE PLACE 24 HARVEY S. HOSHOUR, '10. EDITORIALS '. 29 EXCHANGES 31 GETTYSBURG COLLEGE Gettysburg, Pa. | - LIBRARY - I THE MERCURY. THE WRONG OF WASTE. DAVID M. CRIST, '10. jO the contemplative mind one of the saddest things in the world is the waste that is going on, and has gone on ever since civilization dawned. Much of this waste is wretched, needless, wicked; it means human efforts thrown away; it is one form of homicide for it sacrifices life and the material that life thrives on, and thus it hampers progress. What does a grain of corn amount to? Nothing, we hear the wasteful man say. Yet the secretary of agriculture of Missouri computes that one grain on every ear of corn grown in his State alone would add one hundred thousand dollars to the wealth of the State each year. We have all been told what a large sum the saving of a few cents a day will amount to, if allowed to roll up for a period of years, yet we all go through life really unmindful of the possi-bilities there are in such little things. A Kansas statistician has recently figured that the men of that State are constantly wearing on their coat sleeves eighty thousand dollars worth of buttons which serve no earthly use. It is easy enough, of course, to over do economy and make it ridiculous, and it is often most difficult to say whether a given policy is wasteful or economical. In this country our railroads work their locomotives very hard, and wear them out in a few years, whereas in England locomotives are used very carefully, and are kept in service several times as long. The English blame our railroads for being wasteful in this, whereas our au-thorities hold that it is better to get the best wear out of any ma-chine in a reasonable time, and then scrap-heap it, and replace it with something newer and better. Large scale producers such as the Carnegie Steel Company of Pittsburg, have owed their success in no small degree to their lavish expenditures, or industrial experiments, and for the in-stallation of new machinery as soon as its superiority to that in use has been demonstrated. So ideas to what is waste will differ. Unquestionably we are wasting our coal, oil, natural gas, and THE MERCURY. 6 timber supplies in this country, but under the conditions it does not pay to husband these material resources. A few years ago the world became alarmed because its fuel supply seemed to be coming to an end. Now, we are harnessing the rivers, water-falls, and even the glaciers, and making them do much of the work that coal hitherto has done. There is no small doubt that before the coal supply is ex-hausted the world will be so completely electrified that the use of coal will have become obsolete. The waste of timber is more serious, and yet as lumber rises in price other materials will be developed to take its place, witness the present rapid introduc-tion of concrete for building purposes. This country would not be what it is if it had been developed UDcler such a saving policy as has necessarily dominated the rise of European nations, so it would be well for us to remember the words of Benjamin Franklin when he said: "What maintains one vice would bring up two children. Eemember many a little makes a nickle. and farther, beware of little expenses; a small leak will sink a great ship." FRESCOING A LOST ART. ELMER STOUFFER, '11. EW people realize that the frescos which they see on the walls of buildings are the remnants of a once great art. An art which for the number of men who were engaged at it and scope of application never had an equal. The history of this great form of art is long and of itself interesting to read. It is not the purpose in this article to give the history beyond what is necessary to the illustration of the subject in hand. It shall be our purpose to discuss the art as we know it, and the methods of the frescoer of to-day. It is claimed by many that the art of frescoing was known to the ancient Egyptians, but this is doubtful. If they knew any-thing at all about it, it could not have been more than enough THE MERCURY. •to cover the walls of their houses with the crudest and coarsest kinds of earth colors mixed with water. True one can find buildings decorated in patterns which are supposed to be genu-ine reproductions of ideas found on the walls of Egyptian ruins, but the methods of getting these actual designs are never told. The whole is fanciful and not certain enough to receive much consideration. The Greeks were familiar with the art of fres-coing but the extent to which they developed the art is uncer-tain. The excavations of Schlieman have brought forth some old decorated pieces of walls which were thought to be frescoes, but careful examination has shown them to be mere earth colors applied in various designs. The Hebrews it is certain knew nothing of frescoing. It was not until the beginning of the Christian era that the art rose to its fullest development. The Christian artist wanted an art which would properly express the emotions. The stirring scenes of the early Christian times were the subjects for the •church decorator to work upon. The art which he would use must be able to express faith, hope, joy, sorrow, grief, pain and things of that nature. Sculpture, the art of the Greeks, would not answer his purpose for that is essentially an art of repose. Frescoing seemed the only one capable of answering his purposes so he employed it. Even then the early decorator was held in check by ecclesiastical interference. In decorating the churches he was not permitted, even though he had the impulse, to use any type not traditional. For this reason we find nearly all the fres-coes of this period consist of the gaunt, pinched bodies of an-chorites and saints. In the sixteenth century this art reached its highest state of development. In this period some of the world's most famous frescoers lived, and some of the most noted frescoers were executed. Several of the works produced in this period are extant to this day. The wave of Iconoclast fanaticism which swept over Europe in the sixteenth century struck the art a blow from which it has never wholly recovered. In England nearly all the paintings were destroyed. In some churches they were merely defaced, hut in those churches where the frescoes could not be destroyed without permanently injuring the buildings, the despoilers cov- THE MERCURY. «red them up with lime. On the continent of Europe the hatred was not so intense, and it is doubtful whether any works of real value were destroyed. It is true, however, that when the Icono-clastic wave had swept away, the art was practically dead. In America very little is known about frescoing. Our near-est approach to it are the distemper paintings with which we decorate our theatres and churches. Several reasons might be mentioned for this, but the most reasonable seems to be that Americans are too impatient to apply themselves to a trade in which the first and chief requisite is painstaking precision. The Americans as a class are too much in a hurry to take the time which it is necessary to do a good work of frescoing. The aver-age American does not care what a piece of work costs but he invariably does want his work done at once. So little interest is taken in the art in America that not one color manufacturer is to be found who so much as manufacture the kind of color which mural decorators use. The American decorator must depend upon the shops of Germany for the colors which he uses. German workshops also supply America with her supply of deco-rators. Frescoing as clone in former times required a great deal more skill than it does to-day. The work was all done while the plaster was still soft. The decorator decided in the morning just about how much surface he wished to cover that day. The plasterer, who worked right with him, then finished that much. With a sharp pointed awl or some other instrument the deco-rator then marked the design in the plaster, and proceeded to his task. Sometimes a small design of the work in hand was made and kept lying by to refer to in case the decorator became puz-zled as to how to proceed. The necessity of this can readily be seen when one remembers that some of the great works of this kind were fifteen and sometimes twenty years in the accomplish-ment. If all which was marked could not be done in the day the plasterer cut the unfinished portion off and they began all over again. An almost perfect knowledge of pigments was ab-solutely essential to the decorator of the old time. Lime in dry-ing causes many colors to fade and some to become darker. It was necessary for the mechanic to know just what effect the lime tf**ftiufvrxv GETTYSBURG COLLEGE * Gettysburg, Pa. LIBRARY 10 THE MEBCURY. "An unlucky spot," sighed Proud Patrick. "He ain't the first, nor thirteenth to be tuk tar." Hattie came running in with the holy water bottle and Mis-tress Proud Patrick eagerly bathed poor Oiney's head. As the cold drops fell showering upon his face Oiney winced in spite of himself. "The color is comin' to his cheeks," said Hattie as she knelt over him solicitously. "The fire is warmin' him. He's comin' roun' all right." "God be thanked for holy water bottle said Mrs. Proud Pat-rick. "Let's raise him up a bit," said Del. "An' a drop of nice warm sweet milk with a pinch o' ginger and sugar might do the poor fello' good," said Hattie. "Bether couldn't be," said Del. "An' a bowl o' tea," added Chris. "An' a drop o' spirits," said Joe. At this insinuation a perceptible glow over-spread the features of the unconscious one and to the delight of Del and eve^one there, a sigh escaped his lips. "God be thanked," said Hattie. Del bent over his patient and softly whispered, "Oiney." Oiney slowly opened his eyes and looked wonderingly and in-quiringly about him. "Del—is—is—thet—you ?" "Yis, yis, me darlint." "Del—where an' where can I be?" "Make yer min' aisy, ye are in a dacent house an' with dacent folks. Mister Proud Patrick and Mistress and Hattie McPher-son. Del then asked for a drop of whiskey and tried to persuade Oiney to take it but he refused. "Just a drop," said Del. "Only a toothful," said Mrs. Proud Patrick," and take it as medicine. It'll send the blood through yer veins." But Oiney looked gratefully at Mrs. Proud Patrick and ten-derly at Hattie, but still refused to touch the whiskey. The patient grew rapidly stronger on the beef tea which was THE MEKCURY. 11 tendered by loving hands and thanked the whole family for the trouble they had gone to in his behalf. "But ah, ye knows I can't be kapin' ye dacent folk out o' bed all night—it's almost mornin' now." "Oh, that's all right," volunteered Hattie. "It's no bother an' as to me uncle an' aunt, there, they can go to bed any time now seein' ye are on the fair way to mendin' yerself; an' me an' Eosie-an' Matthew 'ill tarry a while an' git ye somethin' to eat." "Uncle," she continued, "you an' me aunt can now take yer-selves off to bed seein' poor ill Oiney here is gettin' along bet-ter. Myself an' Eosie an' Matthew 'ill take care of him jes as good as if you was here." So with more thanks Oiney bade them good night and wished them a sound sleep and pleasant dreams, and assured them he would never forget their timely generosity. Then Hattie warmed some sweet milk and supported Oiney while he drank it. He was soon sufficiently strengthened to make his way to the fireside with the help of Hattie and Eosie, where he and Hattie sat down together. Oh, I'm ever so glad you're comin' roun' so fast," Said Hattie. "Faith an' I know the doctor I'm thankin' for the same," re-plied Oiney, his eyes beaming upon her. "Och, don't bother me Oiney, it's a poet you should a' been born—you've a tongue as sweet as any poet's." "Well, it's no poet you should a' been born, darlin' but in the Garden of Aiden." "Array, go way with ye." "Yis. in the Garden of Aiden, when man was alone an' com-fortless." "But the Bible never mentioned Adam takin' 'fever gortach," and Oiney reflected. "Oh, Adam would a' got it some how if he had a thot that it would a brot you in its wake." "Houl on Oiney. Take yer arm away out o' that. Take it away. Tre' ain't no danger o' my takin' waikness—no fear of it." "An' thr' all blamin' poor Adam 'cause he ate the apple"— went on Oiney, philosophical!}', gazing into the fire, still keeping ^■^■i^^n^^^^^^^^^^^H 12 THE MERCURY. his arm across her as if absentmindedly. "I know well if I was Adam an' some people I know was Eve, an' that if this partick-ler Eve offered me the same size o' rat pizen and sayed, Here Adam, my sweet, take this, its good, I'd swallowed it an' swared it was honey." "My, what a nice fellow you'd make for the lucky woman that gits ye," said Hattic. "But will ye take away yerself an' take yer arm out o' thet." "Oh," said Oiney in surprise. "Is that where my arm is?" Yet absentmindedly he went on philosophizing upon man's lonely lot had not God given him lovely woman to be a joy and a blessing forever. Del whiled away the early morning hours for Eosie, the maid, and poor Chris and Joe Eegan smoked their pieces of pipe. When the gray dawn began to filter through the blackness of the night, Hattie and Eosie who now had to begin their day's work, bade their sweethearts a merry good-bye after promising to meet them on Sunday evening at the Crooked Bridge. THE VOTER'S DOMINANT PRINCIPLES SHOULD BE. WHAT THEY ROY V. DERR, '10. .NDIVIDUAL right of franchise is the heart of a demo-cratic government. The stability and perpetuity of a nation such as ours depend upon the righteous use of the ballot-box j while corruption and dissolution are the fruit of its abuse. The right to vote becomes a cherished privi-lege by the young man as he approaches twenty-one. At this point a searching question confronts him. Will he be influenced by seductive tradition and paternal inheritance? Will he con-tinue to cast his vote as father always did? Or will he permit his privilege to be directed by certain guiding principles? This is the vital question. When one thinks of the untutored multi-tudes who become the prey of scheming politicians, it becomes an THE MERCURY. 13 important question. But what should these dominant motives, of action be? If our voter is a man of any education or good judgment, he will seek to have a general knowledge of the country's condition and needs. He aims to know the issues at stake, and the plat-form of his chosen party with regard to them. Why ? That he may decide whether the candidate in question is fully qualified for the position. In other words he will endeavor to vote intel-ligently. Not merely boasting a long ancestry who were stal-wart Democrats or life-long Eepublicans. Very often such a spirit is but ignorant pride and betrays the lack of intelligence and reason. The voter should not only be able to state his party,, but also to tell why it is his preference. But the careful voter will not stop with an investigation into the ability of the candidate to fill the duties of office. He goes further and deeper. He will seek to know the aspiring office seeker as a man. What is his character? A man of self-con-trol and integrity ? Will he prove faithful to the trust ? These questions must be answered affirmatively by the conscientious voter. Strict sense of civic duty demands nothing less. The loyal citizen will not cast his vote for incompetent or unworthy men out of mere favor or friendly acquaintance. To do so weak-ens the dictates of his moral conscience. The highest motives should control our franchise; the prosperity of the State, the-welfare of the community, and the best interests' of all concerned. This is true loyalty and genuine patriotism. Above all, for the thoughtful man the dominant principle will be party subordinate to the man. Some one may ask would not such universal independent voting destroy political parties? They are essential to counter-balance one another in government. In answer the true voter will use his influence in securing the best men on the party ticket of his preference, if for some reason these are not chosen, but undesirable nominees instead, the strict sense of civic duty will compel him to refuse to vote for those men. Partisanship must bow before right and duty. Prejudice and tradition must yield to justice and intelligence. It is bet-ter to cut one's ticket and prove traitor to one's party than to iise one's franchise in voting for incompetent or unworthy men. Then he will have nothing to regret. L GETTYSBURG COLLEGEI Gettysburg, Pa. LIBRARY ^^^■^^^^B^^^H 14 THE MERCURY. Who is to blame for corruption in politics? For partisan legislation and bad government? Those holding office we say. But our nation is a democracy! We boast of the rule of the-people! The boomerang springs back upon the voter himself. Corrupt legislation reflects itself upon the public at large. If office holders prove unloyal to their country's trust, it shows that the voters were not careful enough to elect the best men. This situation is but a practical application of the fable in which the indulgent master gives shelter, under his tent, to the imploring ass who in turn ungratefully kicks him out! What, then, should be the voter's dominant principles? To serve his country and State, not only party and self. To know the needs and conditions of his nation or community. To elect the man best fitted to fill the position, that is the man of capabil-ity and character. The former involves the ability to discharge his duties well and efficiently. The latter includes those quali-ties of honesty and integrity as will enable the office holder to stand fearlessly against bribery, partiality or injustice. Such is the type of man whom the true voter will strive to elect. So long as the right of franchise is jealously guarded and highly prized, there will be no need to fear the downfall of our repub-lic. But she shall ascend higher as a moving power in the eyes of the civilized world. Her destiny will not approach soon, but with the oncoming years, she shall exert an untold influence-among the nations of the world. THE MERCURY. 15 IS GERMANY A MENACE TO THE WORLD'S PEACE ? C. M. ALLABACH, '11. T can hardly be denied by those who have noticed the trend of international politics that Germany is the greatest obstacle to the world's peace to-day. This has become strikingly evident in recent years. Diplomatic relations between the English and Germans have been strained for more than a decade. The famous Kruger tele-gram of 1896, the intense commercial rivalry, the hostile attitude of the German people during the Boer War, the biting criticism of the press, and finally, the manifest intention of Germany to wrest from Great Britain her maritime supremacy, have all com-bined to make the situation critical. To England, this mari-time supremacy is a matter of life and death; to Germany, it is an object of mere desire or ambition. Examples of German aggressiveness are numerous. The first American experience of it was in the Samoan Islands in 1888, and a second in 1898, when Germany sent a powerful fleet to the Philippine Islands. Japan felt it in 1895 when Germany joined Russia and France in forcing her to recede from the Liao-Tung Peninsula which bore no small weight in furthering and hasten-ing the outbreak of the Russo-Japanese War. All Europe and America was unfavorably impressed by the attitude of the Ger-mans in the Boxer uprising. Then, too, it is generally known that Germany took the initiative in the Venezuelan blockade in 1M2, and since the power of Russia has been considerably les-sened by the Russo-Japanese War, the Germans appear to be even more aggressive than before. These actions truly speak louder than words, but the words are not lacking either. The German Kaiser's speeches are teeming with expressions which clearly reveal the German attitude. Among many others he said at Cologne in 1897: "We have great duties in the world. There are Germans everywhere whom we must protect. German prestige must be preserved abroad. The trident belongs in our hands." In 1900, upon delegating to Prince Henry the command of the Oriental fleet, he said: "Im-perial power is sea power. The two are mutually dependent. 16 THE MERCURY. Should anyone infringe our rights, then use the mailed fist and earn your laurel wreath." To departing soldiers he used such terms as these: "Spare nobody." "Take no prisoners." "Give no quarter." Such expressions are not the mere workings of an individual's maind, but are the sentiments of a nation expressed through its chief executive. It is true, too, that Germany is the greatest obstacle to the policy of limitation of armaments and obligatory arbitration. It was with great difficulty that the German government was per-suaded to consent to the establishment of the permanent Court of Arbitration. She opposed nearly every policy advocated by England. She held strict views of belligerant rights and voted against every specific proposal of obligatory arbitration. The Germans have rejected the advances since made by the English to enter upon an Anglo-German understanding concern-ing the cost and extent of their naval programs, claiming that no formal proposal has been made and therefore no official transac-tions have followed. Since Germany was not in harmony with the proposals of the Hague Conference, there seems to be but one remedy to check the steadily growing martial spirit of the sturdy Germans, namely, an alliance between the two greatest branches of the Anglo-Saxon race, England and America. Unless some such alliance is formed, the law of "the survival of the fittest" will be the outcome; of which the fittest is the strongest, the best or-ganized, and the most unscrupulous. A NARROW ESCAPE. R. L. MCNALLY, '13. JHNEAKEY was feeling blue that night as we sat together in the lobby of The Eoyal. He awaiting the arrival of a certain well-padded person, whom he pleased to call his victim,—and very impressibly informed me would be his last one,—while I was trying to pass away the night of idleness. Sneakey started to tell me all about his intended re- THE MERCURY. 17 form, and was in the midst of a "profound resolve" with his fist in the air intending to bring it down on the handle of my chair, when the arrival of a ponderous white steam car arrested his at-tention and without a sign or signal he arose from where he sat walked over to the door where the fat and hearty autoist would have to enter. Only once did he glance back at me, and then very quickly. I thought 1 noticed a shade of distress in that glance, but dismissed the thought of the fact that Sneakey, above all, would ever shrink from a job. Sneakey followed this particular individual over to the desk and watched him register, lighting a cigarette in a cool and un-interested fashion, but carefully noticing in his mind the rooms to be occupied by this person. He didn't return to where I was sitting, a very wise thing on his part, but strolled over to the bil-liard room, where fifteen minutes later, I found him actively en-gaged in a game with a stately looking, shifting-eyed sport. I walked on through and out on the street, took a car, and was soon in my room snugly seated in my large chair, planning, and thinking I had spotted a large elegantly finished mansion across the park, occupied solely by an old gentleman of eccentric habits. his brother, two house maids, and a general utility man. Next morning after breakfast I strolled across the park to in-vestigate my intended loot and map out a course that would be sure to bring me safely to my goal. I bought a paper afterwards and nothing could be printed clearer, nor more prominent to me than the little three-lined announcement that Sneakey, the one and only friend I had to depend upon, had been intercepted in an attempt to enter the rooms of a wealthy guest and was being held for trial. Of all the news, this was the most distressing. But what could I do but accept it as a present from our dreaded enemies, the plain clothes men. I did not know what to do for tools, and to attempt such a task alone would be almost fool-hardy, and Sneakey's presence was an excellent solution to both of these quanderies. But, since he was taken into the strong arms of the police, I could do nothing else than depend on luck. It was now 10.30 A. M., and I thought I might run across an old acquaintance, but there was none I could think of, let alone trust as an accomplice. After dinner I made a list of what I t^^^m^^^m 18 THE MERCURY. was in need of and among the things I needed most was a pair of wire nippers in case I would need them. Now I knew that Sneakey had a pair so I walked over to his room, having to pass the seat of my night's work, and picked the lock. Hanging across the back of a chair was a coat made up with the lining of a smoking jacket. I quickly realized its value and took it over to a tailor's and ordered it pressed, and put into proper shape. In the pocket of this coat I found a cigar which I took as a charm for my safety because I found it in the pocket of the most valuable tool I could have possibly came across. Placing the cigar carefully in my pocket the next thing to do was to get a mate at all hazzards. Scotty kept a rather notable pool room where I had been in the habit of spending some time and where I knew I could find a collection of choicest men of my profession. On entering I could hardly believe myself when who should step up and shake my hand but Harry Musser. I hadn't seen him for years, and why, I'm sure, is not because he had fallen into the same ill luck as Sneakey. I told him all of my plans and asked him to go along and help "cinch it," but woe for my hopes; he had a job on hand at White Flains, and was leaving that night on the 11.30 boat to ge to White Plains about 2 A. M., and be safe from all view to carry out his aim. Well, this was the last hope, and I decided to go alone. I saw Harry off and returning to my room put on the coat nicely tailored, and walked across the park and on around to the rear entrance of this house. Just as I entered the hedge I heard West Hall Hedge clock strike one. Walking up to the porch I started operations by climbing the vine, since I had to dispense with Sneakey's excellent tact of pitching a rope ladder. Gaining the level of the window sill I swung across and caught hold of the sill and hung suspended until I could grasp the shutter and pull myself up so that I could place my foot against the opposite side of the window frame and gradually work myself up inch by inch until I was standing on the sill holding on to the shutters. I was starting to work on the win-dow when I heard somebody walking on the pavement. When he got opposite the place where I was he stopped, lit a cigar and gazing aimlessly about, turned his steps and walked up the gravel walk and sat down on the porch almost under me and smoked. THE MERCURY. 19 After about fifteen minutes I did not see or hear him stir, and concluded he was asleep. Much was my chagrin when I found the window pulled up tight against the upper frame. To get in was almost impossible, and to get back to where I came from, was impossible. I had to decide some way. I knew that it would be safer to get out through the house than to get past that night watchman below, so taking a small finger-nail clip from my pocket, I dig two crescent shaped holes in the window frame, and placing my fingers in them bent all my effort toward pulling it down. It yielded, and carefully lowering it, I climbed in, down on the floor and I thought noislessly over to view my room in general, when all of a sudden, the lights were turned on brightly and a small buz sounded on the wall which I knew was a signal. Then locating the door, I made for it, but was barred by a huge porpous of a man whom I concluded was the butler. I had to pass him to liberty, and being much smaller, knew a struggle would be useless. I waited until he charged, then side-stepping I gave him a lucky stroke in the stomach. He wasn't long in the fight. Throwing my hat in a corner, I ran my fingers through my hair, put the coat inside out, the cigar in my mouth, ran down to the front door, to escape, preparing lest the police should arrive before I got away. Two officers were coming down the pavement at a good speed. I did not know what to do in so-tight a place. I decided to use strategy, so assuming a horrified expression, I called to them that here was the place, and ex-plained that the old gentleman had became suddenly worse, and that I was sent by him to bring his son, who lived some distance-from the house. That story wasn't believed in full by them, and! they decided to go along with me to bring his son. The two fol-lowed me for a square, and then stopping, I reasoned that two of them should go back to the old man, and assist the butler in car-ing for him, while the other officer and I went for the son. To this they agreed, and we two sped, where, I did not know until, reaching into the pocket of this coat, my hand fell upon the wire nippers. I just happened to think of Sneakey. I knew he wouldn't be in his room so I made a short cut there and pound-ing on the door received no reply, until a doctor next door put his head outside the door and informed us that that gentleman mi^^^^^^^^^^^^mwg^^^^^^^^^^^^^m 20 THE MEECUET. had left yesterday morning and had not returned yet. Now I knew to go along back to the house would mean my arrest so I told the officer that he should go on back to assist the other officer and the butler, while I awaited until this doctor would dress and go along with me, that we would follow in a few moments. When the officer left, I feigning that I intended to wait, followed after him down to the street level and proceded over by a back street to my rooms. Next day I learned of Sneakey's sentence of two years and went around, packed up his furniture to store it. In the pro-cess of this packing I was assisted by this doctor who told me of the very strange call he had last night. THE "BACK HOME" BOY. EDWIK C. HOBBOW, '12. EE we, the great American people, interested in the farmer boy? "We are. Why should the attention of the richest, most commercial nation of the earth turn to the humble youth of sunburnt face and freckled nose "back home ?" There are several conspiring reasons which cause the lines of national interest to deflect from their normal course toward that obscure spot on the map where is growing to man-hood the average country boy. One of the first reasons, perhaps, is to be found in the fact that he is "the boy back home." Somebody has said, "God made the country, but man made the town." Well, what man made the town? It was the man from the country; and it is the man from the country who is making the town grow and prosper to-day. It is from the hay-field rather than from the gutter; from the garden rather than from the crowded quarters of the town, that men are being drafted to fight the great battle of the world's market place and public halls. The bulk of brains, the brawn, and the character of this country has come from the country; and from the country will come at least many of our big men of the succeeding gen-eration. THE MERCURY. 21 The country boy is running America to-day; his name is legion. Abraham Lincoln, the greatest monument in American history, has established a standard of idealism for all American frontier boys. President Eoosevelt was a western rancher. William Jennings Bryan, who, despite conflicting views and re-gardless of politics, is an international character, wears overalls on his Nebraska farm. Anthony Comstock, one of the greatest and best moral forces in America to-day, came from a New Eng-land farm. Homer Davenport, one of the best known political cartoonists in the country, grew up on a far western farm. And so the list may continue down along the directory of the "Who is Who"—including United States senators, merchant princes, economic, scientific and philosophic authorities; light of the bar and pulpit; writers, artists and musicians; there is no seat of the mighty where the farmer boy has not sat. If there is anybody in this whole country of ours who is a free citizen, it is the country boy. He is as free as everything about him,—the air, the sunshine, the birds, the snow. Out here in God's own country, a boy can not help growing to manhood brave and strong and clear-minded. Simple taste, simple appe-tites, a simple home, these are a wholesome curriculum for a boy's individual education. Plain food, regular hours, and plenty of healthful exercise,—these create a strong body, the only fit setting for a strong mind. The farmer boy grows up away from the atmosphere of riotous vice. He is not bred in the shadow of corporate domination and "higher ups;" he recognizes no "higher up" in this world than his Father. He is imbued with the faith that a man who dares can, and that a man who can should. He has confidence in himself, and belief in his future. That is what we by times call by one of several names: Energy, backbone, enterprise, jasm, initiative, perseverance, grit, gump-. tion. Whatever it is, it is a winnig quality,—it is power. The thoughtful men are realizing this to-day as they never-did before. Employers know it and want young men from the country; educators feel it and rejoice over the country bred scholar. The voter knows it; and the politician knows that he knows it, with the result that we get in office to-day some honest and fearless men, who stand for the best in American polities,, though tied until almost powerless. 22 THE MERCURY. It is no disgrace to have come from the country, and the boy from the country need not be afraid to apply for a job. His record is good, and nothing need stand between him and success. THE EVOLUTION OF THE BEAST. EDWARD N. FRYE, '10. |OWJST from the mountains came two beasts into a plain upon which grew a few blades of grass; they stood facing each other with snarls. Finally the battle be-gan to rage as to which should get those few blades. It became a life and death struggle, and the turmoil was great. It was a case of the survival of the fittest. The strong one con-quered and the grass was his. The other lay in the dust and gore with his life slowly ebbing away. Thus as I look out over this great country and see the strug-gle of man for life, for liberty and for progress, and then think that he is called beast and materialist, I am reminded of the story of the beasts. The charge is not wholly untrue. Man is a materialist, but a materialist by necessity, a materialist because he is a creature of society and society is warring to keep him bound. His materialism is a bread and butter problem. His materialisms are the necessities of life, nourishment of the body and a life with its comforts. The problem is how shall he pro-cure those necessities upon which his life depends, and how can he add to his daily life those comforts. These are the foremost thoughts in his mind. His hunger must be satisfied and his body clothed, likewise he must care for his wife and his children. Of course he is a materialist and what else could he be. What would give him existence? Surely not spiritualism. The life of man is made up of more or less materialistic wants. And he has been called a materialist because he is forced to center all thought on these wants. He has been called a materialist be-cause he is demanding that which by right is his and which so-ciety will not grant. He has been called a materialist because the other big beast, capitalism, is contending with him for the THE MERCURY. 23 last blade of grass. He is being driven to the very brink of de-spair with only one thought: "How can I live," and with one problem to solve: "How can I procure bread and butter." He is forced further and further to the point of starvation and still that mighty hand reaches out to grasp more from his little to swell its fortune or fill its coffers. Thus the working man is forced to lift up his voice and cry for his rights when the Ameri-can aristocracy consider him nothing more than a machine to further their interests. Whentheworkingman is reduced to a thing he becomes a materialist by necessity. He cannot lie back on the oars and pray that the Almighty God may give him bread, for then he would starve. He is therefore compelled to concentrate his energy, to rise up against such conditions and let his voice be, heard in order that he may receive that which by divine right is his. Then only when he receives that right can he turn his at-tention to the other phase of life, the spiritual side. To bring this about there must be an evolution of social condi-tions, not a revolution as the one who stands without the turmoil describes. The working man must rise up out of his present condition and let it be known that he is not a mere beast for the purpose of serving capitalistic interests and when of no more use to be turned off to starve or to be an object of charity. The capitalist, who is the real materialist, and in a sense a pragma-tist, must realize that the so-called brute is his social brother, born with all the privileges of a human being and with a soul that is equally precious in the sight of God. The capitalist must recognize that life is not a mere dream for the other fellow, but that it is a reality demanding a certain share of this world's goods to make it a joy and to prepare that soul for its rightful inheritance. This will take place when he ceases to say of his social brother: "Beast, beast," and in turn shows him his love. If the capitalist would change his perspective what a change would surely be in human affairs and in human lives. How much strife would be eliminated and how much deeper would be the spiritual life. Then man could think more seriously of things that are spiritual. The stomach of the working man would be filled and his physical wants attended to. You must satisfy those physical wants before you can hope to have him seek the wants of the soul or to develop him spiritually. 24 THE MERCURY. THE SPIRIT OF THE PLACE. HARVEY S. HOSHOUR, '10. S the autumn twilight closed in upon the old Thomaaton campus, so fraught with traditions and memories of a century's existence, there seemed to be an element of discontent, quite foreign to the place indeed, which per-meated everyone. Grant Hilsey, if the conversations which were conducted in low tones throughout the quadrangle were correct, the cause of all this discord, was throwing off his football togs in a room luxuriously furnished in every appointment. He then took a quick shower and dressed thoughtfully. Yes he was right. Something would happen tonight. Something must happen. What should he do ? Should he go to the mass-meeting or stay in his room? What was best for the college? All these ques-tions played havoc in Hilsey's mind while he was dressing and while he ate a late supper at the training table: The old chapel on the hill was that night the scene of the largest mass meeting Thomaston had ever known. Tomorrow-was the day for the "big" game with Greenvale, and the slogan of the meeting was, "Thomaston expects every man to do his duty." After speeches short and to the point by various mem-bers of the faculty, the 'Varsity men were called for one by one, and responded with short talks, promising their best efforts on the morrow. "What's the matter with Captain Hilsey?" shouted the cheer leader. The answer was an irresolute, "He's all right," amid a hubbub of hisses and jeers. The cheer leader looked aghast. "Let's see him. We want Hilsey," clamored the crowd, seem-ingly ashamed of its first action. Every one turned to the rear whence they expected Hilsey to come but there was no answer. Hilsey was not there. The captain had come into the meeting late and had sat in the rear, listening to his men as they spoke. He, too, would do his best to win. How could he lose, leading men with such spirit? Then came the jeers. He had known they must come, but he could not check the hot tears that kept swelling to his eyes. There was still one chance. He was in the rear seat and had not THE MERCURY. 25 been noticed in the excitement of the evening. H suited his ac-tion to the thought, and when the crowd turned to look for him, he had gone forth, unseen and alone. The leader shook his megaphone for silence and said in a voice that quivered just a bit, for he was a friend of the captain, "Pel-lows, tonight we have insulted one of the best captains Thomas-ton has ever known. He has picked the team with the best in-terests of the college at heart, regardless of what his enemies may say. For four years we have seen Grant Hilsey fighting for Thomaston honor. Where is the man who ever saw him betray the college. We have elected him captain, and upon him our hopes of beating Greenvale depend, and yet we hear criticisms, "improvements," and even jeers on the eve of our gratest game. It's mighty fortunate he isn't here to see this, for you know the Hilsey pride and its hard to tell what any one of us wouldn't do under his circumstances. Now fellows, lets make it so he can hear it. "What's the matter with Hilsey?" "He's all right," came back witht the roar of thunder. The dissatisfaction over the picking of the team and the captain himself seemed to be go-ing fast. "Who's all right?" Hilsey," re-echoed the crowd. "We want Hilsey," they yelled, but none appeared. The leader again motioned for silence. "Boys," he said, "one more rick-etyax for Captain Hilsey." The yell was given with a lust. All feeling was gone now in the spirit of the place which gripped every man in a way which was irresistible. With a "last long ray for the 'Varsity," the most successful mass meeting Thomas-ton had ever seen was over. When Grant Hilsey emerged from the building all seemed a confused mass. He had been publicly insulted and even jeered at. Last year, after the season which had ended by "sweeping Greenvale off the face of the earth," as the Thomastonian had it, he had been the hero of the college. He had made the run that had won for his Alma Mater, and it was quite natural that Hil-sey should be elected captain of next year's eleven. The election had been unanimous. He had come back this fall eager to pro-duce another victorious team, but the material was new and hard to get into shape. He had done his best, fairly and squarely, with the result that his associates characterized him as a deserter, for he had not chosen the, team entirely from his own "clique." 26 THE MERCURY. He was too fair for that. He was also criticized by that class of students—all too common everywhere—whose chief concern it is to kick, who are too good for everybody, yet whom nobody wants, and who still, somehow or other, exercise an influence,—probably only due to their persistency,—on every college community. The result was that Hilsey had become the most unpopular man in the college. As he walked through the campus he had grown to love, his mind was crowded to overflowing. What should he do? The Hilsey pride asserted itself. He would show them. No Hilsey could be played with in this manner. They had said that his team was "crooked." Let them improve on it. They would see that they couldn't do without Grant Hil-sey. Eevenge would be his and sweet would be his revenge. Instead of going to his room Hilsey went across the campus to his fraternity house. It too was deserted. He would send for his trunk after the game. As he sat musing on the porch the old walls loomed up before him. How he longed to graduate. But he was a Hilsey and a Hilsey never gave in. What did he care for the place anyhow? There were surely others just as good. The night train for Watauga was almost empty that night. All traffic was turned toward Thomaston for the morrow's big game. It was too late for Hilsey to go home when the train got in, so he resolved to stop at the hotel till the next day. Through-out the night and the morning his mind was in one vast whirl. He would wait till evening before going home. He remembered that all his people were at Thomaston to see the game. Some-how or other he felt that he was shirking something. Maybe he ought to go back to Thomaston even though his fellows had de-serted him. What did these unworthy sons have to do with old Thomaston anyhow ? He remembered a little essay of his on college spirit, on which he had been complimented highly. He was a Freshman then. He remembered the past three years, their ups and downs, their fortunes and misfortunes. Yes, they were happy years, all too happy but they were gone for good now. The Hilsey pride had shown itself. But that essay on college spirit kept forcing itself into his mind. That was theory he knew, rather sentimental at that. Was there such a thing at Thomaston as real live college THE MERCUKY. 27 spirit? He had done his best but did he have the spirit which could endure all for the sake of the college. Anything but gibes, he thought. But what else had he endured. He had failed at the first trial. He was a failure, a quitter, and Thomaston had expected every man to do his duty. Again the college walls loomed up in his mind. Yes, he loved them, he loved their •every stone, he loved their traditions and their lore. He looked at his watch. Could he make it? The Thomaston spirit asserted itself. He signalled a passing car, which he recognized as one of his father's. "Fast as you can to Thomaston," were his orders. It was a long ride but never for an instant did Hilsey's intentions change. There was such a thing as college spirit, Thomaston spirit. He was completely in its spell. As the car neared the campus he heard the cheer leader call, "Now then Thomaston." It thrilled his very heart. That was Thomaston, his Thomaston. "To my room," he fairly yelled to the chauffeur. The campus was de-serted. Over the green hedge which surrounded the athletic field, he could see a mass of crimson and gold. That meant Thomaston, the Thomaston he longed to fight for. It was the work of a few minutes to jump into his togs. Never was he so proud of the hugh "T" on his sweater. To think that he was so near forfeiting the privilege of wearing it. As he neared the field he heard a count—one-two-three—and then a long drawn out —nothing, all from the opposing side. His heart gave a throb. There was a chance yet. He flung off his sweater. He would show them that the Hil-sey pride was swallowed up in his college spirit. A great shout arose as the wearers of the crimson and gold saw Hilsey. They forgot enmities. He, their only hope, had come back to make them win. His judgment had been vindicated for his team had played wonderfully, and, but for a beautiful kick would have held Greenvale to no score. "Ten minutes to play," announced the time-keeper as Hilsey took his place at quarter. The team had been holding well be-fore. Now with a leader they played an aggressive game. Slowly they marched up the gridiron. Once they lost the ball, only to regain it on downs. Thomaston enthusiasm knew no bounds. There were no spectacular runs, ten yards being the greatest 28 THE MERCURY. single gain. With one minute to play a touch-down was made and the goal kicked. "What's the matter with Hilsey?" again shouted the leader. Never was such a yell heard as when they cried, "He's all right." The game was over. Again the colors of Thomaston flew high. Hilsey was late for supper again that evening. The sun was setting beyond the chapel hill with a blaze of crimson and gold, which seemed to him to be in honor of Thomaston's victory, his victory. The old chapel looked dearer than ever. In a few short months he would receive his diploma there. "It's the spirit of the place," he murmured as a crowd of students came down the street, wood in one hand and oil cans in the other. "There he is now. We want Hilsey," they cried." Yes," he muttered, as he was being hoisted upon the shoulders of his ad-miring fellows, "its the spirit of the place, the college spirit, the Thomaston spirit." I H E HE RCU RV Entered at the Postoffi.ee at Gettysburg as second-class Matter. VOL. XVII GETTYSBURG, PA., NOVEMBER, 1909 No. 6 Editor in-Chief SAMUEL FAUSOLD, 'IO. Exchange Editor G. E. BOWERSOX, 'io Business Manager PAUL S. MILLER, 'IO Ass't Bus. Managers C. M. ALLABACH,'ii S. T. BAKER, 'II Assistant Editor RALPH E. RUDISILL, 'IO Associate Editors E. J. BOWMAN, 'II C. M. DAVIS, 'II Advisory Board PROF. G. F. SANDERS, A. M. PROF. P. M. BIKLE, FH. D. PROF. C. J. GRIMM, PH. D. Published each month, from October to June inclusive, by the joint literary Societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance ; single copies IS cents. Notice to discontinue sending THE MERCURY to any address must be ac-companied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. fore, his duty to cultivate it. THE CONYERSA- What a world TIONALIST. of meaning this word contains! What a flood of memories it brings to us! Un-consciously there leaps to the im-agination the pictures of talkers who have given us many a pleas-ant hour. The human voice is probably man's greatest gift. It is his dis-tinguishing feature. It is, there- Indeed this should be his ambi- ^■■■^^^■H 30 THE MEECUEY. tion: to be affable, clear, optimistic and pleasant; to develop a ready wit and the happy accomplishment of speaking the right word at the right time. Indeed to keep silent always is as great a fault as constant babbling. Franklin expressed the idea as follows: "As we must account for every idle word, so we must for every idle silence. Conversation is not a wooden thing; it is elastic, happy and free; it runs, hops and skips. Indeed man's greatest asset is speech and harmonious conversation between two or more should be made the supreme pleasure of life. Conversation costs us nothing in dollars and cents; it com-pletes our education; discovers friends for us and can be enjoyed at all times and in all places. Although conversation is common to all ages, we believe the golden age of youth makes most of it. The young man or woman—particularly the college man or woman—uses the gift of speech to give expression to the bright-est hopes for the future. The collegian, in fact, lives in the fuT ture and oh! what a loss it would be to him to be deprived of the pleasure of building castles in the air. Talk is the great instrument of friendship. By it as Steven-son says, "Men and women contend for each other in the lists of love like rival mesmerists. By it friends can measure strength and enjoy that amicable counter-assertion of personality which is the gauge of relations and the sport of life." Conversation generally drifts to the two great subjects, "You and I." Of course the third party may be given passing consid-eration but vain humanity can not long escape the subjective. This fact is quite noticeable in the chat of two college chums. It invariably has to with the welfare of the speakers directly or in-directly. This being the case the conversationalist should be careful to clothe his old subjects in new garments and to bring them forth from the mint, as it were, with new and ever delight-ful aspects. Yes, let us continue to talk! Let us enjoy our talks, but let us seek to find more and more ways to benefit from them. THE American business world is a rapidly flowing river. To get into this rapidly moving stream, man must hustle and not be slothful. The competitions of modern life have become so keen THE MERCURY. 31 that there are no opportunities for the lazy. Man must either work or go to the wall. In every community this fact is under-stood but too often not believed. Should not these student days be hours of industry and benefit ? Many a night is spent in folly and the following day suffers. The only real and lasting enjoy-ment in life is to be found in work. Everything which man creates decays when neglected, but nothing in nature goes to pieces so fast as man in idleness. The conditions of all our faculties and enjoyments are found in the full exercise of all our powers to the limit of their capacity. There are examples of college men ad inflnitissium whose voice touches no sympathetic chord in the activities of to-day. Their thoughts never got beyond college politics and rivalries of secret societies. They have always been idlers and now are hopeless failures. As in the lower life the busy bees have no room for the drone, so in a college community the diligent students have no room for the dilatory. Let us conscientiously answer the ever-present question would our parents approve of their money's time and benefit ? and give tireless attention to our own work and advancement and when the commencement clock strikes we shall all be ready for our liberal professions. EXCHANGES. | GAIN it becomes our pleasant duty to examine and com-ment on our exchanges. We are gratified to see so many of the former papers again appear this year; as well as many new ones. A few of the former ex-changes have not yet made their appearance, but we trust it is only a matter of a short time until we shall again have the pleas-ure of receiving them. The matter of criticism is quite a relative one; some papers choose to tear every thread of good out of productions by hostile criticism; others are too apt in praising. It has always been our custom to act the part of appreciative critics in dealing with our friends. Of course there is often a necessity to make the harsher 32 THE MERCURY. kind of criticism, but in so doing we shall always do it with a friendly spirit and trust no offense is taken. Of the few exchanges to reach our hands this year one of the best is "The Gilford Collegian;" its departments are all well ordered and literary contributions are of a high order. The ora-tion, "The Solid South," is a very pertinent production; it deals in a broad and sensible manner with the reasons of southern solidity and shows how the causes for it no longer exist and that the idea belonging to a past time should be relegated to its pro-per place by the thoughtful citizens. The story, "The Heart of a Woman," in the same issue is very clearly written and not only causes much amusement but some serious thought. The October issue of "The College Student" is filled with well written articles. "The Crime of the Congo" and "The Crucible of Life" show much preparation and skillful arrangement of material. "We gratefully acknowledge all exchanges received. PATRONIZE OUR ADVERTISERS. IN this Drama of Four Year's Course, Play your part without dad's horse ; This to do is up to you With just a little tact between each yearly act, In some domain take a stroll And sell ALUMINUM for next year's Role (roll). Every summer hundreds of students make BIG MONEY selling Aluminum Cooking Utensils. For particulars address LOUIS HETZEL, Gettysburg College, GETTYSBURG, PA. THE STEWART & STEEN CO., COLLEGE ENGRAVERS, 1024 Arch Street, PHILADELPHIA. MAKERS OF INVITATIONS, PROGRAMS, MENUS, VISITING CARDS, DANCE CARDS, MONOGRAMS, CLASS AND FRATERNITY STATIONERY. P. S. MILLER, '10, Representative, Who has a full line of samples. EDUCATION The times an .1 the Schools demand that the best things shall be done and in the best manner. Watermans^FountainPen accomplishes everything that can be required of a good writing in-strument. Made to last for years of service and give its owner the satisfaction which comes with owning "the best." From all dealers. The Globe trade-mark i» our guarantee .742 Market St. San Frm 136 St. Jftinei St., Moi.trenl 12 Golden L*n«. ton-ton G Ru« A* lUnovm Paris PATRONIZE OUR ADVERTISERS. FUIOTTU^E Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. - Telephone No. 97. H. B. BENDER. 37 Baltimore Street, Gettysburg, Pa. EDGAR C. TAWNEY BAKER West Middle Street. J. B. WINEMAN, DEALER IN CHOICE FAMILY GROCERIES, PROVISIONS AND FRUITS, BOARDING CLUBS A SPECIALTY. L. WEIGAND, DEALER IN FRESH AND CURED MEATS OF ALL KINDS-Boarding Clubs a Specialty. §003^5 f^e5tQUPQDt, No. 7 Chambersburg Street. PATRONIZE OUR ADVERTISERS. EMIL ZOTHE, College Emblems, Engraver, Designer and Manufacturing Jeweler, 722 Chestnut St., Phil delphia. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through G. F. Kieffer. Charles S. Mumper, DEALER IN FURNITURE, PICTURE FRAMES OF ALL SORTS REPAIR WORK DONE PROMPTLY I will also BUY or EXCHANGE any SECOND-HAND FURNITURE No. 4 Chambersburg street, Gettysburg, Pa. D. J. Swartz, DEALER IN COUNTRY PRODUCE, GROCERIES, CIGARS AND TOBACCO. GETTYSBURG. —IS— OHLER BRO.'S RESTAURANT, First National Bank Bld'g. The place to eat the best Ice Cream. QUICK LUNCH and Oysters in season. Your Photographer, If not, why not? 41 Baltimore St., Gettysburg. FLEMMING I BAIR'S LIVERY, Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrange-ments by telegram or letter. Dock Bock 257. PATRONIZE OUR ADVERTISERS. WINDSOR HOTEL, W. T. BRUBAKEB, Manager. Midway between Broad St. Station and Reading Terminal on Filbert St. A convenient and homelike place to stay while in the city shopping. An excellent restaurant where good service combines with low prices. BOOMS $1.00 PER DAY AND UP. The only moderate priced hotel of reputation and consequence in PHILADELPHIA. The Modern Steam Laundry . . OF YORK . . Offers the COLLEGE STUDENTS first-class work at Special Low Prices. E. C. STOUFFER, Local Agt. C. D. SMITH, Prop. The Baltimore Medical College Preliminary Fall Course begins September ist. Regular Winter Course begins September 20th. Liberal teaching facilities ; Modern college buildings; Comfortable lecture hall and amphitheatres ; Large and complete equipped laboratories; Capacious hospital and dispensary; Lying-in department for teaching clinical obstetrics ; Large clinics. Send for catalogue. Address DAVID STREETT, M. D., Dean, N. E. Cor. Madison St., and Linden Ave., Baltimore, Md. COMPILER IMPRINT ON JOB WORK MEANS TASTY WORK CAREFULLY DONE. MENU CARDS WINDOW" POSTERS LETTER HEADS ENVELOPES DANCE CARDS TICKETS Programs of all kinds. Everything the College Man wants in Paper and Ink. Specially designed work. Latest Effects in Paper, done in Colors along lines of College Men's Associations. Catalog and Book work. The Gettysburg Compiler will keep old and new students in touch with town and college life.

The Mercury December. 1906 HELP THOSE WHO HELP US. The Intercollegiate Bureau or Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of Caps and Gowns To Gettysburg College, Lafayette, Lehigh, Dickinson, State College, Univ. of Pennsylvania, Harvard, Yale, Princeton, Wellesley, Bryn Mawr and the others. Class Contracts a Specialty. Correct Hoods for Degrees. WHY NOT GET A POSITION NOW 1 The sooner the young graduate finds the right opportunity the bet-ter his chances for success. We offer the best means of bringing your ability to the attention of employers in all parts of the country. Are you familiar with our successful methods'? We will gladly give you without charge full information concerning desirable posi-tions that will be open in the early summer and fall for capable College. University and Technical School graduates. Better not delay about writing us for we are al-ready placing many 1B0U men. The National Organization ot ZKC-^^GrOOIDS, Brain Brokers. UPen.n.syl-va.srLia, rBld.g-., :iPis.ila,d.elpli.ia,, UPa. Ofnces in Twelve Other Cities. Come and Have a Good Shave,,, or HAIR-CUT at Harry B. Sefton's BARBER SHOP 35 Baltimore St. BARBERS' SUPPLIES A SPECIALTY. Also, choice line of fine Cigars. R. A. WONDERS Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, etc. Scott's Corner, opp. Eagle Hotel GETTYSBURG, PA. Pool Parlors in Connection. IF YOU CALL ON C. A. Bloeher, Jeuuelef*, Centre Square, He can serve you in anything you may want in REPAIRING or JEWELRY. WE RECOMMEND THESE FIRMS. Established 1867 by Allen Walton. Allen K. Walton, Pres. and Treas. Robt. J. Walton, Superintendent. Hummelstown Brown Stone Company j If £ G2TT-£>_^:Ei-3r:b/£:E3:fcT and Manufacturers of BUILDING STONE, SAWED FLAGGING, and TILE, fALTONVILLE. '" PENNA. Contractors for all kinds of cut stone work. Telegraph and Express Address, BROWNSTONE, PA. Parties visiting quarries will leave cars at Hrownstone Station, on the P. & R. R. R. For Artistic Photographs TIPTON, The Leader in Photo Fashions. Frames and Passapartouts Made to Order. ICECREAM. SODAWATEE. Telephone Call 1612. Sheads'Hijjl) Grade Confections 37-39 Chamhersburg Street, GETTYSBURG, PA. FRUITS. Restaurant Attached The Most Popular College Songs A welcome gift in any borne. The Most Popular College Songs - - * 50 New College Songs - Songs of ALL the Colleges - • Songs of the WESTERN Colleges Songs of the EASTERN Colleges SCHOOL Songs with COLLEGE Flavor - Songs of the Flag and Nation - 100 New Kindergarten Songs - New Songs for College Glee Clubs New Songs for Male Quartets - Songs of the University of Pennsylvania Songs of the University of Michigan - Songs of Washington and Jefferson College- Songs of Haverford College - New Songs and Anthems for Church Quartets, {Eleven Numbers) each .10 to .30 HINDS, NOBLE & ELDREDGE, PubUsben 31-33 35 West 15th St. New York City PATRONIZE OUR ADVERTISERS. dJIIIIIIIIIIIIIIIIIIIIIIIIMIMIIIIIIIIIMIIIIIIIillllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll^ I Seligman I I & Brehm I I Are Gettysburg's Most | Reliable | I TAILiORS I And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. 1 Give Them I | Your Patronage I lllllllllllllllMIIIIIIIIIIIIIIIIIIIIIIilllllllllllllillllllinillllllllllSlllillllllllllllllllllllllllllllllllR PATRONIZE OUR ADVERTISERS. AtM*******************************!***********1**^^ Weaver Pianos and Organs Essentially the instruments for critical and discriminating buyers. Superior in every detail of construction and superb instruments for the production of a great variety of musical effects and the finest shades of expression. Close Prices. Easy Term:. Old Instruments Exchanged. WEAVER ORGAN AND PIANO CO., MANUFACTURERS, YORK, PA., U S. A. Students' Headquarters - -FOR-HATS, SHOES . AND GENT'S FURNISHING Sole Agent for WALK-OVER SHOE Eckert's Store. Prices always right The LutheM puMication^ocietiJ No. 1424 Arch Street PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Col-leges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and devel-op one of the church institutions with pecuniary advantage to yourself. Address HENRY. S. BONER, Supt. The flDepcupy. The Literary Journal of Gettysburg College. Vol. XIV. GETTYSBURG, PA., DECEMBER 1906. No. 7 CONTENTS "THE PASSING"—Poem 182 FRANK W. MOSER, '07. " ECONOMIC EFFECTS OF PENSIONS FOR TEACHERS " —Essay 183 SAMUEL E. SMITH, '07. "OUR LIBRARIES "—Essay .188 THOMAS E. SHEARER, '07. "A MILLIONAIRE"—Story. . . 191 F. M. HARMON, '08. "POE: POET OR CHARLATAN "—Essay. . 19s W. WISSLEU HACKMAN, '08. I "THE TWENTIETH CENTURY'S DEMANDS UPON WOMAN "—Oration 201 ELSIE A. GERLACH, '07. "A MYSTERY SOLVED "—Story 204 LEVERING TYSON, '09. EDITORIALS, . . . 208 182 THE MERCURY. . THE PASSING. FRANK W. MOSER, '07. kHE pleasant Autumn days are gone, Their joys have passed away ; Girt with the legions of the North Old Boreas has issued forth To dominate the day. The pumpkins all are gathered in, The corn flags all are furled ; The trees have wept to see them go And fling their leaves like falling snow- Across the dying world. Right valiantly did Autumn strive To yield a bounteous store ; Her granaries were opened wide That lavishly from every side The golden fruit might pour. The snapping of the backlog sounds A message old yet new ; Pile up the fire and let it roar To match the winds that downward pour, The blackened fireplace through. The chestnuts crackle with delight To welcome Winter in ; But Autumn goes with face forlorn, Beat by the surly Winter's storm, A.11 pinched and wan and thin. So life will pass from morn to eve, From noontide glow to dark The cheerful voices of the day Will cease their songs and fade away ; Death kills the vital spark. • »i THE MERCURY. 183 ECONOMICAL EFFECTS OF PENSIONS FOR TEACHERS. SAMUEI, E. SMITH, 07. ASUBJECT of this nature is necessarily very broad. Teachers are of many grades. The teacher of the country school, receiving thirty-five dollars per month, or even less, marks the lowest grade. The college professor, whose compensation is five thousand dollars or more per year, may serve to establish the other margin, although only in rare in-stances is such a sum received by a professor. Between these two limits are many different classes of teachers, whose rates of wages are comparatively well defined. In the discussion of this topic our observations shall be confined, for the most part, to the highest class, college professors, since what pertains to them with reference to public pensions, is also applicable to the teachers of lower grades. Public pensions for .teachers would naturally involve a great variety of economical questions, since those instructing the youth form a large and influential element in society. In our opinion the economical effects would be both direct and indirect; direct in that they affect teachers as a class, and indirect seeing that they would undoubtedly in-fluence society in general. Beginning with the direct economical effects of pensioning teachers, it may first of all be affirmed that a better class of men would take up teaching as a profession. The degree of efficiency in the profession of teaching varies just as it does in the business world. In business the marginal factors are the day laborer and the entrepreneur; in teaching the adher-ent and advocate of a parrot-like mastery of book theories, too often antiquated, and the teacher with a personality, a thinker and one capable of stimulating thought, and yet withal severe in his demands for careful study on the part of students. To the instructor of the youth, a compelling personality is just as essential as it is to the entrepreneur. Rarely does one find a successful business man without a decided personality and yet multitudes of men, are attempting to mould young lives, who are lacking in this essential characteristic. ■ 184 THE MERCURY. Why is it that the men of power more frequently choose a business career than the noble calling, that of instructing the young ? Simply beeause the inducements are mostly on the side of the business career. The professor never receives a large salary and after his days of usefulness are over he may, as a rule, look forward to a mere pittance which he has labori-ously saved during his active service. On the other hand the successful business man looks forward to a comfortable old age made possible by the property acquired during a period when his own efforts were the only limits to his acquisition of wealth. This very difference in prospects makes the business career the more desirable as no man is desirous of spending his old age deprived of the comforts of life. In the event of teachers re-ceiving a pension, after years of faithful service, the natural horror of an old age spent in poverty would be removed. Men are ever willing to toil for a livelihood during their years of strength when a future day of comfort is in prospect, but look with fear upon that calling whose active days require a struggle which is unattended by the promise of support in the declining years. When teachers receive pensions more of the choice spirits will take up the noble work. The result will be that teachers of inferior personality and attainment will be forced into other lines of activity, and it is safe to say that the new work will be for the most part of a clerical nature. Having thus seen that the teaching force would be materially changed by the establishment of pensions, it is also worthy to note that a higher standard of living would prevail among teachers. The teacher would have more money to spend dur-ing the time of his active service. As the teachers number a small army, throughout the country, this item would be of no little importance. More books would be purchased, travel would be more extensive, there would be more and better food and clothing. Thus demand would be increased and produc-tion would naturally be increased to meet the demand. Another direct result of public pension would be the in-creasing number of teachers. For example, if a man after forty years of service should be granted a pension, he would usually be glad to retire to follow various pursuits of a literary, THE MERCURY. I85 political or social nature, pursuits which could not be noticed during the period of active service. Provided a man began teaching at the age of twenty-five he would retire at the age of sixty-five. Under the present system, many men teach until long after the age of sixtv-five. Retirement at this age would make the period of service shorter for each teacher and thus more instructors would be required. These are the direct economical results which would be brought about by the pen-sioning of teachers. However, there are yet more important considerations to be regarded, namely, the effect upon society of granting of such •pensions. These we would characterize by the term indirect. Many branches of commercial activity would be affected. The prospect of a pension, as has already been shown, would attract more and a better class of men to the profession of teaching. Consequently, men now engaged in banking and various business pursuits, whose compensation is equal or con-siderably superior to the salary of teachers, would be eager to enter the ranks of teachers as there would be the strong inducement of being provided for in old age. This same proposition would hold good for all the grades of positions in the profession. Besides, the opinion is almost univer-sally held that teaching is more honorable than a business career. The teacher has also more leisure as the summer months are completely his own. With the added advantage of a pension in old age, great numbers would turn from pur-suits essentially commercial to teaching. In order to retain the most efficient individuals in the business world wages would of necessity increase in a great many lines of business. For example certain men leaving college, would find it more to their advantage to accept an instructorship in a college or high school with the prospect of at length receiving $2,000 per year as a professor and a pension in old age, than to enter a bank with the prospect of becoming cashier at $2500 per year and no pension in old age. Again the girls who must earn their own living, would find it better to become teachers at $40, $50 or $60 per month and receive a pension in old age, than to stand behind a counter or in the telephone ex- UMUn 186 THE MERCURV. change for a compensation of $8, $10, or $12 per week, with-out prospect of a pension, and then oft times be exposed to the indecent and insulting propositions of their employers and the men with whom they are compelled to associate. Besides,, in the case of a woman, it is considered much more respect- ■ able to be a teacher than to be a saleslady, stenographer or cloak model. Without a doubt, the granting of pensions to-teachers would attract the choice spirits to that line of work and all wages in the business world would be advanced in order to keep up the required standard of efficiency. Then too, the standard, of the teaching force having been raised, as has been shown, a gradual change would be effected in the habits and ideals of the people who would receive in-struction under the better teachers. As was intimated before, in the event of pensions being granted to teachers, the change in efficiency would be largely marked by the improved person-, ality of those instructing the young. The teacher who is lack-ing in magnetism and tact is bound to present books and en-force discipline in such a way as to alienate the restless young spirit from scholarly pursuits and respect for authority. Too often the youth having experienced the ennui, pro-duced by books and theories, made possible by the bund-derings of a teacher totally lacking in personality, rushes forth into commercial life, turns his back on true knowl-, edge and culture, and strives only for the dollar. To this man gratification of the senses is the only form of pleasure. He lives a selfish life, ever seeking to take advantage of his fellow-men. He amasses great wealth at the expense of his neigh-bors. Better teachers, especially those with high ideals and a compelling personality would in time help materially to correct this selfish spirit. The young would be taught to respect scholarship and finally to love it. The youth, with a virile mind directing his training, would eventually see that mere money is not the goal to be attained, but that the acquisition of wealth in order to help one's fellowmen is the summum bonum. The young, thus having been inspired with higher ideals would gradually change social and economical conditions in a decided manner. THE MERCURY. I87 However, in another way the granting of pensions would affect society in general. A pension having been granted, after a number of years of service, would surely retire many men, comparatively vigorous in body and mind. Men of this class would naturally take an interest in the social and politi-cal life of the community in which they reside. Having both time and money at their disposal and being filled with high ideals, they would undoubtedly be a power in their community. First there would be a moral uplift but eventually material conditions would be changed. The retired educators would be as a leaven in the social mass. For example, reading cir-cles and culture clubs would be more popular than the gather-ings for playing bridge whist. This would soon have its ef-fects on the manner of dress and the nature of amusements, both of which have to do with the wants of the people. Thus a change in economical conditions. In this brief manner we have endeavored to show the direct and indirect economical effects, which would arise from the pensioning of teachers. However, since no extensive experi-ments have been tried along these lines, most of the discussion relative to this subject is theoretical. It is to be hoped that the next few decades will afford practical examples of pensions for teachers so that the truth or falsity of present conjectures may be demonstrated. i88 THE MERCURY. OUR LIBRARIES. THOMAS E. SHEARER, '07. THE time is now ripe, it seems, to set forth the belief that our libraries would fulfiill their purpose with greater effi-ciency and more satisfaction to all parties concerned, if they were united and systematized under a single index. This idea of a unified library is undergoing some agitation at the pres-ent time, and if this article in anyway increases that agitation and helps to bring about the desired result its purpose shall have been accomplished. Libraries have existed from the remotest times of antiquity. Ever since man was first able to put his thoughts into writing of any form, whether on papyrus, stones, tiles, or paper there have been books and consequently libraries. All our great modern libraries—and particularly is it true of college libraries —are established and maintained for the purpose of research in all the branches of knowledge. In order that a library may effectively fulfill this great purpose, it must be exhaustive, i. e., it must contain all the works necessary for research work in any branch of knowledge. Our present system of libraries is not the best possible for us under the present circumstances. There is too much wasted energy in it. In our three libraries we have a total of about thirty thousand volumes. Of the eighteen thousand volumes of the College Library over one-third are government reports and records of one kind or another—works distinctively of a referential character ; and of each of the societies six thou-sand volumes, practically one fourth are magazine vohimes. Now do not misunderstand this. It is not meant that these books could at all be dispensed with. Far from it. No college library would be at all complete without them. But these volumes are not used very much. These divisions are made merely to get an estimate of what we may call our working library. Therefore, estimating about twelve thousand volumes in College Library and four thousand five hundred in each of the Society Libraries, that are of such a character as to be put into regular use, we have at most twenty-one thousand volumes THE MERCURY. 189 in our working library. This number includes all encyclope-dias, hir.tories, gazetteers, etc., and all other works of reference, with the exception of, as has been noted, government reports, records, and bound magazines. Now, if we had this many different books we would be very well off indeed, but we find a very great number of the same books in all three libraries. For example, among the encyclo-pedias in College Library are: Chambers, The Edinburg, Penny's, The New American and The Americana ; all of which are found in one of the Society Libraries also, and some in both. Now this seems to be an altogether unnecessary outlay of money for such works when we have so many other good works of the same kind in College Library. But, it may be said, that these works named are all old and not up-to-date. That is true, and so much the more reason why we should not have two and three sets of them. The fact that we have more than one set of these works brings out the point that there has been little or no system or unison in the selectfon of books by the different library committees. If there had been system there would not be this useless overlapping of Encyclopedias. That this is a fault not only of the past but also of the pres-ent regulations, is shown by the fact that this overlapping is found not only in the older encyclopedias but also in other de-partments. There is in each of the three libraries the set of The British Poets, in one hundred volumes, one set of which would be sufficient for our Library. The same overlapping is seen in Biography, History and in the standard authors such as Ruskin, Carlyle, Dickens, Scott, Thackery, Cooper, Bulwer- Lytton, Irving, Emerson, Hawthorne, Holmes, and all the standard poets. This overlapping, all told, amounts to a good many hundred volumes. It is necessary to have more than one copy of some of these works, but of the vast majority of them, especially of the sets, a single copy or set is sufficient in a college of our size. It is evident from the extent of the overlapping that a change in the system of selecting our books is necessary. But what change shall we make ? Shall it be a general merger of the 190 THE MERCURY. three libraries into one, or simply a joint committee to select the books? At all events there must be cooperation. The merger idea seems to be the one in popular favor, and would, no doubt, 'solve the problem most satisfactorily. To have our libraries under a single index, systematically and logically arranged in one apartment, and in charge of a person who is acquainted with the entire library, and then to have a unified method of procuring new books, would be almost in-calculably better than the present system. But, it might be objected, that under these conditions the Literary Societies would no longer be ambitious to add a goodly number of books each year. This need not be so. Under this merger let each society put its seal in its new books but leave the numbering and shelving directions to come in under the College system. Each society could also keep a record of the books it adds to the library. In this way the societies could keep up their libraries, but merged into and subject to the College Library. Under this plan we see no reason what-ever why the societies should not continue to vie with each other in securing as many good books each year as possible, under this plan, this expensive and futile overlapping would be done away with, and a wider field of Literature, History and Science would be open to the students. But, most of this, it might be said, could be secured by the mere working of a joint committee to select the books. But that would leave the three libraries separate with their in-complete indices and would not unify matters as they should be. Although a joint committee could do good work in this matter, yet we believe that one good, exhaustive Library would be much better than three, each of which is incomplete in itself. THE MERCURY. IQI A MILLIONAIRE. F. M. HARMON, '08. THE deep-toned noon whistle on the -boiler-house called a thousand men and boys away from their work of prepar-ing "anthracite " for commercial use. The huge breaker en-gines quickly ceased their dreary roaring ; the " lokies " were side-tracked and deserted ; and in every direction hurried the tired, begrimed men to secure their dinner-pails and partake of a cold and unsatisfying lunch. Little knots of congenial spirits were soon assembled in every convenient, shad}' spot, for the sun was hot and the air sultry. Topics of local and universal interest were eagerly taken up and hotly debated. It is wonderful with what earnestness and attention these debates are entered into and listened to by these men of toil. The baseball situation in the major leagues .hav-ing been discussed at length; the protracted and intensely hot weather forcibly disapproved ; plans for the approaching na-tional holiday, the Fourth, eagerly arranged—an article on the next inter-national automobile race was read from the city paper by the breaker engineer, who was the only man around the colliery that indulged in having his paper delivered to him while at work. Immediately arose speculations as to the out-come of the race. In the ensuing discussion about automo-biles in general, a little slate picker exclaimed " Gee, it must take a heap of tin to run one of them things:" " You bet, those guys must have money to burn." Up sprang a grey-haired old man, old " Danny," the boss of the chutes, " Yes, and where do they get their money? They steal it from us workin' men, what earn it hard and then never get it! " The old man's eyes flashed and his voice quivered ■with anger—" I have worked for this company for thirty years ; I have given my best days in its service. What have I to show for it ?—a miserable job at the chutes when I might Vbeen engineer at No. 6." " Yes, but Danny, you're way off, we were talking about automobiles," I 192 1HE MERCURY. " So am I," yelled Danny, highly excited, " Look at old P , (president of the company) just last week he went an' bought one of them noisy back-kickin' machines. They say it cost him twenty thousand. Well, I say that the old miser didn't pay for that thing himself, I paid for it! " " You don't say,'' teased one of the chaingang men. " Yes I did ! though not of my own choosing. Old P has cheated me out of that much money and more since I first started to work for him over in ' Orphan's Home' gangway. Why they tell me he's got twenty million hoarded up. How-much of that did he honestly earn ? Not a cent! He stole it, every penny." " But, Danny, he inherited over five million." " Well then, his people before him stole that too. You needn't try to tell me that any man can honestly work hard enough in a life-time to pile up that much money. He's got to be crooked some place. I've worked my whole life, ever since I was a little shaver of twelve—and I did honest work, too—and to-day I'm an old man and haven't a cent stored up for a rainy-day. If I do earn a little money, they get it back again in the company store. What's he going to do with all his money anyway ? Why can't we have a share in it ? There are a few big thieves who steal up a billion dollars, and then store it away some place. If that would be given out to us who earned it and deserve it, none of us would have to work no more and we'd have plenty of grub and clothes and a little left over for the tobacco. Emitting a flow of strong language directed against all rich men in general, Danny, with an air of the sense of the injustice of the whole thing, sat down again A burly young chain-gangman, closing his emptied dinner can with a bang, began : " Danny is right; those rich old duf-fers have no right to hang on to all that money. The money in the first place come from some place in the earth ; we are all on the earth. In the second place, every man is just as-good as the next one, so no man has any call to get something more than any other man can get. You see old P strut THE MERCURY. 193 down the street in his swell clothes, smoking dollar cigars and looking as if he was the only pebble. He's got a string of race horses that bring him in a good many thousands a year. They have those races all fixed, anyhow. That's all right, for one thief to rob another thief, but who earns the money which those big suckers are stealing ? We do ! It's our money ! How could anything be done except for the working man. Suppose these old soaks had to work the way we do i I'd given a week's pay to have gotton old P on one end of that fan we carried up the west slope of the old Hollywood stripping. We'd have either broken his back or his head. There are over a thousand men working here in this colliery and those thousand are under the thumbs of one or two big bugs. Why do we let them tramp on us like this ? We could easily put them out of business and run things to suit ourselves. I know if we just had some fellow to lead us we could soon make old P .duff up." " Well, why don't you lead off, Tippey ?" " No, thanks, I am not anxious for the job ; but just the same I'm ready to follow a good leader." "Same here—So am I" "That's the cheese," and similar expressions were muttered by the listening men. Just then the warning whistle blew and the men hurried to their places of work to be ready when the engines started again. Among those who heard the discussion that noon hour was a young fellow who went to college, but who liked to spend his summers working among the laboring people. This discus-sion occupied his thoughts all afternoon and when quitting time came he was anxious to get home and find the opinion of some other person upon some of the questions brought up by the miners. The man whose opinion he sought was the cashier of one of the largest banks in the city and was noted for his knowl-edge of things in genera! and knowledge of money in particu-lar. The one question which had arisen in the youth's mind was whether the money owned by the millionaire was really hoarded up. 194 THE MERCURY. The cashier answered this question immediately and decis-ively : "No, that money, said to be owned by a single indi-vidual, is in constant circulation throughout the financial uni-verse. What difference does it make whether one man owns the million dollars or whether a hundred or a thousand men own it. A millionaire is generally a shrewd business man or he would never have acquired his possessions. So the money in his hands is made to do the greatest possible work, while in the hands of a number of people it might not be used to such wise advantage. It takes brains as well as energy to become a millionaire. Those men over there at the colliery who were today ignorantly discussing a great subject have not the mental capacity required to control and use rightly a vast fortune. I'll admit that people of great wealth very often waste their money in extravagant affairs. But is that money really lost ? No, it returns into the general circulation and remains a part of the inestimable wealth of the world. The working man does not really desire to live like a mil lionaire and even if he did have the opportunity of indulging in the little follies of the rich, he couldn't endure them long, for generations of the one plane of living have habituated him to his occupation in life and he will be out of place anywhere away from his natural work. I am no defender of the million aire in his follies, but I do believe that his money does as much good and more when manipulated by his keen business ability than if divided among people who in conceit think themselves capable of using wealth, but who in truth are in no way able to use wisely more money than seems to be their just amount. So let us not envy the rich man or be harsh in our judgment of his actions. Our manner of living is different from his and so we cannot be fair in our estimate of his conduct." !' THE MERCURY. 195 POE: POET OR CHARLATAN? W. WISSLER HACKMAN. II. AS POET. IT is not our intention to usurp the office of critic—had we even the ability—the need were lacking. It is not so much a question whether or no Poe wrote good poetry, or bad poetry, or mediocre, for he did, as, is he sincere, is he consistent with his own. declaration of faith ; are the motives and emotions he displays genuine. There is however, a deeper, a subtler, a more intangible phase to be determined which does involve a certain consideration of style. The question that confronts us at the very outset is such as would—to satisfy the hypocritical—-necessitate a del-ving to the very roots and vital bases of poetry—even more a determination of the very nature and essence of poety it-selt. To state clearly, concisely, and convincingly what POETRY is per se, is a proposition before which greater intel-lects than ours have quailed. It is therefore, with a sense of gratefulness that we may assert that for our purposes we" need go no further than the poet's own assertion in the matter— " Poetry in words is therythmical creation of beauty." Yet let us be a little clearer on this matter of poetry before we draw deductions. Just as red light, brass bands, and tri-colored draperies in-spire an exaltation of emotion by no means necessarily iden-tical with patriotism, and as the abnormal stir of passion pro-duced by the snare drums' spirited roll is not, nor should be, confounded with love of fatherland; so let us not confuse me-chanical means and effects, be they ever so admirable, with the true soul exaltation of poesy. To the majority of the public Poe appears in the single role 'of Poet. This is rather significant, for the sum of his poetry, in bulk, is comparatively slight. Yet so completely has he won the title of Poet from the masses as to have it eclipse, in a manner, the other and more extensive phases of his literary activity. I have said this was significant. And this signifi- 190 THE MERCURY. cance will be apparent when we turn to the poet's own words, " With me poetry has been, not a purpose, but a passion." * If anywhere Poe is sincere it must be in his poems. All through his career " Poet" was the one goal of his ambition, the passionate aspiration of his being. Almost all his prose was written in the form of " pot boilers," or to wreak ven-geance or perchance malice on rivals or critics, supposed or real. Eureka alone I think may be set aside as wrought in purity and reverence; and toward poetry he maintains much the same worshipful, sincere attitude. Note his words: " Events not to be controlled have prevented me from making, at any time, any serious efforts in what [poetry,] under happier circumstances, would have been the field of my choice." f Fur-ther down ; "and. the passions [among them that of poetry] should be held in reverence: they must not—they cannot at will be excited, with an eye to paltry compensations, etc." \ That the subject of poetry powerfully appealed to Poe is evident in his own prose work. He has devoted five articles to poetry in one phase or another ; more than to any one other subject. And almost always his treatment is serious ; bitter often, carping frequently, but in the main sincere. The tenets of his poetic faith are set forth in apparent good faith, and lived up to with remarkable fidelity. Only once does his man-ner descend dangerously near to buffoonery, the concluding paragraph of his Rationale of Verse—a nasty fling at Long-fellow, for whom Poe, as a rival perhaps, had scant love. Yet even here it is an injury aimed rather at a school of writers than an evidence of irreverence to poetry. One other instance of a similar attack may be lound in his poetry proper, "The Einigma" a take sonnet which will be again noted in this article. What, then, are the principles of Poe's poetical creed ? 1st principle—"The value of the poem is in the ratio of this elevating excitement [i. e. of soul]." 2nd principle—" Beauty is the sole legitimate province of * Preface to edition of Poems in 1845. t Preface to edition of Poems in 1H45. % Italics are mine. THE MERCURY. 197 the poem."* Postulate—a POEM should not aim to satisfy intel-lect by Truth, or excite the heart by passion, but should aim to give the highest, purest, intensest pleasure. A little farther on in this same essay of his he argues forci-bly against didactic poetry. He continues all effort to teach for the sake of teaching. Truth he boldly asserts may be in-troduced merely to illucidate, to be a foil, as intended discords in music, or low comedy in Shakespeare. All, then, is subser-viant to " beauty "; " The Beautiful " is paramount in the cre-ation of POETRY. Bear in mind, however, he does not utterly banish TRUTH from the realm of poesy; he distinctly concedes that at such times as he has stipulated TRUTH may be profitably introduced. In the mechanism of his verse there are four characteristics worthy of especial attention; the refrain, alliteration, intraand interlinier rhyme, and a daring independence in material ar-rangement. Poe was a keen analyst, and consequently an able mathematician. He was fond of calculus, and both at college and West Point took high rank in mathematics. To the popu-lar mind there presents itself somewhat incongruous, a so close union between two so seemingly diametrically opposed forms of mental activity. The Poet is the very antithesis to the Mathematician, such seems the general sentiment, and to have them brought together thus rudely and unceremoniously is a shock, sudden and unprecedented, to accepted ideals. Yet is there really such incongruity ? Poe's arguments are then re-markably lucid and plausible. He not only preaches but practices. Now for a brief review of his more important poems, they fall naturally into four groups; personal, meditative, melan-cholic, abnormal or supernatural. Throughout all winds the tragic thread of hysteria, all are marked or marred by an ab-normal egotism, a morbid self interest. I have said Poe was Byronic in egotism, this is nowhere so evident as in these poems. Under the first group come his tributes to benefactors and sympathizers, the best of which is probably the one "To * Philosophy of Composition. 198 THE MERCURY. Helen,"* the worst "The Enigma." "To Hellen " was written at the age of fourteen, yet the illusive flow and exalted grandeur of this slight poem caused Lowell to exclaim in wonder, "A standard to which many in their maturity fail to approach !" The poem starts with a line of peculiar beauty, " Helen thy beauty is to me—" The second stanza ends in the magnificent couplet: '' To the glory that was Greece, And the grandeur that was Rome." Words crammed with centuries, resonant of the ages! The final stanza is evidently reminiscent of some occasion strongly impressed; the "agate lamp" lends a touch of homely reality that attests to sincerity, although it mars the atmosphere of the elevated, and otherwise classic setting. Compared to this "The Enigma" is rank doggerel, and it is a blessed relief to feel Poe so intended it. It is rather coarsely ironic, yet it is clever. It is a trick poem, an accostic hinted in the last line containing the names Anna and Lewis. Aside from this it is a mere blunt stab at the then existing popularity and abuse of the \ sonnet, in which form this same is written. To the second group belong a larger part of Poe's poems. Foremost: are " A Dream Within a Dream," " The Coliseum," " Silence," " Dreams," " Romance." Of these " The Coliseum " is in my judgment the noblest. The sustained loftiness, the classic stateliness of its measures, is happily free from the blem-ishes of ill-timed commonplaces which so often mar his other poems. The second stanza is an invocation ; sombre and sonorous. Note the slow, stately sweep of the feet like the measured tread of legions. Vastness ! and Age ! and memories of Eld. Then follows a remarkable series of parallels, the final being elimacteric in its somber irony : " Here, where on golden throne the monarch lolled, Glides, specter-like, unto his marble home ; *I refer to the " To Helen " addressed to Mrs. Stanard, the mother of a school-mate, who, by her kindness, wielded a remarkable influence over the sensitive youth. Her death called forth this poem together with " The Sleeper." THE MERCURY. 199 Lit by the wan light of the ronnd moon, The swift and silent lizatd of the stones." Then the query, full of a vast regret : "These stones—alas ! these grey stones—are they all- Left ********** By the corosive Hours to Fate and me ? " And the triumphant reply : " ' Not all '—the Echoes answer me—' not all! , Prophetic sounds and loud, arise forever From us, and from all Ruin unto the wise, Not all * * * * that hang upon And cling around about us as a garment, Clothing us in a robe of more than glory.' " Of the Melancholic there are a host. In fact very few of Poe's poems are free from melancholia. Although Poe in his "Philosophy of Composition" makes melancholia an impera-tive necessity in a poet's equipment—yet I feel that Poe's poems in the main are melancholiy because they are autobiographic. They are of the soul; and that soul warped, distorted and embittered. Of these I can but note, in passing, "Ulalume " and " Tamerlane," the former mystic, the latter lucid ; they stand widely apart and yet they are akin in spirit. Tragedy, deep, vague, flows through them like a turgid, stream, livid and unwholesome. " Al ArafT" together with "Tamerlane" show marked traces of the influences of Byron and Moor, both of whom Poe intensely admired. Peculiarly redolent with Poe's own aspirations, fresh in youth, yet already tainted with the bitter edge of dissappointment, are the lines : " I wrapped myself in grandeur then And donned a visionary crown— Yet it was not that of fantasy Had thrown her mantle over me— But that, among the rabble—men, Lion ambition is chained down— And crouches to a keeper's hand— Not so in deserts where the grand— The wild—the terrible conspire With their own breath to fan his fire."* The final group- * Tamerlane. -the fantastic, the wierd, the grewsome 200 THE MERCURY. this is Poe's special sphere. The somber tragedy of " The Raven," the morbid unhumaness of " Anabell Lee," the quaint fantastic irony of " For Arnnie,"the creeping, slimy, awful still-ness ; the brazen waters, the livid sky—the silence, downpress-ing and palpable ; the noisless stir—the dull horror of " The City of the Sea," in " The Sleeper; " the human common place-ness of its former part, the growing mystery, the freedom from natural grief, the the dull repression of its latter part; the un-seemly cheerfulness grating harshly to stimulate a feeling very like repugnance; to all this the allegory of " The Haunted Palace " insistently seems to offer a clew—it is Poe's INTELLECT ! " The olden time of long ago," is his childhood and early youth—the demon haunted palace is the present;—the demon's —thoughts! How many have crept their slimy selves into dis-torted perpetuity. It is terrible to conceive of a human be-ing cursed with such a horror-breeding brain bordering on de-mentia— it is more terrible to think of a man deliberately manu-facturing in cold blood such twisting, grinny, ghoulish crea-tions. No, this is too profound—in parts, too diabolic—if you please, to pass for mere buffoonery ; it may be charlatanism in dead earnest—but to me it smells of downright magic and fellest black-art. NOTE—"The Raven," " The Bells," "Tamerlane," "Leonore" will receive fuller attention in a later article embracing these together with " Eureka " under the head of Poe's Masterpieces. The next installment will treat of Poe under the phase as Critic and Essayist. —Ed. THE MERCURY. 201 THE TWENTIETH CENTURY'S DEMANDS UPON WOMAN. ELSIE A. GERLACH, '07. BEFORE the present century dawned it was not uncom-mon to hear the mannish woman styled the twentieth century woman. Where the idea originated is not known. But it was possibly due to the fact that woman was becoming more self-reliant, was taking her place in the business world, and was entering with keen appreciation into the sports which were hers for the asking but which only men had indulged in heretofore. The last and perhaps the greatest reason was that woman was coming to the front in education, and standing on an equal plane with the men, both in our own country and Europe. In the early part of the last century the women of the West worked shoulder to shoulder with their husbands on the farm- Willingly they helped to tame the wilderness, following the plow and gathering the harvest, and bravely they faced the danger when death threatened them in the shape of wild beasts or wilder men. But alas! their willing hands often faltered under a burden too heavy for them to bear. And while these women were helping wich strenuous manual labor to build up a new life in the West, our Southern women, with innumerable slaves at their command, were living a life of ease and luxury, basking under a tropical sun. For a Southern woman of gentle birth to work was considered a disgrace. House work was forbidden, and to go out into the world to earn a living was not to be thought of. So it seemed to fall to the lot of the Northern woman to set the pace for a happy medium. Stirred to activity by the cool winds of the North, work seemed the most natural thing in the world for her. Yet it was not all work and no play which she desired. If necessity compelled her to make her living she did it willingly, and was respected for it. But at the same time she entered with zeal into the healthful out-of-door sports and exercises. She also advanced step by step toward the higher education formerly attained only by the men, until 202 THE MERCURY. to-day she stands at the zenith. Can the extent of this for-ward movement be measured? " In man there is nothing great but mind " is the familiar abhorism of Hamilton, and the men-tal endowment is received directly from the mother. Find, if you can, one man who has been truly great whose mother was not a wise woman, and now since higher education has become universal, with such a heritage from his mother the man of the twentieth century ought to achieve things inconcievable to-former generations. The Western and Southern women soon realized and ac-knowledged the superiority of the course which the Northern woman was pursuing, and to-day not only they, but the wo-men all over the world, are following her example of Sana metis in corpore sono. With such privileges granted her, what does the century de mand of woman? One thing is certain, that the present cen-tury demands far more than former centuries. The reason for this may. be that we are living in a more strenuous age and one must live faster to keep abreast of the times. The cen-tury's primal demand is that woman must be educated. No-matter in what sphere of life she may be she must be educated that she may be able to cope with the many perplexing prob-lems which arise daily. If her sphere is the home, she must be familiar with the science of cooking. If she has servants she must know how to bring out the best that is in them. She must be able to answer the questions of her children, who know more at ten than their great-grandfathers did at fifty. She must be able to be a good companion to a husband who-is alert, well balanced in business affairs, and keeping pace with the times. There is an urgent demand for the cheaper labor of woman. Many a foolish girl leaves a good home where she has all the necessities of" life, and a not a few luxuries, to enter a factory. She has, as one says, " All she needs but not all she wants." To earn a few trifling luxuries and to enjoy, a few worthless pleasures, she will forego all the joys of home life, and will go from the guiding hand of a loving mother, out into the world, into the oftimes degrading factories, with their deafening, mad- THE MERCURY. 203 dening roar, their awful monotony of work, and in many cases their dull and coarse workmen. Mrs. Van Vorst writes that a girl working by her in the factory said to her, " I'll bet you can't guess how old I am." The lady records, " I look at her. Her face and throat are wrinkled. Her hands broad and scrawney. She is tall and has short skirts. What shall be my clue ? If I judge by pleasures " Unborn " would be my an-swer. If by effort then " A thousand years." " Twenty " I hazard as a safe medium, " Fourteen " she laughs. " I don't like it at home. The kids bother me so, Mamma's people are. well to do. I'm working for my own pleasure." Is it right for a girl to throw her life away in this manner? The answer is emphatically " No." This demand ought not to be com-plied with. She ought to learn a higher aim than the mere making of money. Still worse is the case of the sweat shop, where the cheap bargain-counter goods are made. Cheap ? Yes, cheap in money value, but dearly bought at the price of the lives of women and children who are not able to demand high wages. This demand for labor ought to be prohibited by law, law closing the sweat shops. At least all good women ought to know the significance of the bargain-counters and shun them. On the other hand, and here is a puzzling question, if the century demands a place for women in the congenial business world with the men, does she find it, after all, her sphere ? When the number of women who enter the business world is increasing year by year, what will be the outcome ? Is it, after all, best ? The " Homeletic Review " gives the following sta-tistics : In 1890 about 4,000,000 women were engaged in gain-ful occupations. Ten years later they had increased 36 per cent. Relatively to men the number of women engaged in domestic and personal service actually fell off in this same time, while in trade and transportation it rose from 6 per cent, to 10. True, hundreds and thousands of women are working on an equal basis with men, equally capable and receiving equal salaries, and we would not say that it is not for woman to earn a living: far from it. It is only when the work she does unfits her for higher spheres or detracts from the gentle- 204 THE MERCURY. ness, modesty and virtue that is the true heritage of every woman. The demands of the century are many, and it would be im-possible to discuss them all. I have treated only those which are most evident. But now let us consider, finally, the demand that woman shall be effective in bringing about a higher stand-ard of living. Many specific examples might be cited, as the Hull House, in Chicago, which has accomplished a wonderful work in the elevation of the people of the slums, mentally, morally, and physically. The work of the Woman's Mission-ary Society, and their Christian Association is well known to all. The Woman's Temperance Union is often scoffed at, but along what line have we made more progress than the lessen-ing of the curse of drunkenness ? Early in the last century liquor flowed freely at the harvesting, the dances, the weddings, and even at the funerals. Although drunkenness prevails today, there has been a great reformation along this line. This im-provement is universally attributed to the influence of woman. Considering the strength of this single argument, we could boldly affirm, that the world is growing better. " God's in His Heaven, all's well with the world." A MYSTERY SOLVED. LEVERING TYSON, '09. SOON after my graduation from Yale University, my thoughts turned to inventive channels. I left my home in New Haven and moved to Kansas. On a wide, barren stretch of prairie land in the outskirts of Topeka, I built a handsome residence and near by an observatory and a laboratory. I de-voted all my spare time to astronomical researches, and the heavens ever proved a source of interest and pleasure. There were two principal inventions which I contemplated ; the first—an exceptionally powerful light, whose rays would be brilliant enough to penetrate many, many miles through any obstacle; the second—an automatic shell, which, when hurled forth into space, would gain in velocity, the greater the oppos- THE MERCURY. 205 ing force. This latter was the result of many years of hard labor and concentrated thought. It was about seventeen feet long and five wide, and was shaped like a projectile. The outer shell was so constructed of scales or plates of steel, that they regulated a motor inside the shell and thus the velocity was increased when it struck an obstruction. This huge piece of mechanism was nearing completion, and was standing on a high scaffold a short distance from my lab-oratory. Not long after this, in the dead of night, I was awak-ened by a loud, fierce, crashing, I dressed immediately and hurried downstairs. My foreman began to pound on the door furiously and, when I answered his urgent summons, said that the scaffolding which supported the automatic shell, had given 'way, and that the shell had struck the ground and begun to bore into the earth. We hurried to the scene of action and found a hole five feet in diameter, reaching down, down, down, nobody knew where. After setting men to work to ascertain the depth of the shaft, I again retired. The men worked on, lowering a cord with a lead on the end. Late in the forenoon of the next day they struck bottom four-teen and one-half miles below the surface of the earth. I then decided to find out all I could about the course of my shell and why it had finally stopped. My first step was to lower a camera with electrical appliances into the shaft. The pictures were developed and those taken at different depths showed very interesting strata formations. Those, however, which were taken at the bottom of the shaft showed nothing but light, light, nothing but light. One pe-culiarity existed in every picture—every one had a dark blur in some part. This I finally decided was my shell. I finally hit upon an idea. My powerful Xray ! The very thing ! It was nearly completed and now everything was laid aside until it should be tested and proved a success. I sent away for the most powerful telescope made to examine the path of my light. This I erected above the mouth of the shaft, and under the balcony on which it rested, were the pow-erful batteries of this wonderful light. 206 THE-MERCURY. It was ready for a trial in a few: weeks' time, and the time had come, as I thought, to solve the mystery of the light. I stationed myself just above the mouth of the shaft and turned the switch. With a tremenduous hiss, the enclosure was brilliantly illuminated with the ray. I finally lowered it and it slowly ate its way downward, seeming to devour layer after layer of rock and bed after bed of coal and other products of nature hidden beneath the earth's surface. . This continued for nearly half an hour, when suddenly my ray did not disclose anything. There was the bright beam seemingly penetrating into the depths of the earth. I ordered my foreman to turn on all power possible. He complied with my requests but all ef-forts were fruitless. That steady, glow still met my gaze at the end of my glass and there was always a small dark corner projecting into view. Again I was baffled by the strange light, at a loss as to its meaning. I returned to spend a sleep-less night, tossing from side to side in my vain efforts to solve the phenomenon. I finally dozed off, I reached a conclusion while I slept, and it seemed that in the few hours I rested, my brain was still active. I would descend the shaft. As soon as I awoke I summoned my foreman, told him my resolution and put him in full charge of constructing a huge hoisting engine and a car the exact shape of my shell. Preparations were completed in a little less than seven months, I named a day when I was to descend into the earth's depths and final arrangements were at length completed. I entered the car and began to descend slowly, down, down, down. The car was so constructed that you could see on all sides while the descent was being made. My car Was comfortably constructed and elaborately fitted out. I had a telephone at my elbow and conversed with my foreman about many matters while I slowly descended. I passed through coal beds, and stratum upon stratum of rock and sandstone. These wonders I reported to my foreman who took notes so that, if any acci-dent occurred, my venture would still be of some use to scien-tists. I finally reached the bottom of the shaft safely after a most interesting journey. THE MERCURY. 207 No sooner had I struck bottom,* than a blinding glare met my eyes. It was several moments before I could see objects distinctly. I then noticed that the light was all about me. My car was suspended in space, and was in a cavern about twenty feet above my shell, lying on its side, not injured in the least by its strenuous journey. I directed my car to be slowly lowered until it was but several inches above the shell. The light still puzzled me. My shell rested upon it, but as far as •eye could see there was that unconquerable light, that light that had baffled me so often. .1 stepped from my car to the shell, but still kept firm hold of the bottom of the car. Low-ering myself gradually I finally stood on the light. Noticing some small pieces of some substance lying at my feet I picked them up and to my astonishment found that these fragments of " light " were pure diamond. I gathered several more speci-mens of " light" and, seized with a sudden fear; again entered my car and was slowly drawn upward. The problem was deeper than before, the mystery was not yet solved. As I slowly ascended to the upper air, the revelation of the whole matter buist upon me. The earth, like most of the other planets was, in the primaeval age, part of the tail of a •comet. Her whole interior was a solid diamond and this was charred and burned by the action of the elements. The upper crust was nothing more than an accumulation of ashes during many, many stages of natural development. At last every-thing seemed plain to me. I finally reached the upper air. Closeting myself for three months I prepared a book containing my views. Naturally this created a sensation in the scientific world. After a com-mittee of college professors and noted scientists visited my works and inspected the shaft I ordered it closed by the use of dynamite. Much to my satisfaction 'my theory was finally verified. The diamonds brought from the earth's depths were bought by a syndicate of kings and remained in their possession for many centuries. THE MERCURY Entered at the Postoffice at Gettysburg as second-class Matter VOL. XIV GETTYSBURG, PA., DECEMBER, 1906 No. 7 Editor-in-chief WARD B. S. RICE, '07 Exchange Editor THOS. E. SHEARER, '07 Business Manager THOMAS A. FAUST, '07 Ass't Bus. Managers. HENRY M. BOWER, '08 H. WATSON DAVISON. 'OS Associate Editors GEO. W. KESSLER, '08 J. K. ROBB, '08 EDMUND L. MANGES, '08 Advisory Board PROF. J. A. HIMES, LITT.D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D.D. Published each month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance; single copies 15 cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Busi-ness Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. One of the Y. M. C. A. COURSE. most ed. uca-tional and cultivating features of the college year is* about to be-gin, that of the Y. M. C. A. Course. Through the manage-ment of this branch of work a course of performances has been arranged which no one who is-interested in the rareties of lite can well afford to miss. It consists of a good variety of lec-tures, musicals and recitals, given by some of the most highly THE MERCURY. 209 skilled artisans of the season. As promoters of the educa-tional and literary spirit, we would urge all, especially students, to attend these intellectual feasts. The committee in charge have gone to no little trouble, and have assumed no little-risk in scheduling these numbers, for which they deserve much credit and loyal support. The cause for which this course is promoted would alone be worthy of our aid ; but when duty is so coupled with an extraordinary privilege, it should martial an unusual support. In taking advantage of this course we not only help a good cause, but adds very* materially to our gen-eral and aesthetic knowledge. DUTY. If you are a a member of this or that activity, what are you doing? Is the activity indebted to you, or are you indebted to it? In other words : Are you doing your duty ? We are all a little inclined to shift a responsibility, if we can, and we believe that it is due to this fact that the proper spirit is lacking in some departments, especially the literary. How many of us, when asked to serve on the society program, have not said: "It doesn't suit me this week, I don't have time?" There are, no doubt, many valid excuses given, but in a num-ber of cases, is it not simply an effort to avoid the task ? How many, when asked to contribute to the monthly journal, have not said : " Oh, I can't write; " or, " I don't have the time ?'' Again there may be legitimate reasons, but many times it is merely a way of putting it off. Other instances may be cited in which we are too ready to shirk our duty. Is this not more of a habit than anything else? We are so accustomed to excusing ourselves that we often give some excuse when we consent with the next breath. Let us break away from this ; when asked to perform a reasonable task, consider it a duty and do it, unless a plausible excuse can be offered. Many ot these departments are of our own institution ; and they will succeed only in so far as they are supported by their constituents. Therefore, when asked to do a service, let us not say we do not have time—others may be as busy as we—but remember it is our duty. 2IO THE MERCURY. It is the consensus of opinion that Gettysburg has played a remarkable game this foot ball season, having lost but one game. Her success was proven not to be the result of force and brute strength, but of good coaching and a team with a capacity for being coached. It is not our intention to discuss the game as played, but to emphasize an-other factor to which we attribute much of the success ; one whose value is sometimes underestimated ; one which is very rare in the case of athletic teams, especially successful ones. It is one which is highly commendable and worthy of example. All are well aware of the fact that at most universities and colleges there are a certain number of players who are contin-ually " cutting " classes, that is not including trips and times when they are obliged to absent themselves. We are glad to say that this was not the case at Gettysburg. The intellectual was not sacrificed to the physical. It can be said with all sin-cerity that the men who represented Gettysburg on the Grid-iron this season were men who were here for an education and of no mean standing in their class work; not one of them were here especially to play foot-ball. We believe then that the success in a large measure lay in the fact that the school was represented not by mere residents, but real students; men who have the true college spirit and a deep sense of interest in their Alma Mater. This is a record to be envied; let us keep it up, the success and honor will be the greater for it. As is customary, on account of the winter vacation, there will be no January issue of the MERCURY. Lack of space prevents the publication of the usual exchange column in this issue. PATRONIZE OUR ADVERTISER'S FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. * Telephone No. 97. EE_ IB. :i3e:cLd.ez 37 Baltimore St., Gettysburg, Pa. The Windsor Hotel 1217=2 Filbert St., Philadelphia. Headquarters for Students. Thoroughly Renovated, Refurnished and Remodeled FRANK M. SCHEIBLEY, Manager. Graduate of Lafayette College 1898. A. G. Spalding & Bros. Largest Manufacturers in the World of Official Athletic Supplies Base Bali Lawn Tennis Foot Bali Archery Roque Quoits Cricket Lacrosse Golf Implements for all Sports Spalding's Official Base Ball Guide for 1906. Edited by Henry Chadwick. The most complete and up-to-date book ever published on the subject. Fully illustrated. Price 10 Cents. Spalding's Official League Ball is the adopted ball of the National League, and must be used in all match games. Every requisite for Lawn Ten-nis and Golf. For over a quarter of a century Spalding's Trade-Mark on Base Ball implements has marked the advancement in this particular sport. Spalding's Trade Mark on our Athletic Implement gives you an advantage over the other player as you have a better article, lasts longer, gives more satisfaction. Every Base Ball Manager should send at once/or a copy of Spalding's Spring and Sum-mer Catalogue—FREE. A. G. SPALDING 6 BROS. New York, Chicago, Boston, Buffalo, Washington, San Francisco, Philadelphia, Kansas City, Montreal, Canada, New Orleans, London England, Denver, Pittsburg. Cincinnati, Syracuse, St. Louis, Minneapolis, Baltimore, Hamburg, Germany PATRONIZE OUR ADVERTISERS. in's For busy people. No bother. Tills itself. Cleans itself. No dropper. Nothing to take apart. Nothing to spill. A dip in ink, a touch of thumb to nickel cres-cent and the pen is full, ready to write. AH the best dealers everywhere— Stationers, Druggists, Jewelers—handle the Conklin Pen or can supply it if you in-sist upon having it. Costs no more than other fountain pens of best grade. 100 styles and s'zes to select from shown in our catalog furnished free upon request. Any make or style of fountain pen repaired promptly. THE CONKLIN PEN CO. 514-516-518 Jefferson Ave., Toledo, Ohio. Sole Manufacturers Conklin Self-Filling Pen PATRONIZE OUR ADVERTISERS. EMIL ZOTHE COLLEGE EMBLEMS Engraver, Designer and Manufacturing Jeweler, 722 CHESTNUT STREET, PHILADELPHIA Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes All Goods ordered through F. A. Faust. .s. Dealer in E Picture Frames of All Sorts. Repair work done promptly. i^*I will also buy or exchange any second-hand, furniture 40hamberaburgSt., GETTYSBURG, PA. SEFTON & FLEMMINGS LIVERY Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrangements by telegram or letter. Lock Box 257. J. I. MUMPER. 41 Baltimore St., Gettysburg, Pa. The improvements to our Studio have proven a perfect success and we are now better prepared than ever to give you satisfactory work. Under New Management The Peoples Drug Store Invites you to visit tliem and select your needs from a fresh, new, and up-to-date stock. ■ C. WM. BEALES, Ph.G., Prop. 1). J. Swartz Country Produce ,,e!'Tn Groceries Shoes I^epaifed -BY— Cigars and Tooacco GETTYSBURG. I J. H. BAKER, 115 Baltimore St., near Court House. Good Work Guaranteed. PATRONIZE OUR ADVERTISERS. HOTEL GETTYSBURG HEADQUARTERS FOR BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES 83.00 PER DAY. Livery jPLttacrixeci. ZrPzroprietor. *pi?e

I«rt*\tmiw**$*n**t+mt*0m*m*0tmm***** PRGOHV MARCH, 1906 YOL. XIY. BTO. 1 GETTYSBURG COLLEGE GETTYSBURG, PA. I ! GETTYSBURG "NEWS" PRIWT. ■ • HELP THOSE WHO HELP US. The Intercollegiate Bureau or Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of Caps, Gowns and Hoods t" the American Colleges and Universities from the Atlan-u tic to the Pacific' Class contracts a specialty. I^i'cli .eir, bv any b"y or fir! in the re'mo e>t I anilct. or ai.y / teacher or otiiuul anyvvnere, and * prepaid firand new, complete alphabetical t atalogue^/r^.of school books at a// (i publisheri, it you mention this ad. HINDS & WOBLE -31-33-35 W\ loth St., New York City. r PATRONIZE OUR ADVERTISERS. dJIIIIIIIIIIMIIIIMIIIIIIIIIIMIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIIIIIIIIIIIIIIIIIIIILi I Scligman I I & Brehm [ I Are Gettysburg's Most | | Reliable | I TAILORS I And sbow their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. r / | Give Them J | YOUF Patronage J ^iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiMiiiiiiiiiiiiiMiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiuiir? PATRONIZE OUR ADVERTISERS. Weave** Pianos and Organs Essentially die instruments for critical and discriminating buyers. Superior in every detail of construction and superb' instruments for the production of a great variety of musical effects and the finest shades of expression. ::::( Price*. Eajv Term:. Old Isitrameats Ixehi»£ed. WEAVER ORGAN AND ?PIANO CO., MANUFACTURERS, YORK, PA., U. S. A. Students' Headquarters —FOR-HATS, SHOES AND GENT'S FURNISHING Sole Agent for WALK-OVER SHOE Eckert's Store. Prices always right The Lutheran puMicafajSocietiJ No. 1424 Arch Street PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Col-leges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and devel-op one of the church institutions with pecuniary advantage to yourself. Address HENRY. S. BONER, Supf. ' THE MERCURY. "ODE ALGERICAS CONFERENCE." H. BRUA CAMPBELL. '06. ON January 16th, 1906, at Algericas, a Spanish town of about 13000 inhabitants, six miles west of Gibralter, the opening session of the conference of the Powers with re-ference to the Moroccan question was held, and at this writing the conference is still in session, only matters of secondary im-portance having as yet been adjusted. The Moroccan affair is one that is of vital importance from an international standpoint and the questions pertaining thereto have been a matter of dispute for a number of years. Several decades ago the powers of Europe found it necessary to call a halt to the abuses that existed in Morocco, and to that end summoned a conference at Madrid in 1 880 to consider the re-forming of that country. At this conference the Powers form-ally undertook the work of improving Morocco's condition. But this convention, however, was not successful in finally ad-justing matters. Since that time France has continued to in-crease her influence and power in Moroccan affairs. At first with the tacit approval of all the powers, but lately to the great dissatisfaction of her bitter rival in colonization, Germany.— In the fall of 1905 events reached a crisis and in order to settle the discussion, the Algericas conference was called. At this conference are represented, France, Germany.United States, Austria, Italy, Great Britian, Sweden, Holland, Spain and Por-tugual. Denmark and the new kingdom of Norway refused to enter, the Austrian delegate is also acting for the Pope, who desires to present a proposition for freedom of worship in Morocco. The subjects which are now being discussed at the confer-ence are : " The organization of a police force, regulations for the surveillance and suppression of the contraband trade in arms, financial reforms, consisting chiefly in the establishment of a State bank, in the study-of the best tariff measures and in the creation of new revenues, and finally, in the fixation of certain principles designed to safeguard economic liberty."— THE MEKCURV. These in brief are the reforms which are being debated upon by the envoys, and there is not the slightest doubt but that they are badly needed in Morocco, the internal affairs of that nation approaching a loose and even chaotic condition. There-fore the question of paramount importance is, not whether these reforms mentioned shall or shall not be provided for, but who shall carry out these reforms. Let us look at the attitude of the various powers with refer-ence to this all important question. Finance has been and is predominant in Moroccan affairs. She regards Morocco " as an island surrounded by French influence and destined inevit-ably to be absorbed in the French African Empire." Germany on the other hand recognizes the interests of the French in the policing of the frontiers but is unalterably opposed to French control over the cost regions, which she claims' should be guarded by an international police. Germany likewise desires to exercise control over the crown dominions which were given as securitv for the loan of two million dollars made by Spanish banks to the Sultan of Morocco. However Germany, as I have said, while not attempting to deny that France should have the right to police the Moroccan territory adjoining her Alger-ian possessions, is firmly opposed to giving France regulative control over the rest of the Sultan's domain. The attitude of Great Britian may be stated as being in favor of the French' contention, that France and not an international gendarmerie should police Morocco. Great Britian in 1904 resigned all her claims in Morocco to France,in consideration of the relinguish-ment by France of her right in New Foundland and Egypt. With respect to the positions of Spain, France can count on that nation's support in view of the convention of April 8th, 1904, in which France gave to Spain a number of concessions, the particulars of which were not made public. The support of Italy was won,by an agreement made with that country ,in which France was to keep Italy in Tripolo in return for aid given to France in Moroccan affairs. Thus France is assured of the support in the conference, of Great Britian, Spain and Italy. With respect to the attitude of other powers, nothing certain is THE MERCURY. 5 known. It is believed that Austria is not concerned with the political aspect of the question, but only with its commercial side. With respect to the position of the United States much has been said, the subject having only recently been exhaust-ively discussed by the U. S. Senate. Our government can be considered merely as a disinterested party in the conference, and as having no political axe to grind. It is thought that our representative will insist upon the " open door " in Morocco and will stand for the protection of the Jews and naturalized citizens of foreign countries. Then the stand taken by the Sultan of Morocco is of importance. The Sultan's delegates will make no proposals to the conference and are not endowed with powers to accept finally,the reforms adopted by the conference. It has been declared, however, that these delegates will approve all of the unanimous findings of the conference, provided that they do not affect the soverign rights of the Sultan or the in-tegrity of the country ; and that the introductions of the re-forms and their execution likewise be not entrusted to any one country. As a result of this position we can easily see that Germany, Austria, or in fact any one power, may very success, fully block the whole conference. Having seen that the point at issue is whether France shall have the right to police Morocco or whether that power shall be placed in the hands of an international gendarmerie, let us inquire into the relative strength of these two claims. When we consider the lact that Algeria, France's possession, which borders Morocco on the east, has for a number of years been troubled by disorders along the boundary, by some lawless Moroccan tribes ; and that France has been attempting to ex-tend her influence over Morocco,primarily to maintain order in Algeria, and secondarily to secure influence and trade in Morocco, we cannot fail to admit in part at least the justice of Frances' claims. In 1904, the French minister of Foreign Affairs, M. Delecasse duly communicated the scope of the agreements, made by France with Great Britain, Spain and Italy, to Germany and explicitly made known the intention of France to place Morocco within her sphere of influence. At THE MEKCLKV. that time the German embassador at Pans declared that France's declarations,with respect to Morocco, were " sound and reason-able." But very soon after Russia's serious defeats in the East by Japan, the German Kaiser, evidently eager to supplant France in Morocco and to acquire a controlling influence in this " priceless pawn on the chess board of world power," stepped in. and declared that Germany would protect her commercial inter-ests, and the integrity of Morocco must be preserved. This-action of the Kaiser has deceived no one. His uncalled for interference in the matter can be attributed to no other cause-than jealousy of France's growing influence in Morocco. Sur-rounded as that country is by French possessions, it is but just and reasonable that France should strive to establish a protec-torate over the territory of the Sultan. Germany on the other hand bases her claims upon no other grounds than the fact that German commercial interests, aggregating in all a few mil-lion dollars, are located there. This does not seem a good and sufficient reason for seeking to frustrate France's ambition to acquire control over Moroccan affairs, inasmuch as the latter country undoubtedly is supported by international law. At present France and Germany have deadlocked the con-ference by failure to agree on this most vital point, the polic-ing of Morocco. What the outcome will be it is difficult to say, but it is to be hoped that justice will prevail and that sel-fish greed for territory, unsupported by any valid and reason-able claim, will not prevail over the manifest validity of France's contention. THE MERCURY. / SOME ESSENTIAL CHARACTERISTICS OF A SALESMAN. E. G. HESS, '06. HAVING made a somewhat extended study of the funda-mental principles underlying successful salesmanship, I regard this an opportune moment to share with you a few in-significant fragments of what investigation and experience teach as some of the essential characteristics of a salesman. My definition of the term does not include the easy going automaton, measuring silks and satins in a department store. Neither do I refer to him, who dressed in snowy white, on a sunshiny sultry summer day manipulates the soda-water foun-tain or hands the refreshing " Moxie " to the ever-thirsting crowds, and with ease, registers the cash. Nor do I refer to any, to whom the prospective customers, with bulging purses, come, having a definite intention to purchase. But the parti-cular class concerning whom I shall speak are those who solicit buyers and generally meet their customers determined not to purchase. Perhaps nothing portrays the situation more accu-rately than that old and well known Jewish saying.which reads as follows: " To sell a coat to a man who wants a coat, that is nothing: but, when you sell a coat to a man that don't want a coat, that is business." This, paraphrased and expressed in more refined language, reads : offer not merely what people want, but offer something better and convince them of its value. To have conscientious convictions concerning the goods to be sold, stands as a pre-eminent requisite. The salesman must feel, from the depth of his heart, that the article offered is use-ful and better than any other of its kind ; that, while it may have imitations, there is no substitute ; in short, that it stands unique. Have you ever noticed the vast difference there is between something good and something just a little better ? For ex-ample, there is a trotting horse that covers a mile in 2.10. You say, that is a fine animal and valued highly. But there is 8 THE MERCURV. another horse trotting a mile in 2.08. You say, what difference can two seconds make in going to church ? Before you can look at the clock the seconds.are gone. The latter horse is, however, valued about $10,000 more than the former, for the simple reason that it is just a little better. So with the goods, they must be just a little bit better. He must also conscientiously believe that the article is worth the money received for it. For who could be so scandulous as to rob people in every business transaction ? Also it is evident that a thorough knowledge of the goods is absolutely necessary. The salesman needs to know at least a hundred times as much as he expects to tell any customer. Goods handled by drummers are either entirely new or posess some new and especially valuable property. People generally of their accord recognize the common properties of goods ; therefore it becpmes the salesman's business to differentiate and demonstrate conclusively the superior merits of his goods. He represents a new idea expressed in material form. Conse-qently he must introduce into a community that new idea. He necessarily must expect other people's ideas to differ from his own. He becomes an educator or a missionary, and this determines the spirit in which he engages in his work. There are some, however, who consider salesmanship trick-ery. It is absolutely foolish to try to sell by tricks. A sales-man can be known, in a large measure, by the controlling prin-ciples of his business. There is, perhaps, no characteristic that manifiests itself so clearly as a powerful will. Let us, however, not mistake stub-borness, obstinacy or temper for strong will. Such demonstra-tions and characteristics are the result of an uncontrolled will. The true will has the force and the continuity to stick persistently to a purpose and steadily perserve until it is accomplished. This gives ability to throw great energy and enthusiasm into the work and keep it there until the end is attained. One may have spasmodic outbursts and throw enormous energy into one special effort. But this is no cri-terion and does not indicate strength, which is tested by the THE MERCURY. ability to carry out a continuous course of so strenuous a character. He must also be able to make immediate and final decisions. A salesman cannot afford to doubt or even to hesitate betweert two opinions. He must sometimes, instantaneously, decide to do or not to do, and having thus-decided, his determination must become invincible, his purpose fixed, and then death or victory. Those who study this department of activities find some who fluctuate from one opinion to another. These opinions are usually furnished to them gratuitously by some kindly-disposed person, who had rather he were transacting business elsewhere, lest perchance, some money might be taken out of that partic-ular vicinity. They drift upon the free thought of the com-munity and are tossed about like a cork on the rolling billows t)f the mighty deep. These generally complain of being buf-feted by the world, and they erroneously conclude that they are not adapted for this particular sphere of business activity. Let us, therefore, consider what adaptability has to do with successful salesmanship. When one transacts business in New York he must have the Democratic spirit of a New Yorker; when in Boston, that of the Puritanic Bostonian ; when in Phila-delphia, that of brotherly love of the Philadelphian. Emerson says: "Nature is not slow to equip us in the prison uniform of the -party to which we adhere. We come to wear one cut of face and figure. But for non-conformity the world whips us with its displeasure. Therefore, a man must know how to estimate a sour face. It becomes easy enough for the firm man, who knows the world, to brook the rage of the cultivated classes." This principle of conformity, nevertheless, also has its limita-tions. It must be adhered to until the salesman has found a point of contact or mutual interest. But, when he presents his cause, he must know his own worth and keep things under his feet. He then becomes himself. So logically and forcibly does he argue, that the prospective customer loses his vantage-ground and is uplifted to a new and more beautiful realm of thought. In this happy state it is infinitely more easy for him to compensate by handing you a check than to see you go empty-handed. A good salesman is said to be like a good cook; he can create an appetite when the buyer isn't hungry. IO THE MERCURY, "CHINESE" GORDON. HESSE, '09. EVERY truly great man exerts an influence for good, and becomes a public benefactor. He', who aids another to conquer his own evil nature, or who rescues the plains and forests of the earth from barrenness and unfruitfulness, de-serves the highest praise and an undying fame. Each nation of the dim past, as it raised to prominence, dis-closed some man, who, by his genius, his energy, or his self sacrifice, stood preeminent among his fellows. The nations of antiquity have not alone become famous for their great leaders ; for the nineteenth century and modern Europe have contributed in Charles Gordon, "The hero of three continents," a man, who as a soldier, a statesman, an explorer, and a Christian missionary, brought light to darkest Africa, relief to oppressed China, and by his unselfish devotion to duty, became a worthy example for all succeeding ages. Gordon stands to-day the product of freedom and Christian morality, the son of an illus-trious race. The history of his ancestors is the story of man on the altar of self sacrifice, and the deeds of his illustrious Highland clan have become famous in the annals of Scotland. When a young man, Charles Gordon entered the Loyal Mili-tary Academy, but with no desire of becoming a soldier. He first entered Her Majesty's'service at the out break of the Cri-mean war, where, by his bravery and soldierly bearing, he won the confidence of his superior officers. During the one year's siege of Sabastopal, incessant guard by day and night, hard labor in the trenches, scarcity of food, and an unhealthy climate, tried his courage and disclosed that endurance which, later made him famous. At the close of this bloody struggle the young soldier was appointed to locate the boundaries between Russia and Turkey, and while there, got a glimpse of an infamous trade which later was to receive from him such a deadly blow. Four years thus spent in active service and travels, gave Gordon such knowledge and wisdom as seldom comes to one so young. He had seen and lived with both the oldest and THE MERCURY. II newest among the nations of men, and his thoughts, running •deep into the unwritten volumes of nature, equipped him well ' for his later and more difficult tasks. Our hero next appears in China, that ancient and solitary nation.which for centuries had been consuming all its wealth in the producing of a terrestial paradise. As an officer of the English arm}- he took part in the so called " Opium War," but when the capture of Pekin put an end to hostilities, and the Chinese government found its very existence threatened by the great Taping rebellion, this obscure Englishman, an enemy, was chosen to lead the Imperial Army and to protect the three hun-dred million inhabitants of China. The service he rendered to the Empire of China we can not fully estimate. He gave vigor to their plans, thought to their councils, rapidity to their action, and courage to their soldiers. His indomitable resolu-tion, inexhaustible resources, and sleepless activity, prevented the spread of the insurrection, and the overthrow of the oldest empire in the world. Honest sincerity, love of justice, humility and a superior knowledge of mankind were his master quali-ties ; and yet, while the government and ruling classes of China honored Gordon as the saviour of their country, the people of England looked upon him as a fanatic or mad man. At the close of the rebellion he returned to England, and for six years devoted himself to the aiding of the poor in his native land. In the year eighteen hundred and seventy four, this unselfish soldier accepted an offer from the Khedive of Egypt to penetrate the upper regions of the Nile, to explore that unknown land, and to overthrow the power of the slave dealer. There, in the pit of man's lowest degredation, in that region made dark by the long absence of Christian civilization, were displayed an intense feeling of sympathy toward the de-graded black man, and a bodily energy or power of endurance, which made him a master of physical toil. The course of the river led him due South into the very heart of darkest Africa. Day after day, and month after month, he traveled on through that vast rainless region, and then came to the home of the African negro, who had so long been the spoil of his stronger 12 THE MERCURY. brother. All his companions soon died, and by the last of December Gordon was the only white man in that vast region called the Soudan. Where is there a more pathetic picture than that of this lonely solitary being, fighting both man and nature, and hoping almost against hope for the overthrow of slavery ? After enduring untold sufferings and exposure, Charles Gordon accomplished his mission of organizing that region,, more vast than all Europe, and returned to the Khedive at Cairo. A second time, as Gov. General of the entire Soudan, he penetrated those vast equitorial wastes and day after day he could have been seen, mounted on a fleet camel, traversing the long wilderness of ridge and gorge, plain and valley, and seek-ing in every possible way to thwart the Arab slave traders and check their nefarious traffic. Gordon aimed to lighten the load of human misery wherever he might find it; to establish order where there was anarchy ; to unbind the slave and restore to him his lost manhood. The wretchedness of the poor people of the country was beyond description, for war, famine, and slavery had truly made it the Dark Continent. It seemed at that time that Gordon's long and speedy jour-neys about the country, and his ardent toil, were all in vain, but no: no sacrifice for the sake of humanity is ever in vain. The African slave trade, with its attendant evils, has now been overthrown, and all Christian nations vie with each other in opening Africa's fertile regions to the civilization of the world. Now Charles Gordon was not permitted to reap this hard earned reward of his labor, for jealous officials reported to the govern-ment of England, that this great son ot hers was not only in-solent, disobedient, and insubordinate, but that he was mad. His knowledge and outspoken convictions regarding England's-foreign policy in India, Egypt and South Africa soon placed-him in disfavor with all political parties, and this man, who had devoted his life to the service of his fellow man, was appointed as a mere secretary at the legation in Bombay. Deserted by - his countrymen, and ignored by his fellow-soldiers, Gordon • THE MERCURY. 13 again went to China, and while there, succeeded in preventing the threatened war with Russia. When this friend of the oppressed again returned to England, he came face to face with the most unnatural system of slavery ever tolerated by a Christian nation, and in his bold and fear-less way, urged the English people to right the wrongs of Ireland. He was listened to, when he spoke in the cause of some distant race in Central Africa ; he had legions of admir-ers, when he painted the road to right and justice for some? nameless tribe in the remote Soudan; but was ridiculed when, he told the people of England, that within twelve hours of the capitol there existed a deeper misery and a more unnatural injustice. Such bluntness of speech and honest expressions of conviction were not pleasing to either people or government; so Gordon was again forced to retire from public life. How-ever, he was soon sought and urged by a helpless ministry to again take up the burden in the equitorial regions, and rescue England's garrisons from impending destruction. The appalling mismanagement of affairs in Egypt, and the numerous successes of the fanatic, Mohammedon Mahdi, were threatening to cause the complete destruction of Britain's au-thority in Africa; so, bidding a last farewell to the land of his birth, Gordon set out to rescue the garrisons he himself had es-tablished in the Soudan. Having advanced into the upper re-gions of Egypt, he made his headquarters at Khartoum, and with half a dozen Englishmen and a few thousand Egyptians soldiers, sought to stem the tide of Mohamedian fanaticism, and rescue the land he had so often sought to save. Month after month the forces of the Arabs increased, but daily the food supply and the number of his faithful followers lessoned. De-serted by many of his" Egyptian troops, and abandoned to his fate by his government at h/>me; this lone hero fought on, hop-ing against hope for the success that never came. After a siege often months, when every morsel of food had been ex-hausted and every hope disappointed, the city fell; and this king of men, the greatest of England's heroes fell—a martyr at the post of duty. 14 THE MERCURY. Many a year has gone by since the kith of Charles Gordon first heard from Highland hilltop the signal of battle ; but never in Celtic hero's long record of honor, has such answer been sent back to Highland or Lowland, as when this great heart ceased its beating in the dawn at Khartoum. The dust of Gor-don is not laid in English earth, nor does the ocean hold in its vast and wandering grave, the bones of England's greatest hero. Somewhere, far out in the immense desert, whose sands so of-ten gave him rest in life, or by the banks of that river, which was the scene of so much of his labor, his ashes now add their wind-swept atoms to the mighty waste of the Soudan. IS THE PRINCIPLE OF CONTEST BEING RUN TO EXCESS? SAMUEL E. SMITH, '07. THE life of man is a continual struggle. From the cradle to the grave he is always fighting for his very existence. In childhood his frail physical organism is battling all the time with the diseases which blot out the lives of so many before they reach their teens. As a young man he is ever striving against the forces which would destroy him. And how many do succomb to the temptations and ambitions of young man-hood ! When he is married and has a home of his own, it is again a never ceasing struggle to provide bountifully for his dear ones and educate them properly. No wealth, no position can guarantee to a man a life free from struggle. With the rich it is a constant fight to keep from being defrauded, while with the poor it is an every day struggle to procure the neces-sities of life. Since the question is of such breadth it will be impossible for us, in the space allotted, to present anything like a conclusive argument, unless we»will limit ourselves to some particular period of life and examine its relation to this ques-tion with much thoroughness. An understanding has been reached with the negative to this effect, and in pursuance of such an agreement it is the purpose to debate,—is the principle of contest being carried to excess in college life ? THE MERCURV. I 5 Even narrowing the question down as we have narrowed it, there are so many phases of college activity, that it is almost a problem to find a proper point for our argument to begin. However there are four worlds, as it were, in which the student with normal tendencies moves, and these will serve our purpose for an outline. The intellectual realm is the first to be considered. The chief occupation of the student is, or should be, study. How is the principle of contest affecting the intellectual pursuits of the student? In a very vital way to be sure. Indeed the entire education of man is a contest of his higher self with the plastic materials of his lower nature; that the strong and beauti-ful fabric of a vigorous mentality may be fashioned. The word education is most significant in this respect, being from educo, whose root means the one who leads an army. Our present system of education makes study a continual con-test tor most students, and it is well that such is the case. The student must be careful or he will make poor recitations and* that means poor marks. He must keep the examinations in view and for a week before the last of the term the contest becomes more strenuous. Then there are prizes to be con-tended tor, and the love of intellectual war, so to speak, is felt so little that only a few ever struggle tor prizes with real effort. Inter-class debates and inter-society debates afford a further means of contest. However, so few are interested in these, as a rule, that the principle of contest is practically inoperative in the intellectual realm. On this account the regular college re-quirements should be higher, in order that the great majority of students would be required to fight harder for success. As we pass from the intellectual to the physical world we find the principle of contest operative to a greater degree. This brings about many and beneficial results. The athlete has ever, and justly so, received great honor, although we can scarcely approve of the almost universal custom of making more of physical prowess than of intellectual supremacy. At college a man must work hard to reach a high place in the athletic world, and in striving for success in sports certain very i6 THE MERCURV. definite results are achieved. Many a boy who is too lazy to do any useful work, enters the field of athletics, thinking of glory only and never considering the work. Soon he discovers that there is a great deal of hard work, but under the excite-ment of the principle of contest he keeps on and finally a change is produced ; he forgets his former aversion to effort of any kind and at length becomes a useful member of society. Thus the principle of contest is beneficial. In the social circle the principle of contest is a real problem with the student and is of a decided benefit to him. Some are born gentlemen and associate with men and women, and never feel the slightest embarassment. But the great majority of young men find it, for a time at least.a veritable struggle to ac-quire the little niceties and the tact which society so rigorously exacts from those who would become factors in a college com-munity and have entrance to the best homes of college towns. Many a student has developed from a bashful, uncouth, and vulgar country boy into a master of men and a perfect gentle-man. through his continual struggle for social recognition. It may seem surprising that the principle of contest should be considered as applicable to the religious life of a college. But we believe it to be a very important element in religious 'growth and consider its absence in the present age, to be in a great degree responsible for the indifference toward sacred things. In other words it is too easy for a man to be a Chris-tian. He has nothing to directly oppose any religious tenden-cies which may be present in his nature Everyone about him believes in a Divine Father, etc. To be brief there is no direct opposition to strengthen his religious nature. There is no open battle for him to fight as there are in his other spheres of life. To be sure there are temptations and evil ambitions, as no doubt by this time you are ready to suggest, but they are like the rust which slowly gathers upon the steel unbright-ened by frequent encounters with direct opposition. If the principle of contest were more in evidence in religious life, if it meant a direct fight, with tangible forces of evil, to be a Chris- THE MERCURY. 17 tian, there would be more out and out Christians than there are under the present circumstances. Until this point we have only mentioned the possible bene-fits of, and as it were, the conditions under which, the principle of contest is in evidence to-day in the college world. You may-say what have we proved? There has been no final argument as we admit. We have just been making the staves and heads, if we may liken our argument to a barrel on which we will now place the hoops.in order that you may see the finished fabric of our argument. Taking all the ages of the past for examples, we may affirm certain things which are so evident that ex-tended proof is unnecessary. The general truth may be stated thus, where the principle of contest has been operative to the greatest degree, the finest types havebeen produced. Thus, in Athens, whose great men possessed the mightiest intellects of all times, such rigorous methods ot intellectual culture were resorted to as would notbe endured today. The Indian, pro-bably the finest type of physical manhood ever produced, at-tained his perfection in the wilderness where it was a constant struggle with nature. To day when conditions are changed and the principle of contest is no longer operative, the Indian is rapidly dying out. In social intercourse the masters of men are those who must deal most with their kind in a constant stru-ggle. The truest Christians were those whose faith led them to the stake. We believe we have shown you, first,the possibilities of im-provement which the student has in struggling with the forces about him, and second, that such a principle of contest is nec-essary to the highest culture as demonstrated by the experience of men from immemorial lime. ^HMHUHBI iS THE MERCURY. FIRE BY NIGHT. BY W. WISSUSR HACKMAN, 'OS. Hark, hear the bells boys, Hear the terrible sound Fire, fire, fire, fire, Hurry the engine along. Clang, clang, wild alarm and clang of bell, Clamor of men and shouts across the twilight fell, Clangor of bells, with iron knell, Wild agonies their tones foretell, And shrinking fears their shrill alarms compel. Now thru streets but late so silent, Bursts the crowd all turbulent, Cries, the peacefull twilight rend And to the night their panic lend. On swerving wheels The engine reels, Its strident gong hurls warning peals, And over all the deepening darkness steals. Oh, Fire ! Thou art a fearful thing, What carest thou that wild bells ring, Thou, thou alone art king, And to the world thy challenge fling : " Ring out ye bells for what reck I, I'l fling my banners to the sky, All now that dares athwart my path Shall bow its crest before my wrath. Ring, ring ye bells for I am nigh, Your petty strength I may defy, Nor heed your harsh alarm ; so ring, ring And to the conflict all your forces bring. My flashing hosts gleam fiercely bright, Their flashing light Shall put to flight The dusky warders of the night— King, king am I And boldly do defy Aught that would stay my reign, Or check the ardor of my flame." Fierce the joy in the muffled roar Of the wild flames that heavenward soar, The lurid gleams wierd shadows throw, And cast an elfish light on all below. THE MERCURY. 19 With wild exultant leaps it glides along. Its fitful flare reveals the throng Of upturned faces silent and subdued, Awed to silence by the ruthless power viewed. Yet he, that one whom thou disdain, Shall overthrow thy fiery reign, Shall bind thee with an icy chain, And quench the ardor of thy flame. The sovereign mind of man shall halt thy sway, And conqueror shall steal thy blazing crown away, To dust and ashes shall thy reign descend, Already is thy vaunted fury spent. Thy gorgeous canopy of smoke is rent, And with thy allabsorbing ether blent, Only smouldering coals—hissing hate— Are left to testify thy fate. A few faint sparks, A smoking wall Thy pathway marks, And over all The black night pitying throws her pall, And Silence, Nights twin sister, over all, Her mantle of oblivion lets fall. THE RUINS OF TIME. KOPP, '09. HOW full of instruction are the wrecks, the ruins and the the revolutions of time! They are the oracles of ages ; they speak with a voice of thunder to the heart, with a voice more impressive than the tongue of Tully, more harmonious than the harp of Homer, more picturesque than the pencil of Apelles. Imagine you see the venerable shade of Time as he stands for a moment on the pedestal of years, his aged hand pointing to the ruins of empires, and his trembling form bend-ing over the tombs of Oriental genius. Roll back the billowy tide of time; unroll the moldering records of ages. What wonderful scenes are presented to the startled imagination of man! He beholds his own destiny and the doom of his nob-lest achievements. He builds a colossal empire of his renown ; he dedicates it to other ages ; but, behold, triumphant Time hurls it with all its grandeur to the dust. 20 THE MERCURY. So it is with man himself, and so it is with the nations oi the earth ; they rise, they flourish, and pass away as if they had never been. Where now is ancient Egypt, the land of science and of sacred recollections ? Where are her hundreds of cities, her Memphis, her Thebes, her oracle of Ammon f The strong red arm of the Vandal and Goth has leveled them with the dust; the serpent now dwells in the temple where the worshipper once bent a knee of adoration. The oracle has been silent for ages, and the priestess long since fled from her shrine. And where are the pyramids of Egypt that stretch into the upper light and mock from their cloud-capped pinnacles all objects beneath them ? Alas! they stand as mournful monuments of human ambition. The kings who planned them, and the millions of wretched slaves who erected them have gone down to their graves and the tall grass now waves over the sepulchre of their bones. And such shall be the fall of those pyramids which have stood tor ages as bea-cons of misguided ambition ; the wave of time shall roll over them and buryjhem forever in the general mausoleum of ages. Mournful to the minds oi men are the records of departed greatness. Imagine you are seated amid the melancholy ruins of Rome. Around you are strewn the crumbling fragments of other ages, and before you are the tumbling temples once hal-lowed by the footsteps of the Caesars. The cottage of Romu-lus, the golden palace of Nero, and the shrine of Apollo and the Muses are mingling with the wrecks of other times. But where is the great Roman Forum in which the thunder of Cicero's eloquence once struck terror to tyrants ? There the shepherd boy now roams with his fleecy flocks. There, where the Comitium, the Curia and the Rostrum once stood, the lean lizard now crawls, and the tall grass waves in the night breeze. And where is that stupendous pile, the Coliseum, which stood in ancient days like a mountain of marble, where the strong-armed gladiator bled and where the untamed tigers of the forest died ? Alas ! it still stands tottering in decay, but the thousands of spectators have departed. The footsteps of the solitary traveler now echo alone where THE MERCURY. 21 the mighty Caesars once applauded and where the clash of the combat sounded. But is this all ? Alas ! Rome is still eloquent in ruins: the City of the Seven Hills is strewn with the frag-ments of other ages. Go, muse over the fallen forms of Trajan, Nerva and Domitian; a few pillars of Parian marble alone re-main to tell the world that they once have been. Go, gaze on the ruins of the palaces of the Caesars; descend into the catacombs and ruminate amid the bleaching bones of the early Christians, persecuted by the demon of superstition even to death. Go, climb the lofty towers of Rome and survey the melancholy me-- mentos of other times and other men. And is this the mighty Rome that once stood against the legions of Carthage led by the victorious Hannibal ? It is the same, though fallen. Carthage too is buried in the vortex of oblivion. Such are a few instances of the ravages of time. And not less has our own loved country been the scene of desolation. Here may be seen the ruins of an Indian empire, more extended than the empires of the East; and though they left no monuments of sculpture, painting and poetry, yet great were they in their fall, and sad is the story of their wrongs. They once had cities but they are swept from the face of the earth. They had their Temple of the Sun, but the sanctuary is broken down. It is true, they worshiped the Great Spirit, but the sacred pages of revelation had never been unrolled to them ; the gospel of the Saviour had never sounded in the ears of the poor children of the forest. Here along these shores the council fires blazed, and the war-whoop echoed among their native hills. Here the canoe of the dark brown Indian was once seen to glide over his own-loved lakes. Centuries passed away and they still roved, the undisputed masters of the Western world. But at length a pilgrim bark came darkening on their shores. They yielded not their empire tamely, but they could not stand against the sons of light: they Bed. With slow and solitary steps they took up their westward march and yielded with a broken heart their native land to another race. They left their homes and the graves of their fathers to explore the Western woods, where never human foot had trod and never human eye had pene-trated. From time to time they have been driven back and the next move will be into the bosom of the stormy Pacific. 22 THE MERCURY. REMINISCENCES. " The late snow, with its crowd of yelling, snow-balling boys, brings back our own boyhood," said an old man as he sat be-fore the fire in the engine-house. " Yes, boys ain't what they used to be," sighed another, old geezer. " Aw, ring off," said a young fellow, who had been listening. " You make me weary. Why, I'll bet your ma tanned you mighty frequently in the dim and distant past, and you could have had more and not been imposed on." The old men looked at each other shame-facedly for a mo-ment, and then the elder said, " Well, I kinder reckon we did cut up a little, didn't we, Bill," and the two gray heads chuckled at the reminiscence. "I kin remember very well," said Bill, " when we used ter go out swimming.' At breakfast pa 'ud say, ' William, my boy, I want you to stay and help yer ma,' an' I'd say, ' Yes, pa,' so meek that Moses' chin-whiskers must have curled with jealousy. Then dad would hustle off to work, leavin' me to-the tender mercies of ma. . " ' Willie, just you go down and cavort around the woodpile, and don't you let me catch you outside.' " Of course, bein' full of virtue and worldly ambition, I'd hie me to the woodpile aforesaid and cavort. Pattin' myself on the back, figeratively speakin', I'd make chips fly like a good 'un. ' O, no, William,' says I to myself, ' you ain't hankerin' after no swimmin' holes ; you don't care for no nuts or no apples. You air an honest boy and will be President some day or own a hand-organ and a b'ar.' And says I, ' William, if those there Campbell boys come down the alley, you will treat them with scorn. You won't go swimmin'.' By this time the day is rather warm and somehow the charm of ownin' a hand-organ and a b'ar cant hold a candle to your desire to get into the cool water. Satan about this time through his per-sonal agents, as rna always believes, puts temptation before me in the shape of the Campbell boys and Bill Black. A shrill whistle, I look! Again the whistle, and there at the back end THE MERCURY. 23 of the lot you see Bill Black cautiously hold up two fingers like the forks on a shooting flappy. It is the sign, the great masonic highball, to boys in distress. It means, ' Will you go swimmin' ?' Even now I feel a queer feelin' of surprise and pleasure when I see it, and when I was a boy, wild hosses couldn't keep me still at the sight. Then ma's Willie would look at the house, then at the fence, then at the house again. All wuz still, no sight of ma. The ax dropped quietly, and away I'd sneak, along the grape-arbor, behind the barn, over the fence and then away." "You don't need to tell me what followed," said old man Strong. " You clawed your bare legs on briar bushes, treed a squirrel or two, ripped all the buttons off your trousers, fell in the swamp in the chase of bull frogs, ate Henry Igo's apples in the field by the Slate Hole and was well warmed if the old man caught you, and other things too numerous to mention." " Yep," said Bill, " that's me, only I never could see the use of goin' home to dinner nor why big rocks wuz always in my way to stub my toes on. Then, too, John, you fergit how we used to argie with Jim and Bill Mulholland, and I ain't for-got how my feelin's used to oppress me as the sun went into the west behind the mountains. At them moments my con-science 'ud become painful, and the thought of mother standin' lonely ' beckonin' me from the wigwam,' as that Longfeller poet says about Higherwather, would move me to tears almost. Mother'd be sure to overcome the ' almost' though. " She allus said it hurt her more than it did me, but I could never bring myself to look at it in that way. But we ain't allus got the making of the way and it wuz better to go home than to sleep in the woods. Somehow, the world didn't seem so bright jest then as it had in the mornin', this same darken-in' being produced no doubt by the idee of the whalin' you'd get when you'd arrive at your humble domicile. " But I put on a bold front, and when near home, I'd pick up a few sticks of kindlin' and carry them as if I wuz old At-las in the geography carryin' the world. Arrivin' at home, with the rest of the family at supper, and goin' in like a lamb 24 THE MERCURY. to slaughter, thinkin' thereby to melt the hard heart of a par-entess. It wasn't no use. The neighbors would soon think the Turks were murderin' some more Armenians, and I'd think a boy wuz the most abused and mistaken bein' alive. And I'd wish I wuz dead, and think how they would wail over me and say es how they never had appreciated William. And I thought if I could swear like Bill Black, how much better I'd feel. But it wa'nt no use. Next day wuz just like yesterday." " Do you mind old man Cassiday? " says old man Strong. "Mind him! Wall I wonder! Bill Black's stepdaddy? An old soldier? Yes! Him and Bill used to have some powerful tussles. Wait till I light my pipe," said old Bill as he produced a corncob about whose strength there could be no question, carefully tearing off a strip of newspaper, lit it at the fire, started it going, and began. " Yes old Cassidy war a terror. He war a beer peddler you know, and when Bill ud swipe a keg would hang him up by the thumbs for half a day. You can't expect none of the vices and all of the virtues from a boy raised in them surroundings. After old man Cassiday wuz arrested and fined he wouldn't stay in them parts, where good liquor weren't appreciated. So he buys a farm off in the hills about two miles out of town and moves there, chattels, personal property, wife, Bill and the goat." " I ruther calculate Bill wuz more trouble to the old man than them articles above mentioned." " Wall, Bill waren't constructed to do hard bone labor. He war a quiet, mannerly lad when your eye war glued on him, but all but that when it warn't. So when in the bootitul dawn, old man Cassiday would interduce Bill to a hoe and then inter-duce the pair of them to a twenty-acre cornfield, why, I am free to remark a field like that would discourage a youth with more grit than Bill had, and on Bill the effect was simply paralizin.' He hoed like the old man was after him fur a spell, and then'd resign and head for the icedam. This icedam were appreciated by boys. It was one hundred steps square with high banks and seven feet of clear cool water all over. A springin' board THE MERCURY. 25 *, wus rigged up, and there, guiltless of clothes, the boys would swim until their backs looked like b'iled lobsters. " All around the outside of the dam vvuz swamp where muskrats had bored until they let water out of the dam. " Hither Bill would come and be received with yelps of de-light. Bill wuz no believer in clothes, or if he wuz didn't prac-tice what he preached. After Bill hed shed his shift, a cap, and a pair of badly torn trousers held up by a string over the shoulders, he was ready for a swim. " It was not exactly Bill's ability as a swimmer that 'ud cause him to be welcomed, but we all knew that when old man Cassiday found out that Bill and the hoe had become divorced the icedam would be right in the fire-zone for a few minutes, sure 'nough, about the time Bill was divin' and jumpin out about the center of the dam, old man Cassiday would hie him in sight and there'd be a wild scramble by them as was in the water to get ashore. Old Cassiday allus come prepared. In one hand he carried a long, limber willow stick forked at one end (for he was a connussier on matters of discipline,) and in his other mit he had a few selected pebbles, gathered like David's , from the brook just beyond. "'Come hyer, you sneak, come hyer!' he'd yell. There wuz no attraction fur Bill on that there bank just then, but after considerable persuasion, aided and abetted by the pebbles lighting near his head, and because of the fact that he couldn't duck the rocks and swim all day, Bill he'd crawl out of the water an' make a rush for his wardrobe, grab it in one hand, and with old Cass arisin' a big welt at every jump, go flying through the swamp, across the crick, through a clump of briars .and away to the farm , Bill a little in the lead, with old Cass a good second, and a urgin' him on occasion'ly." " Ah, me," said old man Strong, " boys ain't what they used to be." And the young man said nothing. " Yes, and Bill would sometimes come back the afternoon of the same day. Poor Bill! He's gone now. It's gettin' dark now and my old woman has early supper so I think I'll be goin' now." " Me too," says Bill, and in silence they left the fire-house, tottering as they went. " Queer old codgers," said the youth. " Yep," said the fire captain. THE MERCURY Entered at the Postoffice at Gettysburg as second-class Matter Vol. XIV GETTYSBURG, PA., MARCH, 1906 No. 1 -Editor-in -ch ief WARD B. S. RICE, '07 Exchange Editor THOS. E.SHEARER, '07 Business Manager THOMAS A. FAUST, '07 Ass't Bus. Managers. HENRY M. BOWER, '08 H. WATSON DAVISON, 'OS Associate Editors GEO. W. KESSI.ER. 'OS J. K. ROBB, 'oS EDMUND L. MANGES, '08 Advisory Board PROF. J. A. HIMES, LITT.D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D. D. Published each month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance; single copies 15 cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Busi-ness Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORALS. To the members of the retiring staff we turn with a feeling of thanks and gratitude, in the name of both the friends of the MERCURY, and the newly elected staff. The editors have shown a keen interest in maintaining the standard of this publication, one which commands respect wherever it goes and is a credit to its alma mater. On the other hand the business management calls forth our highest admiration, when we consider the con-dition in which this department of the paper was found at the beginning of the school year, and the unceasing energy which must have been put forth to set it again on a firm basis. The MURCURY, on this its fourteenth birthday again finds it-self in new hands, which we hope will prove worthy of their THE MERCURY. 27 trust. It is of such tender age, and possesses such a high state •of development, that they, in view of the duties which must fall upon them and the lack of wide experience, have a tendency to shrink ; but memory steps in and recalls inspiring words : " Wherever there is a will there is a way." Therefore it will ever be their aim during the coming year, to train this child of literature, to the best of their knowledge, according to the maxims of the past and the growing wisdom of the future. ONE of the mottoes on the walls of the temple at Delphos was : " Know thy opportunity." How significant these words must have been in those ancient days when the loss of a single opportunity often meant a blighted career. An opportunity is the small moment, the exact point, the critical minute on which success in every good work so much depends. A latin writer has said: "She has hair in front; behind she is bald: if you sieze her by the forelock, you may hold her; but if suffered to escape, not Jupiter himself can catch her." The man of today has opportunities on every side ; indeed they sometimes appear to attempt to force one to seize them ; yet thousands of men die leaving the world unimproved by their having lived in it. They seem to have used this superabundance of opportuni - ties as children do at the seashore—They fill their little hands with sand, and then let the grains fall through, one by one, until all are gone. Today there is scarcely a person who does not have vast opportunities, and especially we who are college student^. The chance of having a college education has been made almost universal, yet how small a per cent, of the coming generation are taking this advantage. By a college education we do not mean the memorizing of books an'd the thoughts of others, but the development of our own inventive powers. There are dif-ferent institutions connected with a college career, which offer this opportunity: The literary societies, the Bible classes, the Y. M. C. A., and still another very importont one, the college publications. This last one is a branch of our work in which all should be very much interested. 28 THE MERCURY. Let us take tor example the MERCURY. It should be the pride of every student to have his writings published in it. There should be enthusiastic competition for its space. When such a spirit shall have been manifested, how much higher will the standard of the paper be raised, and how much wider will our literary experience be. Nor should we be discouraged if our contributions are not always used, but should try again ; many an ancient writer spent his whole life in literary pursuits, gaining the much coveted prize only a few times ; yet history heralds his name to the future. Therefore let us make this op-portunity to compare our work with others a prize; even though we often fail, we will be compensated when we suc-ceed. When we write even for class work, we should do it with the intention of giving it for publication ; in that way we would not only see them in print but would raise our class marks. Then do not wait to be asked for what you have written, but promptly give it to some member of the staff; nor should one be modest in doing this, for it is our com-mon interest and they will be glad to see you. WE have closed what may be regarded a very successful basketball season, although we have played a harder schedule than ever before. We also recall the unprecedented record of this year's football team. Now what has the baseball season in store for us ? Let us make it unusually successful too ; let us make the whole year one round of athletic success. In order to do this, a keen interest must be manifested, and some hard work must be done. There is plenty of work for all, do not think that you are not needed. If you cannot help any other way, do it financially. Be at all the games and show a lively college spirit; good " rooting " helps wonderfully. But {f.possible be on the field. Come put,for practice every day. If you don't make the' team, this year you may the next. Then do not think that it is impossible to make a position because another played it last year, his position is not guaranteed and each position is looking for one who can play it just a little better than the one who now holds it. Choose a position apd THE MERCURY. 29 play for it, even if you don't make it, you will make him work harder who does. If last year's players are made to feel that there are others to take their places, they will work harder and thus the team will be considerably strengthened. So you see that if a proper effort is put forth, even if you do not make the team, you have aided very materially in making it what it is, and you can justly claim a share of the honors in the event of victory. EXCHANGES. The Feb. number of " The Haverfordian," being the last in Vol. XXVII, contains a loose-leaf table of contents of the Vol. In glancing over this, one is surprised at the amount of material published by the magazine in the course of a year. In the volume there are nineteen essays, twenty pieces of fiction, twenty poems, seventeen sketches, and thirty-two editorials covering a wide range of subjects. In this number the article " Medicine as a Profession " by Dr. Tyson, '60, now of U. of P, while of special interest and value to those contemplating the study of medicine, is, nevertheless, interesting and instruc-tive to others also. This article is one of a series, written by prominent alumni on the subject of choosing a profession, which " The Haverfordion " has been publishing throughout the year. " Undergraduate Life at Oxford " is interesting to us as it brings out some ot the contrasts between English and American University lite. " The Philosophy of Optimism " is one of those " casual calls from a prophet of hope to rally round the standards of those who believe that 'all's right with the world.' " The issue contains some entertaining fiction also, among which is a good ghost story. The "State Collegian," of Feb. 22nd, contains in an ex-change an interesting summary of the cut systems employed in some fourteen colleges and universities. The number of absences allowed, average about 10 per cent, per term. Some striking exceptions are U. of P. and U. of N. Y, The former allows 20 per cent, absences, and the latter requires the student 30 THE MERCURY. to hand in a thousand-word theme on a prescribed subject for every fifteen cuts from chapel. " First American Newspapers " in the " Dickinsonian," of Feb. 21, is one of the most interesting articles that we have re-viewed this month. " The Mountaineer " contains several good stories and an ex-cellent translation in verse of Horace's " Ode to Thaliarchus." The article " The Poetry of William Collins " shows a fine ap-preciation of the poetical on the part of the writer and also the ability to express this appreciation in words. The "Lesbian Herald" is a magazine of superior quality— better this month than the general run of our exchanges. It contains strong articles on " Carlyle's French Revolution," " Browning as a Writer of Love Poems," " Schiller, the Man " (conclusion), and also several good poems, the " Sonnet " par-ticularly appealing to us. We have also reviewed with pleasure and profit the " Juniata Echo," the " Susquehanna," " Otferbein Aegis " and the "Mid-land." To the last named, we would suggest that a table of contents would, doubtless be a convenience for its readers! Editing a college paper is a nice thing. If we publish jokes people say we are fossils. If we publish original matter, they say we don't give them enough selections. If we give them selections they say we are too lazy to write. If we don't go to church, we are heathen. If we do, we are hyprocrites. If we remain at the office, we ought to be out looking for news items. If we go out then we are not attending to business. If we wear old clothes they laugh at us. If we wear good clothes they say we' have a pull. Now what are we to do ? Just as.likely as not some one will say we stole this from an exchange. So we did. .,.- ■■ " • ■ ' .'.,-■'-.,. ■ •',''/■!;; . . • :■-'-:,,'. .-■■■■ ': '.I'-'--:.;. ; I '; *■"■'■- . Fi ;;- ■ ■ .,:. : & i PATRONIZE OUR ADVERTISER'S FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames. Repair Work done promptly. Under-taking a specialty. ■* Telephone No. 97. £E& 13. Eerier 37 Baltimore St., Gettysburg, Pa. The Windsor Hotel 1217=2 Filbert St., Philadelphia. Headquarters for Students. Thoroughly Renovated, Refurnished and Remodeled FRANK M. SCHEIBLEY, Manager. Graduate of Lafayette College i8g8. Spalding's Athletic Library NO. 250. Spalding's Official Athletic Almanac EDITED BY FOR 1906. E. SULLIVAN All Intercollegiate and Interseholastic Meets and Records; Ama-teur Athletic Union Records ; A. A. U. Senior and Junior Champion-ships ; Swimming and Skating Records; A. A. U. Boxing and Wrest-ling Championships ; all Shot Putting and Weight Throwing Records; Official Report of the Lewis and Clark Centennial Athletic Games; pictures of leading athletes, American and foreign. Price by Mail 10 Cents. Send your name and address to our nearest store for Spalding's Catalogue of all Athletic Sports—it's*free. A. G. SPALDING & BROS. New York, Chicago, Denver, Kansas City, Baltimore, Philadelphia, Minneapolis, Boston, Buffalo, St. Louis, San Francisco, Montreal, Canada ; London, England. PATRONIZE OUR ADVERTISERS. BEGKER & GOUINS • >CHAMBERSBURG ST., Dealers in Beet Teal, Lamb, Pork, Sausage, Pudding,. Bologna, Hams, Sides, Shoulders, Lard, Prime Corned Beef. SEFTON & FLEMMING'S LIVERY Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrangements by-telegram or letter. Lock Box 257. J. I. MUMPER. 41 Baltimore St., Gettysburg, Pa. The improvements to our Studio have proven a perfect success and we are now better prepared than ever to give you satisfactory work. ICE CREAM Telephone Call 1612 SODA WATER (Sheads' (High (Grade (Confections 37-39 Chambersburg Street, Gettysburg, Pa. FRUITS RESTAURANT ATTACHED Under New Management ■"—> The Peoples Drug Store Invites you to visit them and select your needs from a fresh, new, and up-to-date stock. C. WM. BEALES, Ph.Gr., Prop. D. J. Swartz Dealer in Country Produce Groceries Cigars anfl Tobacco GETTYSBURG. Shoes Repaired -BY-US Baltimore St., near Court House. Good Work Guaranteed. PATRONIZE OUR ADVERTISERS. 0 EAGLE HOTEL Rates $2.00, $2.50 and $3.00 per day. HAS A CAPACITY OF 400 GUESTS —r-*-^ GEO. F. EBERHART, PROP'R. iiriiPlffimi Picture Frames of All Sorts. Repair work done promptly. r^Tl will also buy or exchange any second-hand furniture 40hambersburgSt., - GETTYSBURG, PA. tne Gettysburg Mercury when inpiring for and lying WALL PAPERS FIRO:^ WATT & BROTHER CO. YORK, PA. Our Microscopes, Microtomes, Laboratory Glass-1 ware, Chemical Apparatus, Chemicals, Photo I Leases and Shutters, Field Glasses, Projection I Apparatus, Photo-Micro Cameras are used by I the leadingLab-^___^__ oratories and I Gover'nt Dep'tsM 55 Round the World 30 SCOPES Catalogs^: BJ Free Bausch & Lomb Opt. Co. I ROCHESTER, N. Y. ^New York Chicago Boston Frankfurt, G'yJ PATRONIZE OUR ADVERTISERS. HOTEL GETTYSBURG HEADQUARTERS FOR BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES ©2.00 PEK DAY. Proprietor, T^e AMelI}ar} Hardware Go. Manufacturer's Agent and Jobber of Hardware, Oils, Paints and Queensware Gettysburg, Pa. THE ONLY JOBBING HOUSE IN ADAMS COUNTY EMIL ZOTHE COLLEGE EMBLEMS Engraver, Designer and Manufacturing Jeweler, 716 CHESTNUT STREET, PHILADELPHIA. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes All Goods ordered through F. A. Faust. >

The Mercury December. 1895 ADVERTISEMENTS. Eagle H°tel, 0) >- IS si ♦ I e 9 ©©ttysburcj, IPa. W. T. ZIEGLER, PROPRIETOR. THE CHARLES H. ELLIOTT CO., Carriages for the Battlefield can be secured at the office. John fl. Minnigh^ onfeetionepxj ^|©e^peam, OYSTERS Stewed and Fried. No. 17 Baltimore St. S. A, Fl^OXEL'S •illiarcL M Wool WiOmtiB BdLTIMOQLE ST •*P©NSOSB MYBfiS,^ WAT6HMAKER AND rTEWELER, Gettysburg Souvenir Spoons, College Souvenir Spoons, No. 10 Baltimore Street, GETTYSBURG, PENN'A. ''{mm &C;0" Hats and Gent's Furnisher, 33 North Third Street, Opera House Block, HARRISBURG.PA. Latest Styles in ^£&v Sttj*»Mt, R M. ELLIOTT'S IT. B.—Stiff Hats undo to Fit the Head in two minutes. Eckenrode &* Earner, DEALERS IN Iptresto ieefc'Vealc (karat,, Pork5 Paddlteg,, Sa«o sag©» tCacrasj, B.aird!» &c" Chambersburg Street. i^lJII 60I2FE6TIOI2E^Y AND IGE 6REAM. ©YSTE&S IH SEASOT, NEWS DEPOT AND SUBSCRIPTION AGENCY. Main St. ITZIL}ILLEJ( NATS, CAPS, —~" BOOTS*SHOES. G^Satisfaction Gua ra nteed.Sja Afa. (5 J?. Baltimore Street, GETTYSBURG. PA. -*LEVI REINECKER,^ DEALER IN FINE GROCERIES AND NOTIONS, » Nos. 16 and 18 W. German Street, BALTIMORE, Offer to the trade their large and well-selected stock of Make a specialty to have on hand everything required by Pharmacists. A complete stock can at any time be selected or wants supplied. ALQNZQ L. THOMSEN,^- BACK, WINDER, SHAEP AND LEADENHALL STS., p. O. Box 557, Baltimore, Md, I heg to call to tlie attention or the Trade tliat I have re-cently added to my Want a complete set of Drug Milling Ma-chinery ot the most Improved pattern. " G. ». SPMGLB8, ~ Successor to J. W. Eicholtz & Co., DEALEB IN VMMOS, ORGANS, MUSIC, MUSICAL INSTRUMENTS, STRINGS, Etc. No. 21 BALTIMORE STREET, Gettysburg. A temperance house. Pleasant and home-like. Teams and Guides to all points of interest on the battle-field. -StJggSQeY&B&B 2&$ZW£.=S2?0 No. 127 Chambersburg St., GETTYSBURG, PA. JOHN E. PITZER, MEMBER POST 9, G. A. R. ABB' ic -DEALER IX-Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, (Pocket (Books, Trunks, Telescopes, (Rubber, Etc., Etc. AMOS ECKERT. H ( (LWY HOT Gettysburg, Pa. JOfil] E, HUSHES, PROFIT Tins Hotel is situated on Main street, one square from P. and It. and W. M. R. R. Depots and within one-half minute's walk of the Diamond. Every room is heated, and lighted by electricity. Parlors on first and second floors. Bath and Toilet rooms on second floor, gratis to guests. Rates $1 50 to $2.50 per day. Rooms without Board 50 cents and upward according to location. Excellent accommo-dations for 250 people. Electric cars stop at the door eveiy half hour. Livery Connected, with first-class Teams, and Battle-field Guides at Low Hates. Dinner with Drive over the Battle-field SI.35. The College Mefcufy. VOL. HI. GETTYSBURG, PA., DECEMBER, 1895. No. 8. THE COLLEGE MEHCUHT, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor: D. EDGAR RICE, '96. Associate Editors : EDNA M. LOOMIS, '96. GRAYSON Z. STUP, '96. HARLEN E. GLAZIER, '96. WEBSTER C. SPAYDE, '96. WILLIAM E. WHEELER, '97, HERBERT D. SHIMER, '96. ROBIN B. WOLF, '97. Alumni Association Editor: .REV. D. FRANK GARLAND, A. M., Baltimore, Md. Business Manager : WILLIAM G. BRUBAKER, '96. Assistant Business Manager: E. A. ARMSTRONG, '97. »"",,". /One volume (ten months). . . . $i.rn iLiiars. |slngle copies .15 Payable in advance All Students are requested to hand us matter for publication. The Alumni and ex-members or the college, will favor us by sending Information concerning their whereabouts or any Items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the business manager. Matter Intended for publication should be addressed to the Editor Address, THE COLLEGE MERCURY, Gettysburg, Pa. CONTENTS. EDITORIALS, THE DUTIES OF THE WEALTHY TO SOCIETY, A FANCY, -- COLLEGE LOCALS, ALUMNI NOTES, FRATERNITY NOTES, ATHLETICS, --- TOWN AND SEMINARY NOTES, - - - - 128 129 132 132 135 136 137 139 LITERARY SOCIETIES, EXCHANGES, - 141 - Hi EDITORIAL. THE subject of student self-government has of late been receiving considerable attention from the students of various colleges, and the general sentiment seems to be that its adoption would effect a great improvement in college life. It is our intention to present the subject to the students of Gettysburg College, in the hope that they will at least think of the advisa-bility of its adoption here, and if it is consid-ered at all practicable, that they will use the columns of the MERCURY for its discussion. The plan originated at Amherst and has been in successful operation there for quite a number of years, and is briefly as follows : In addition to the Faculty there is a student Senate, selected by the students, and consist-ing of four Seniors, three Juniors two Sopho-mores, and one Freshman, to which matters of decorum, and all others pertaining to the stu-dents are referred. The decisions of the Sen-ate are passed upon by the Faculty, and of course may be reversed by it if considered ex-pedient, but such reversals would undoubtedly be infrequent. Such a system, being, as we believe, entirely practicable, could be adopted by ourcollege with great advantage to both the students and the in-stitution. Much is said about student honor, but oneis compelled to believe that under the present system of college legislation this quality of the student receives but little recognition and en-couragement. Instead of being left free to act of his own accord in a manner to which the training of a Christian home and his gentle-manly instincts would prompt him, he is met on every side with rules and prohibitions. He is compelled to attend public worship on Sun-day and chapel during the week, and required to promise that he will refrain from profanity, 129 THE COLLEGE MERCURY. Sabbath desecration, and in short the whole catalogue of sins to which young men are prone. While we readily admit that all these re-quirements are just and proper, yet we are not willing to believe that compulsion is necessary in order to have students observe them. Those who are naturally well disposed grow restless at being compelled to do what they would most gladly do of their own free will, while those who have no inherent regard for right or propriety will generally do as they please de-spite the rules and prohibitions. The result of this method of treating the student has been »to create in him the feeling that the Faculty is hostile to him rather than friendly, and chafing under the restrictions placed upon him, he loses the respect for his instructors which they really deserve, and which it is necessary for him to have in order to obtain the most satisfactory results of his work. The Faculty on the other hand, by the discontent and constant opposition of the stu-dents become more confirmed in the opinion that they are to be suppressed by stronger re-strictions, rather than pacified by the removal of the restrictions. It is gratifying to see that this feeling of un-friendliness between Faculty and students is generally growing less, but if the students were given a part in their own government, it would disappear entirely. As soon as they would realize that the Faculty are willing, in a practical wa}', to recognize the fact that stu-dents have noble motives which influence them more strongly than compulsion, their feelings toward the Faculty would be greatly changed, and they would take delight in doing that which is now distasteful, simply because it is compulsory. Another very important advantage of the co-operative system is that a stricter discipline could be enforced than the Faculty acting-alone, is able to maintain. We do not wish to be understood as saying that the discipline in our college is more lax than formerly, for we do not believe it is, but the fact is nevertheless evident that there is much room for improve-ment in the conduct of the students. There are numerous instances of misconduct which are disgraceful not only to those who commit them, but to the whole body of students, as well as injurious to the reputation of the col-lege. These acts are, indeed, strongly de-nounced by all the students who have a regard for the right, but as none are willing to incur the unpopularity attached to one who gives evidence against his fellow student, the Fac-ulty is in many cases unable to punish the offenders as they deserve. If, however, the students were giv.m a share in their own gov-ernment, they would take a greater interest in preserving the reputation of the college, and cases which would come before them would be almost sure to be decided justly and impar-tially. Being entirely in the hands of the stu-dents, no individual unpopularity would result from any decisions of the Senate, but they would be supported by the whole body of stu-dents, and their enforcement made more cer-tain. Of course this whole matter of self-govern-ment rests on the question as to whether our students wish to raise the moral standard of our college, or are willing to let matters re-main as they are. The expressions of dissat-isfaction with prevailing conditions are suf-ficiently numerous and general, but if it is to stop at this, nothing more need be said. If, however, some definite action is desirable to improve these conditions, the self-government system is at least worthy of consideration. * ** SUPPLEMENTING the remarks made in our last issue concerning the recommendation of the West Pennsylvania Synod to prohibit our intercollegiate foot-ball contests, we wish to give the following statements, which we think will serve to show that it is not the sentiment of the larger colleges that these foot-ball con-tests be prohibited. The first is from an address to the Senior class on Nov. 4th, by President Patton, of Princeton, and is a most decided approval of THE COLLEGE MERCURY. 1.30 intercollegiate contests. He said in substsnce: "I am well aware that many forces operate to make a college and no one appreciates the benefits arising from intercollegiate athletics more than I. Foot-ball is a factor that cannot be overlooked in building up a college, and I was heartily gratified to learn of the amicable ar-rangement for annual games with Harvard. I The intellectual and moral sides of college life are paramount, but going hand in hand with these are the healthy exercise of mind and body, and the attainment of physical culture." The evidence of a man of so great experi-ence in presiding over a college as Dr. Patton is deserving of much consideration, for it is in the larger colleges, if anywhere, that evil re-sults follow these intercollegiate contests. The second article is from President An-drews, of Brown University, and if we can be-lieve him to be a careful observer, the game which is generally spoken against as so very i brutal, is not as dangerous as other college athletics. In his annual report Dr. Andrews . says : "For those in perfect health and trained to it, foot-ball is safer than either rowing, ! yachting, gunning or running hounds. Row-ing appears to be many times as fatal. So is base-ball. Even tennis is worse." These statements, coming from the presi-dents of two of our largest institutions may be taken as the expression of the sentiment of all ! the larger colleges, and surely there is nothing in them to indicate that intercollegiate foot-ball is losing favor as a college sport. On the contrary, they show that its importance is be-coming more and more recognized. Disregarding the merits of the game itself, the Synod seems to show partiality or rather inconsistency in thus discriminating against Gettysburg College. Midland College, Kan-' sas, which is supported directly by the appro-priations of various synods, boasts of having one of the best foot-ball teams in the state of Kansas, and yet we have not heard of any reso-lutions recommending the cessation of foot-ball contests. Other Lutheran colleges also pay great ■ attention to their athletics without any objection being raised, and why Gettysburg is singled out is more than we can understand. * * * OUR foot-ball season closed early on account of the many difficulties with which the man-agement had to contend, but we hope that dur-ing the coming year these difficulties may be-come less instead of greater, and that next season we may achieve the success of which we are capable under favorable circumstances. AT Franklin and Marshall recently, Presi-dent Stahr announced that by a resolution of the Faculty every student not a member of a literary society must of necessity be a member of the classes in elocution, in addition to the extra work in composition, etc., before re-quired. It would be well if our Faculty would follow the example of the F. and M. Faculty, and enforce strictly the rules they have made in regard to joining literary societies. More interest must be taken in our societies if we do not wish them to decline, and as per-suasion and argument seem useless, the socie-ties ought to insist that the Faculty enforce the rules which have been made on this subject. * * * OUR students have been very fortunate within the past month, in having the oppor-tunity to hear the series of lectures on the social problem by Dr. Stuckenberg. This prob-lem is one of the most serious and important of the present time, and all who heard Dr. Stuckenberg's able discussion of it were very much enlightened and benefited thereby. THE DUTIES OF THE WEALTHY TO SOCIETY. Seldom does a wealthy man hear the injunc-tion, "Sell that thou hast and give to the poor." Once, long ago, a young ruler heard these words, and it is recorded that he "went away sorrowful for he had great possessions." It would seem that a rich man's first duty is to give to the poor. He has an abundance and can give, not with sparing hand, but roy i-31 THE COLLEGE MERCURY. ally. He is not compelled to limit charity to the beggar at his gates ; he can found institu-tions that shall bring knowledge or health or even life, to thousands, and his name shall be blessed by many. " Wealth brings power, and power always brings responsibility. The wealthy man may have neither a brilliant intellect nor unusual talent ; in this case he will be excused from moving millions by ''one ink drop on a single thought," he will be excused from making any great inventions, and he will hardly be expected to revolutionize the world by his startling discoveries in the realms of science and art. His duty lies in a different direction. Let him take care how he spends his money. There are plenty of brilliant intellects going to waste from lack of money to cultivate them. If the rich man invests some of his wealth in a poor man's brains he may be able to do great things in the intellectual world by proxy. This is the next best thing to doing them in person. There are plenty of college.? needing endowments ; it may almost be said of them that their name is Legion. What more last-ing monument can any man erect to his mem-ory than a fine college building ? And, pos-sibly, some of the students will enjoy their comfortable quarters more than the epic which the founder might have written, had he been a poet. Such is the depravity of human na-ture. Money means so much. As long as the soul dwells in the earthly body it longs for material comforts and luxuries. All these the rich man has at his command. If he does his duty, he will not keep them all to himself; life is un-certain, and he may enjoy them only a day. He will divide them up a little and find his greatest delight in the pleasure of others. But he need not stop with this. Money means far more than material enjoyment. The rich man with an average amount of brain power has no excuse for not knowing some-thing. He is released from the drudgery that wearies the rest of the world. His time is at his disposal, and if he wastes this, what can be said of him ? It is his duty to give to the poor, but it is also his duty to give something to his poor soul, and not let it go starving into eternity. God gives him the grandest oppor-tunities, and what can he say if these are neg-lected ? When the wealthy class are educated and cultured, it will be the fashion to be educated and cultured. They are the leaders in society and they can do more for its elevation than any one else. They can open their doors to those who are fitted, by nature and learning, to move in the best circles, and close them against those whose admission is only bought by money. Society need not be merely a show, a hollow pretense. It should be some-thing more satisfying than this. It lies with the rich to uphold the standards of truth and right ; yes, and the standards of purity and common sense. The wealth}' woman can, per-haps, do more for society than the wealthy man. The spending of her dollars has such an influence upon the spending of her poorer sisters' dimes. If her church dress is of silk or velvet, she may still gain a great deal of benefit from the sermon ; but how is it with her neighbors? Possibly, one whose plain gown is pretty and suitable feels a little stir-ring of envy in the depths of her soul. If if she could only array himself like that. Another one, perhaps, whose shabby gown is brought out in startling relief by so much ele-gance, firmly determines to stay away from that church in the future. Well is it, if she does not go further and pronounce church-goers a vain lot. Yet, the wealthy ought not to deprive them-selves of all beautiful, luxurious things. They are a part of the blessing of wealth. A wealthy man has a right to a beautiful home and to elegant surroundings. The)' tend to refine-ment and culture. There is no reason in the world why he should not gratify his tastes in this direction ; there is strong reasons why he should. If art, music, and literature are to be kept alive at all, they must be kept alive by the wealthy classes. The wise use of money THE COLLEGE MERCURY. 132 has nothing whatever to do with penury in the case of a man who has an abundance. If he has a wise, good heart, he may spend his money f.eely, even for self gratification, and 110 one will suffer thereby.' ;A woman who distinguishes between things temporal and things eternal may be attired elegantly without proving a stumbling block in the way of any one. It is hard to observe the fitness of things when pride comes in ; but things fall into their proper places of themselves when one remem-bers that "the glory of man is as the flower of grass." To the wealthy are given great responsibili-ties, but great privileges. The responsibility of power and influence and example ; the re-sponsibility of spending wealth ; of settling the standards of society, and of influencing their fellow men. They have the privilege of receiving blessings from many grateful lips and of hastening the day when social purity and justice shall reign. God gives to some his good things in keeping, and let them be care-ful how thev fulfill the trust. E. M. L., '96. COLLEGE LOCALS. GRAYSON Z. STUP and ROBBIN B. WOLF, Editors. A FANCY. Very early one Autumn morn. Before the first flush of coming dawn Had touched the sky with roseate hue, Or scattered the morning mist of dew, I saw—afar in the cloudless sky— Crescent-pointed, sailing high, The waning moon, like a tiny hoat, In a sea of boundless blue afloat; Just a slender, silvery, thread Sailing serenely overhead. Oh, where are you going, little boat. As through the azure dome you float? Where are you bound, as you sail along Thro' all the silent, starry throng. Is there some dim and distant strand Far, far away from this mortal land, Some celestial, glorious shore To which you are sailing evermore? And do you hope, some day, to reach The haven of that shining beach ? Sail on oh, little fairy boat Still onward thro' the azure float, Who knows what precious freight you bear, What wealth of heavenly treasures rare. Perchance some bright, angelic band You carry to that shining strand. We do not know, we only see Thee, sailing onward silently, And wonder at the silver boat In heaven's boundless blue afloat. A. R. W., '99. Thanksgiving ! Big dinners ! Institute ! School marms ! Get ready for examination, boys. Long vacation this Christmas. College closes on Dec. 20th at noon and opens again for the winter term on Jan. 7th, 1896. Thanksgiving day dawned very beautifully. It was an ideal day, and even the heart of the most ungrateful wretch must have felt like giving praise on such a ,day. The boys were especially happy, because the day was given as a holiday. Not even the first recita-tion was heard. Many of the boys went home. Those who stayed here lived off the fat of the land at their respective boarding places, and after their feasts were over many were seen on the streets and in the country, walking with friends and fair ladies—many of them modest little school teachers. While the Institute, with its many teachers, is fresh in our minds, we might notice some effects upon college life in general. No one would question that the Institute is a good thing for Gettysburg. It has proved so as re-gards the college boys. Many of them, who were never known to be out much with the ladies, have decided to take lessons under their instructions. Quite a few had courage enough to venture upon the campus with them, even though their fellows, from the dormitory win-dows, whistled that familiar march so well known. Their courage did not fail, even, when they were invited to bring back the col-lar and handkerchiefs they had borrowed. The college athletic field is about completed. The fence is being put up and, in fact, is nearly finished. It is eight and a half feet high, and is made entirely of chestnut. The grass seed is up nicely, and by next spring the field will present a first-class condition for base ball. We ought to have a strong team to initiate the work on the new field. Gymnasium work began on Nov. 4th, with Physical Director Wheeler, dressed in his best suit of tights, ready to take charge of the classes. He was a little nervous when he looked up and saw the gallery filled with spec-tators, among whom appeared some of the 133 THE COLLEGE MERCURY. co-eds. But in spite of all the eyes fixed on him Billy gave the command—"Attention"— and everybody obeyed. He is getting along very well with his work. About three weeks ago a glee club was formed, consisting of eight members. On ac-count of the number it is denominated "The College Octet." It originated out of an invi-tation extended to the musical clubs of the col-lege to furnish music at the Institute. There being no Banjo nor Mandolin clubs, some of the boys in the old Glee Club, with one new fnan, formed the organization. The members are as follows : Nicholas, '98, and Ott, '97, first tenors; White, '97, and Stup, '96, seco.id tenors; Lark, '98, and Koller, '98, first bass; Stamets, '99, and Manges, '97, second bass. The Octet furnished music on Monday and Tuesday evenings for the Institute. Many very favorable criticisms were passed on the songs. On Monday evening, Nov. nth, a good trick was played at College. Good, '99, was reported to have been stoned by those pestifer-ous town boys and it was said that his face was cut very badly. Naturally the boys' sym-pathy would be aroused and no very urgent invitation would be needed to get them to go to his room to see him. When they got there this is what they found. A number of boys in the study room, a dim light in the bed-room, and a form in the bed. The faces of the boys had that woe-be-gone expression that in-dicates the awfulness of something ; the light was so dim that it suggested the chamber of death ; and the form in the bed had the ap-pearance of a human being. However, when the sympathizing visitors were led up to the bedside silently on tiptoe, and the other long-faced boys were standing around, the dim light was suddenly turned up and the cover thrown back, then it was that the form of a good-sized pillow was seen. Then the longitude of those boys' faces standing around suddenly changed into latitude. From time to time the hearty peals of laughter that were heard told that another fellow, who had per-haps gotten up out of his nice warm bed, had been victimized. Just about a hundred boys, from every class in College, and some from Prep, were faked. So effectually did the trick work that Good, who was up town during the evening, was made a victim, his chum having been reported to be the unlucky one. Some of the Seniors were fooled so badly that they got sick, and flunks were quite in style the next morning. So it will not do to have many such experiences. One good trick goes a long dis-tance. The boys will have to get hungry be-fore they will bite on such bait again. A series of six lectures on Sociology by J. H. W. Stuckenberg, D. D., was given in Brua Chapel from Nov. 18th to 23rd. The lectures were given in the evening and lasted a little over an hour. The main auditorium of the chapel was well filled each evening, and much interest was manifested. Dr. Stuckenberg is an able speaker, and his reputation as a scholar brought many strangers to hear him discuss the great problem of society. The public is indebted to the Missionary Society of the Seminary tor Dr. Stuckenberg's stay with us. The balance of the money remaining after ex-penses are paid will go for the purpose of fit-ting up the new gymnasium in the Seminary. The following is a list of tlie subjects lectured upon : 1. What is the Meaning of the Social Prob-lem ? 2. What are the Causes of the Problem ? 3. The Social Problem in the United States. 4. Solution by Revolution : Communism, The Social Democracy, Anarchism. 5. The Solution by Evolution. 6. The Function of the State in the Solution of the Problem. The Lecture Course Committee takes pleas-ure in announcing the course of entertainments for this season. The course is an excellent one, surpassing that of last year in price. The committee, being very desirous of having Gen. Gordon, had to sacrifice the arrangement of the entertainments. This explains why they are in such close succession. The following is the course : Jan. 22—Lovett's Boston Stars. Jan. 27—Col. Copelaud. Feb. 22—Gen. J. B. Gordon. Feb. 25—New York Male Quartette. Mar. 17—Rev. A. A. Willets, D. D. Somebody said that he thought Bruby had very hopeful signs of being married before long. When asked why, he said: "I see that the arch is up." The boys must have seen the arch when they were out to the Battlefield Hotel fire. Prof. H.—What is the object of a minister? Ans.—Saving souls. Prof. H.—How does he do it? Ans. (after long reflection)—By not walk-ing on them. THE COLLEGE MERCURY. 134 Messrs. Brubaker, '96, and Lutz, '98, have purchased a graphophoue. About two weeks ago they gave an entertainment in Brua Chapel for the benefit of the Athletic Associa-tion. The instrument is an improvement over the phonograph and reproduces the music very nicely. The proprietors were well advertised on the bulletin board before the concert. A crowd of sympathizing Freshmen, wish-ing to aid in a charitable cause, recently sub-scribed the necessary amount for another scientific man to have his curly locks trimmed. The collection was gladly accepted, and now the curly-headed lad no longer gets late at church. Dr. H.—Whom did the Lord tell Moses to take along up into the mountain ? S., Jr., '99—His brother Exodus. M., '96; suprised the class in astronomy the other morning when he said that an eclipse has the effect of making birds and other ani-mals go to roost. Mr. W., '95, reading Bacon's essay on "Studies," said: "Reading maketh a man full." Even Prof. H. could not restrain his laughter. Mr. L-, '98, was lately seen strolling over Balto. Hill prominently exposing his suspend-ers. Many of the boys spent Thanksgiving day and the remainder of the week at their respect-ive homes. They can hardly know how good Adams county turkey is. Mr. S., '97, while at Mr. B.'s reception, spied the olives and asked one of the young ladies to pass him the pickled plums. Mr. Z., '98, had just passed the P. & R. depot and was telling a freshman how high the snow had drifted there last winter and how his whole class conspired to stay out of mathe-matical recitation the day of the blizzard. Just then Dr. N. loomed out of the darkness and said: "Yes, and I'll catch you some day." Very sad, indeed, was the disappointment of the boys who went to St. Mary's to see the foot-ball game when they found that the game had been cancelled. The class of '97 was royally entertained on Tuesday evening, Oct. 28th, by Mr. H. W. Bikle. It was our first reception and the boys looked forward to it with great expectations. Our expectations were not only realized but far surpassed. The class assembled at the home of the host about half-past eight. Great was our joy when we beheld some of the fair sex of G. 011 hand who were to share the hon-ors of our co-eds. Everybody was cordially received by Dr. and Mrs. Bikle who then re-tired, having given the young people full charge. The first part of the evening was spent in pitching bean bags. This game was enjoyed by all since some of the boys could not' even hit the board. The winning side then went out to the dining-room where a bountifully laden table awaited them. Every-thing was served beautifully and the refresh-ments were enjoyed by all. The winning side then retired to the parlor to give the losers an opportunity to enjoy the feast. While the losers were eating they were entertained by the melodious voices of the Avalon Sextette. After the party was again united in the parlor the}' were entertained Mr. S.'s jigs and piano music by the young ladies. Then we all sang —except Pearl, who has not acquired the art— till our throats and music were exhausted. The clock had passed the hour of midnight when we adjourned, thanking Mr. B. for his kindness and congratulating him on his capac-ity as a host. It was an event which will be long remembered by us all. Many of the boys attended Institute during the past week and had the customary good time with the school marms. Some of them were so much interested in the work that it seriously affected their recitations. Mr. E. of Prep., displayed the Persian fond-ness for strangers by sitting in church with his arm around one of our co-eds. The Juniors are hard at work on their Spec-trum. The Spectrum will be of special interest since it includes matter of the last two years. If any of the students or Alumni have not sub-scribed for it they should do so immediately. If Gettysburg College is to publish an annual it must have the support of all its friends. Mr. B., '96, who has lately been troubled with nervous fluctuations of the heart, finds it a wonderful restorative, when calling on young ladies, to keep on his overcoat and gloves. That's hard luck, Bruby. One of the most able men in the Junior class, after he had been out with the ladies all morn-ing, suddenly asked the boys at the dinner table whether a duck was the he of a geese. He must have been suffering from temporary aberration, his mind wandering after his duckie. '-35 THE COLLEGE MERCURY. While Mr. Bikle, '97, was working in chem- j ical laboratory recently, he had an accident by which he was seriously burned about the eyes by sulphuric acid. He has the sympathy of all his fellow-students. The following is a brief lesson in '97's nom-enclature. One Friday, when the Duck was out strolling, she was sud- , denly attacked by the Mange(s). She at once went to the \ Miller and asked him what she Ott to do to get rid of it. The Miller said he was not Abel to give her a remedy. But as the Duck walked along, it made her Sh(r)iver to see a White Wolf in the bushes eating (h)Erbs. The Wolf was just about to sieze the Duck when the Smith came riding down the road on his Bik(l)e, and he, being very Armstrong, slew the Wolf with his Kain. The Smith then got on his Wheel(er) and brought the Duck safely to her Stahl. BEFORE THE FRESHMAN-PEEP. GAME. Before you crash 'gainst Freshies' line Just think it over. The challenge, Sirs, do not decline, ■ But think it over. . It is not wise to be too new Because, before the game is through, Your bright prospects may all turn blue, So think it over. Don't spend your cash for painted signs, But think it over. The score towards you of course inclines But, think it over. We've heard of teams beaten before With a smaller difference in the score, And it might be done just once more. So think it over. We did not practice, Sirs, to lose. So think it over. We care not for a break or bruise So think it over. As soon as our men reach the field, It certainly won't be to yield. But henceforth shall the score be sealed. So think it over. H. M. C, '99. Y. M. C. A. NOTES. We were glad to see the interest taken in our meetings during the week of prayer. Al-though there were none who openly professed Christ as their Saviour, we are sure that none could have attended the meetings without re-ceiving much benefit. The topics for discus-sion during the week were : "For What has God Created Me?"—Dr. Valentine; "Christ our Righteousness"—Rev. Black; "An Invi-tation to All"—Dr. McKnight; "Excuses"— Rev. A. R. Steck ; "What Shall I do with Jesus Which is Called Christ?"—Dr. Bill-heimer. Our delegates to the Y. M. C. A. Conven-tion at Erie, brought home a very interesting and gratifying report. May the great Y. M. C. A. work go on. No one can estimate the value of good music. It perhaps exerts more influence in our meetings than the words which are spoken. Everybody come and help us sing. We shall appreciate your presence. The Missionary Bible Class is exceedingly interested in the study of God's Word. We would be glad to see interest in work of this kind more general. The Bible will admit of the profoundest stud5'. On Wednesday evening, Nov. 13th, Rev. M. S. Kemp delivered an address in the Pres-byterian church, on his summer's work in Adams county for the Bible Society. The fol-lowing are statistics given : Number of fam-ilies visited, 3250 ; number of families found entirely destitute of the Bible, and which he supplied by sale or gift, 230 ; number of fami-lies who had nothing but a large Family Bible, 519; number of families who, though not en-tirely destitute, needed the Bible, yet were too poor to buy, and which he supplied, 260 ; number of Roman Catholic families to whom he sold Bibles (King James Version), 25; number of Roman Catholic families who were supplied, 60; number of copies of the Bible sold and donated throughout the county, 419 ; number of Testaments and other parts of the Bible sold and donated, 744 ; total number of books sold and donated, 1163 ; amounting to the value of $400. ALUwiNl. H. D. SHIMER, Editor. '53. Rev. W. F. Ulery was in Gettysburg for a few days recently. '57. Rev. Dr. L. A. Gotwald, Professor of Practical Theology in Wittenberg Theological Seminary, was stricken with paralysis a few weeks ago. Dr. Gotwald's illness is a source of great anxiety to the entire church. Our latest intelligence is that his condition is im-proving. '57. Rev. Dr. H. Louis Baugher has lately returned from his western trip. '58. Rev. Dr. A. R. Home, whose cut was lately published in one of the leading papers, is editor of the National Educator. Dr. Home THE COLLEGE MERCURY. 136 is well known throughout the State as an educator, and is worthy of the position he holds. '63. Rev. Dr. E. J. Wolf assisted in the re-dedication of the Lutheran Church, at Seven Valley, York county, Nov. 17. '64. Dr. T. L- Seip, president of Muhlen-berg College, was appointed by Governor Hastings a member of the College and Univer-sity Council of the State of Pennsylvania, and by them elected chairman of the Council. '68. Rev. L. M. Heilman, D. D., of Chi-cago, now about to take charge at Harrisburg, Pa., was the recipient of very cordial expres-sions of love and good wishes from his Chi-cago people. '71. Mr. M. Allen Emory has located at Frenchtown, N. J., and is enjoying a lucrative law practice. '73. Rev. J. A. Singmaster, D. D., of Al-lentown, Pa., has received an increase of $300 per year 011 his salar3'. '73. Rev. Wm. S. Freas, D. D., of York, Pa., president of the Board of Church Exten-sion, was elected the principal speaker at the Luther League meetings, held in New York city and Brooklyn, on Nov. 10th and nth. '75. Rev. Dr. E. D. Weigle has decided to accept the call from the Lutheran congrega-tion of Mechanicsburg. It will be remembered that a call was extended him a few weeks ago, which he refused at the request of the people of the charge which he is now serving in Al-toona. '75. Rev. E. G. Hay was in Gettysburg during November, visiting Prof. Himes and family. '76. Rev. S. E. Smith, pastor of Punxsu-tawney, Pa., is hard-working and successful in his parish efforts. '79. Rev. Geo. S. Diven has been called to St. Paul's Lutheran church, Iredell county, S. C. '84. Rev. L. M. Zimmerman, pastor of Christ English Lutheran church, Baltimore, Md., recently preached upon the subject: "Who are Lutherans." The Morning Herald, of October 28th, contains an excellent extract from it. '88. On Thursday afternoon and evening, November 14th, the semi-annual meeting of the Central Lutheran Association of Pittsburg and vicinity, was held in Bethany church, East End. Rev. S. D. Daugherly was one of the speakers. '90. Rev. J. F. W. Kitzmeyer, of Davis, W. Va., has been called to the new English Mis-sion in New York city. '91. Rev. S. Griug Hefelbower's address is 'changed from 13 Emilien street to Floss Platz, Leipsic, Germany. '92. Dr. August Pohlman, of Baltimore, a graduate of Pennsylvania College, has been elected valedictorian by the graduating class oi the Baltimore Medical College. '92. Rev. George Beiswanger has changed his residence from No. 2233 Gough street to No. 1722 Fulton avenue, Baltimore, Md. '92. Emanuel W. Herman, Esq., of Luther-ville, Md., was elected to the Maryland House of Delegates at the election held in November. '93. We are glad to note that George C. Baum, who is a member of the Senior class in the School of Architecture at Philadelghia, re-ceived second mention from the Society of Beaux-Arts Architecture, awarded on the last competitions of that society. '93. Mr. D. Floyd Culler is pursuing a graduate course in Romance Philology at Yale University. '94. Margaret R. Himes is suffering from a severe attack of pneumonia. FRATERNuY NOTES. PHI KAPPA PSI. The Chapter will celebrate its fortieth anni-versary this month. . D. P. Forney, '57, has been elected presi-dent of the Adams County Farmers' Associa-tion. Rev. L. A. Gottwald, D. D., '57, was stricken with paralysis at his home, in Spring-field, O. John C. Bowers, '93, attended the wedding of a former classmate at Frederick last week. Keefer, '95, has entered a business firm in Reading. Witman, '95, attended the Seminary conven-tion at Lancaster last month. Graff, '97, has gone into the lumber busi-ness in Duluth, Minn. '37 THE COLLEGE MERCURY. Reitzell, Eisenhart, Kueudig and Lark spent Thanksgiving day at their respective homes. Weaver, '99, spent the holiday in Philadel-phia. PHI GAMMA DELTA. Bro. Meade D. Detweiler, '84, was re-elected District Attorney of Dauphin county at the last election. He managed the affairs of the office so satisfactorily to all that he was re-elected by a majority greater than the num-ber of votes cast for his opponent. Bros. Alleman and Garland attended the lectures delivered by Dr. Stuckenberg. Bro. H. M. Roth, of Bucknell Chapter, was a visitor to Gettysburg recently. Bro. Fite represented the Chapter at the 47th annual convention held at Eastou, last week. Bros. Rice and Shaar spent Thanksgiving at their respective homes. Bro. C. H. Smith, attended the reception at Irving, Thanksgiving night. Bro. Neudewitz preached at Rossville, last Sunday. Bros. Valentine, Ph. D., '80, Stabler, '82, and Bliut, '90, were recent visitors in town. PHI DELTA THETA. Bro. J. F. Seibert, '89, paid the Chapter a visit the beginning of the month. Bro. E. O. Grover, N. H. Alpha, '94, spent last week in town, in the interests of Kellogg &Co. Bro. Sloop spent Sunday, Nov. 17, with his parents, at Steeltou, Pa. Bro. Meiseuhelder spent Thanksgiving at his home, in Hanover, Pa. Bros. Smith and Friday spent election day at their respective homes. Bros. Kain and Meiseuhelder attended the Alpha Province Convention, held at Schenec-tady, N. Y., with N. Y. Beta, Oct. 31-Nov. 2. SIGMA CHI. Bro. Garnet Gehr, '91, was recently ap-pointed attorney for Wolf & Co., a large man-ufacturing firm of Chambersburg. Bro. Edwin J. McKee, '88, gave the address of welcome to the visiting firemen at Hagers-town, Md., on Thanksgiving Day. He is also a member of the board of directors of the Hagerstowu Athletic Association. Bro. Leisenring spent Thanksgiving with his parents at Chambersburg, Pa. Bro. Lawyer spent Thanksgiving with his parents at Westminster, Md. The Chapter recently- had their pictures taken in a group in front of the Chapter lodge. Brother William Hersh, '91, will be married on the nth inst. to Miss Edith Eunice Rahter. The best wishes of the Chapter are extended to him. C. E. Stable, '87, visited the Atlanta Expo-sition. ALPHA TAU OMEGA. W. B. Nipple, '97, spent Thanksgiving Day with friends at Harrkburg. M. R. Zullinger, '98, was home over Thanksgiving Day. C. W. Spayde, '99, spent some time recently at his home in Harrisburg. P. W. Roller, '94, of the Seminary, spent a week recently at Lancaster, Pa. Geo. W. Kyner, '89, of Chambersburg, was in town on business some time ago. ATHLETICS. WILLIAM E. WHEELER, Editor. The last game of foot-ball for this season was played with Swarthmore at Harrisburg, on Nov. 2nd. The Harrisburg papers, com-menting upon the game, said : It was one of the prettiest ever played here. Both teams played with a dash and brilliancy, surprising even the admir-ers of the game. The teams were about evenly matched, and it is out of the question to say one out-played the other. The ball was first put into play by Gettys-burg kicking well into Swarthmore's territory and downed there. S. lost on downs and Get-tysburg took ball, but was unable to advance it and lost it also on downs. By short, sharp dashes through lines S. rushed ball to 20-yd. line and there lost it. Gettysburg made some very fine runs around S.'s ends, and the ball was back on their 30-yd. line. Here it was lost on a fumble to S., who advanced it by massed plays through the line to Gettysburg's 25-yd. line; but Gettysburg held S., compell-ing them to kick. The ball was blocked and secured by Loudon, who had an open field be-fore him. He was overtaken by Hodge, after making a fine run of 45 yds. Swarthmore got the ball for holding in the line, and by runs THE COLLEGE MERCURY. 138 around end and massed plays carried ball up 1 the field, scoring first touchdown. Time was I called with the ball in Swarthmore's territory. Swarthmore kicked off in the second half and downed the ball on G.'s 35-yd. line. Brilliant j runs by White' and Loudon, and plunges [ through line by Sheely, carried the ball stead- i ily back to S.'s 15 yd. line, and then lost on a miserable fumble. S. kicked to midfield, and the ball moved backwards and forwards for some time. One of the most remarkable runs ever made on a field happened by Hodge secur-ing the ball and making a run of 80yds., scor-ing second touchdown. In the run the cap-tain of S. jumped clear over the head of one of G.'s men, who attempted to tackle him. The play called forth much applause. Hodge then kicked goal, and the game was ended with score 10 to o in favor of Swarthmore. The line up of the teams was as follows : GETTYSBURG. POSITION. SWARTHMORE. Moser, (Capt.1 left-end Wilson Manges left-tackle Firth Wierman left-guard Fouse Williams centre Morrison Tholan right-guard Clarke Menges right-tackle Wills Loudon right-end Cahill Carty quarter (Capt.) Hodge Shinier right-half Cloty White left-half Knauer Sheely full-back Kapplcr Umpire—Hickok. Referree—Beruheisel. Linesman—Fick-inger. Touchdowns—Hodge and Kappler. Goals—Hodge- Thirty-minute halves. In our last issue we spoke of the advisabil-ity of more intef-class spirit as far as athletics were concerned. The suggestion was favor-ably commented upon by the student body, and as a result several inter-class games of foot-ball were played, viz.: Freshmen vs. Preps, and Seniors vs. Freshmen. While these games do not affect the standing of the college teams yet they do, in a great measure, keep aflame the athletic spirit. Our place in the ranks with our sister institutions next year will, in part, be due to our interest and assist-ance this Fall. Show the spirit now and the work will surely manifest itself. The Freshman-Prep game was played Sat-urday afternoon, Nov. 16th. It was a very nice game and stubbornly contested. The Freshmen may have had the benefit of longer practice, but what the. Prep's lacked in prac-tice they made up in aggressiveness and weight. The Freshmen scored on a fumble in the first half, Devinney crossing the line for a touchdown and Spayde kicked goal. The second half was marked by quick, sharp play-ing on the part of the Preps. Determination to score showed itself in the play, and this they did in about twelve minutes after play was called. The score was now a tie and neither side was able to score again before time was called. The game was prettily played and both classes were elated over their, teams. The line up was as follows : FRESHMAN. POSITION. PREP. Weeter left-end Kahler Devinney left-tackle Young Cumbler left-guard Dielll Smith, J centre Williams Reisch right-guard Hollinger Brumbaugh right-tackle Mcllhenny Herman right-end Brandt Good quarter (Capt.) Huber Doty (Capt.) right-half Eberly Spayde left-half Lawyer Trimble full-back Wisotzki Umpire-Rudisill. Referee—Kump. Linesmen—White and Menges. Touchdowns—Divinuey, Eberly. Goals—Spayde, Wisotzki. The Senior-Freshman game was played the following Saturday, Nov. 23rd, and was quite a surprise to those who looked for an over-whelming deleat of the Freshmen. They played a much better game than was expected, preventing the Seniors from scoring in the first half. Several times the ball was lost to each side on downs, and time was called with the ball in the Freshmen's territory. The second half was even more marked by the efforts of each side to score. The Freshmen by repeated rushes and a pretty run by Doty got the ball within one foot of a touchdown. Here the superior strength and weight of the Seniors showed itself in preventing the ball from going over the line. They got the ball on downs and immediately rushed it down the field for a touchdown. This seemed to unnerve the Freshmen and the Seniors made two more touchdowns before time was called. Taking into account the greater weight of the Seniors and the fact that several of their men belonged to the college team, praise is due the Fresh-men for their well-played game. The follow-ing was the line up. SENIORS. POSITION. FRESHMEN. Moser (Capt.) left-end Weeter Shaar left-tackle Hoover Jlrubaker left-guard Cumbler Ritter centre Smith, J. Reitzell right-guard Hickman Shinier right-tackle Brumbaugh Wolf right end Herman Rice right-half (Capt.) Doty London left-half Spaj'de Menges full-back Trimble Carty quarter Good Umpire—Geesy. Referee—Wolf. Linesmen—Kitzmeyerand Meisenhelder. Touchdowns—Loudon 2, Rice. Goals—Menges. '39 THE COLLEGE MERCURY At a recent meeting of the Athletic Associa-tion the following were elected for the ensuing year: Manager of Baseball, Armstrong, '97; Manager of Track Athletics, Wheeler, '97; and Manager of Tennis Tournament, Lark, '98. The various managers, are at work dis-cussing'iplans and outlining the work for next season. Now that the foot-ball season is over, we very naturally turn to the next thing of inter-est and importance, namely, base ball and track athletics. Our record on the diamond is by no means bad, in fact it is here that we demonstrated our ability and worthiness to take our place in the ranks with other colleges. But we can't rest on past reputations and achievements. Everyone interested in base ball should be willing and ready to lend a hand. The places of the old players, now out of college, must be filled, and you can do it. Track athletics are not entirely unknown, since attempts have been made to organize a team, but without success. The fault lay not with the management, but with the students. We surely have the material out of which a creditable team can be made, and at the same time facilities for the training and practicing of such a team. Indifference to the need and importance of track work causes all the trouble. Once get the idea that we MUST have a team, and we will have it. The treasurer of the athletic association will call on all members during the next week who are in arrears for dues and fees. Be ready with your cash. TOWN /\ND SEWIINARY NOTES. WEBSTER C SPAYDE, Editor. TOWN. At the Missionary Convention of the Luth-eran Church, which met in Carlisle several weeks ago, Mrs. E. Breideubaugh was elected treasurer; Mrs. P. M. Bikle and Mrs. Baugher, members of the Literary Committee; Miss Maggie McClean and Mrs. C. H. Ruff on the Adams County Conference. The Veteran Association of the 76th Pa. Regiment held their re-union here on Wednes-day, Oct. 23rd. The party included twenty-six of the survivors, many of them accom-panied by their wives and daughters. Two magnificently illustrated lectures by the Rev. M. W. Hamma, D. D., of Washington, were given in Christ church, Wednesday and Thursday evenings, Nov. 6th and 7th. Sub-ject of first lecture: "Southern Norway—'The Wonderland of the North.' " Second lecture: "Through Denmark, Sweden and Northern Norwav to the North Cape under the Light of 'The Midnight Sun.' " On Wednesday, Oct. 23rd. General John Taylor, General j. P. S. Gobin, Colonel John P. Nicholson and Colonel R. Bruce Ricketts, with the artist, H. K. Bush-Brown, and other friends, among them Geo. Alfred Town'send, the war correspondent, viewed the statue of Major General Geo. G. Meade, and, owing to the delay in the granite pedestal, postponed dedication of this, as well as the Hancock statue, until next June. The Hancock statue was approved by the State Commission and an order given for the payment of its cost. The same gentlemen met at Harrisburg, on their way here, and inspected designs for the Rey-nolds monument, but no action was taken. The three massive granite blocks composing the base of the Meade statue are set and the imposing statue, which has been previously described in these columns, placed in position. On the one face are the words, "Major Gen-eral George Gordon Meade, United States Army, Commander of the Army of the Poto-lnac." On the other, "Born December 31, 1815. Died November 6, 1872." Rev. A. R. Steck, pastor of St. James Luth-eran church, assisted at the re-opening exer-cises of St. Matthew's Lutheran church, Han-over, on Sunday, Nov. 3rd. While the Skelly & Warner corner, form-erly the Fahnestock building, was being in part torn down recently, Mr. John M. Warner found an old paper which seems to be an offic-ial list of the men who formed Company E, 2d Regiment, Penua. Volunteers. Dr. J. H. W. Stuckenberg, of Cambridge, Mass., preached in Christ Lutheran church on Sunday morning, Nov. 17th. He also filled the pulpit of the same church on the morning of Nov. 24th. In pursuance of the general plan of restor-ing the battlefield as nearly as practicable to its appearance in 1863, the Government Com-mission has purchased a large number of trees, including leading varieties of oak, maple, ash, elm, and other indigenous trees with which to renew the portions of Ziegler's and Reynolds's groves, which have been cut away since the THE COLLEGE MERCURY. 140 battle. The work of planting them is in charge of Mr. Mclntire, representing Con-tractor O'Connell, of Philadelphia, who furn-ished the trees. About 2.30 o'clock Sunday morning, Nov. 10th, the Colonial Hotel was discovered to be on fire and the alarm was quickly given. The fire was first discovered by Mrs. Tate, wife of the proprietor, C. B. Tate, who noticed the smell of smoke. She aroused the family and the guests, all of whom escaped, but some were in extreme danger. The firemen quickly responded to the alarm but before they could get water the whole building was wrapt in flames. They turned their attention to the surrounding buildings, all of which were in imminent clanger, espec-ially those on the east and south. The resi-dence of J. A. Kitztniller, Esq., across the street, directly within the line of the wind, caught several times but a slate roof saved it. The ice-house, closely attached to the hotel, was destroyed, but the barn was saved. As to the cause of the fire nothing definite can be stated. Mr. Tate says that he has no idea how it could have started. Those who saw the fire early think that it began in or near the bar-room in the basement. All of the furniture and wearing apparel in the house was destroyed, and a small stock of liquors. The hotel was insured to the amount of about $8,000. A plan is on foot in Gettysburg to introduce a telephone system. Some of the business men have been approached, all of whom, we are told, think the plan a good one. It is pro-posed also, if the venture is a success in Get-tysburg, to connect with the surrounding towns. The anniversary exercises of the Women's Bible Society were held on Sunday evening, Nov. 17th. In the Presbyterirn church the services were conducted by Revs. Dr. Barkley and Black; St. James Lutheran, Rev. Gilchrist and Dr. Billheimer; Christ Lutheran, Revs. Steck and Carver and Dr. Stuckenberg. The Christian Endeavor Society of St. James Lutheran church held their seventh anniver-sary on Sunday, Nov. 24II1. In the morning Rev. C. C. Benson, of Williamsport, Pa., de-livered a very able discourse based on the text: "Thy Kingdom Come." In the evening ap-propriate services were held, conducted by the pastor, Rev. A. R. Steck. The St. James and Christ Lutheran congre-gations held a union Thanksgiving service in St. James Luthern church on Thursday morn-ing, Nov. 28th, at 10 o'clock. Rev. L. S. Black preached the sermon. Services were also held in the Presbyterian and Reformed churches in the morning. The firemen of this place had a parade on Thursday afternoon, Nov. 28th. The hose-carriage was drawn by some of the firemen, the engine and ladder truck were drawn by horses. Music was furnished by the Gettys-burg band. One of the most popular auxiliaries of the evening lectures at the Adams Count}' Teach-ers' Institute was the "Graphophone Exhibi-tion" by two of our boys—Messrs. Lutz and Brubaker. The audience was carried away; every selection was applauded. And so de-lighted were both audience and manager that their service was secured for a second night with equal success. We congratulate the boys on their splendid success in so large a hall and before so large an audience. SEMINARY. • Rev. J. Albert, on account of ill health, has given up his work at Seminary and has re-turned to his Mission in the West. Rev. A. Bredenbek and Rev. M. J. Killian preached at Good Intent on the 10th and 17th of November, respectively. On the 3rd of November, Rev. G. W. Enders, Jr., preached at Newport, Perry county. In the absence of Rev. Steck, Nov. 3rd, Rev. M. J. Kline filled St. James pulpit in the morning, and Rev. George M. Diffenderfer in the evening. Rev. A. A. Kelly preached in the Trindal Spring church, Mechanicsburg, Pa., Novem-rer 24th. Rev. Chas. P. Wiles preached for Rev. Hesse, New Oxford, Pa., Nov. 24th. The pulpit of the Second Lutheran church, Carlisle, Pa., was filled by Rev. H. B. Stock, Nov. 24th. Owing to ill health, Rev. M. J. Kline was advised to return to his home, Frederick, Md., for a short time. Rev. F. Hilton returned to Seminary several weeks ago. i4r THE COLLEGE MERCURY. On Nov. 24th, Rev. E. E. Parson preached at Freedom, Md. Rev. J. F. Crigler assisted Rev. M. P. Hocker, Steelton, Pa., Nov. 10th. Rev. J. C. Bowers preached at Rossville, Pa., Nov. 17th. The following 'Seminarians attended the meeting of the American Inter-Seminary Mis-sionary Alliance, which was held in Lancaster, Pa.: Messrs. Ehrhart, Diffenderfer, Kline, Rndisill, Stock, Heffner, Bare, Oberholtzer, Koller, Ibach, Cromer, Harms, Whitman, Cox and Killian. Each day during the week beginning Nov. 17th, Dr. J. H. W. Stuchenberg lectured to the Seminarians on Philosophy and Christian Sociology. Rev. W. A. Kump preached at Round-Top, Sunday evening, Nov. 10th. On November 24th, Rev. W. O. Ibach pre-sided at the pipe organ in Christ Lutheran church. LIJERARV SOCIETIES. EDNA M. LOOMIS, Editor. PHILO. The society has decided to make some needed improvements in the reading room. As Dr. Stuckenberg's lecture occupied the evening of Ncv. 22nd, and the Teachers' In-stitue the evening of Nov. 29th, no meetings were held on those dates. The new members of Philo are Brumbaugh, '99, and Bregenzer, 1900. The special program of Dec. 6th will be de-voted to Robert Louis Stevenson. PHRENA. Our special meeting on Nov. 1, which was in charge of our new initiates, was a grand success. The hall was filled to overflowing, and all went home well pleased with the even-ing's entertainment. Our new men deserve to be congratulated. The following new names were added to our roll during the past month: J. H. Straw, '99; David P. Deatrick, H. B. Ernest and Alex-ander O'Neal, of the Preparatory Department. On Wednesday evening, Nov. 6, our de-bating club elected the following officers: Pres., Woods, '9S; V. Pres., Staley, Jr., '99; Rec. Sec, Krafit, '98; Treas., Sprenkle, '98. Phrena will render a special program on Friday evening, Dec. 6th, entitled the "New Woman." Declamation, "A Dream of Possibilities," - - WOODS Essay, '"The 'New Woman' in the World of Sport," - CARNEY Declamation, "A Fearful state of Things/' - - LAUFFEH Oration, "The 'New Woman' in Politics," - - - OTT DEBATE: . "Which Makes the Better Wife, the 'New Woman' or the 'Conservative Woman?'" Aff (.FLECK, I MEISENHELDER, E. W., ' J STOCKSLAGER. .•»=»• J AJOSER. Declamation, "Will She?" . ROEHNER Oration, "The 'New Woman' in the Intellectual World," WOLF EXCHANGES. We are glad to add to our exchanges the Maryland Collegian, Lutherville, Md. It con-tains a good editorial department, and well written contributions, and is in every respect an excellent monthly. The Wittenberger among its foot-ball notes says of our former centre-rush : "Rank's cheerful voice is heard at all stages of the game. The darker the prospects, the more encouraging is our right guard's call." A recent number ot the same paper contains a good editorial on the honor system of gov-erning students. The Dickinsonian seems desirous of empha-sizing the fact, by mentioning it in several places, that the Dickinson students who wit-nessed the Buckuell-Gettysburg game, "root-ed" for Bucknell. It is fortunate they took this opportunity to yell for the winning side, as it is about the only one they have had this season. The Irving Skctch-Book begins its second volume with a very creditable number. This is one of the most attractive exchanges we re-ceive, and is always read with special pleasure. JTor all the latest styles in .uitini and Trousers, AND PULL LINE OF Cents' Furnishing Goods, Call on D. H. WELSH, York, Pa. (gO TO^ *H0m GETTYSBURG* TIMBER SHOP.*- Centre Square. <*^__B. M. SEFTON. ADVERTISEMENTS. A. G. SpaSding & Bros., roof BALL SUPPLIES A SPECIALTY. Every Requisite fop the Game. Jackets, Pants, Jerseys, Sweaters, Shoes, Caps, Belts, Stockings, Morrill's Nose Mask, Rubber Mouth-piece, Shin Guards, Head Harness. Spaldiiiy's Official Intercolle-giate Foot Ball Must be used in all Match Games. PRICE - - - ^s.oo Webster9s IM&ioaiary Invaluable in Office, School, and.Some Successor of the "Unabridged." Standard cf tho U. 0. Gov't Printing OGico, the U. S. Supreme Courfc,a:id of nearly all the Schoolbooka. SPALDING'S OFFICIAL FOOT BALL GU I DE~ N EW RULES-PICTURES OF ALL THE LEADING PLAYERS. Price 10c ttCUOSOttt WAUSTRMtO VOfM 6M_\_ CM\\_QQUt Sim TRtt NEW YORK. PHILADELPHIA. CHICAGO. Til HORACE PARTRIDGE CO. "Warmly commended by State Superintendents of Schools, and other Educators almost without number. THE BEST FOR EVERYBODY rt . . *. j ^. BECAUSE it is easy to find the word wanted. Words nre (riven their correct alphabetical placea, each one beginning a paragraph. [1 is easy to ascertain the pronunciation. The pronunciation is Indicated by the ordinary dlacrit. ically mariced letters used iuthoschoolbooks It is easy to trace the growth of a word. The etymologies nre full, unllhe different meanings are given in the order of 1 in ir development. It is easy t o learn what o word means. The definitions are clear, explicit, and full, and each 13 contained in a separate paragraph. G. & C. MEItRTAM CO., Publishers, Springfield, Mass., XJ. S. A. 03-Specimen pages, etc., Bent on application. BOj^R/JDIILTGh By Day, \A/eel< or Month. RATES REASONABLE. MOUSE EQUIPPED WITH ALL MODERN IMPROVEMENTS. 335 Washington St.,, BOSTON, WIASS. Grocery Store In same building. Full line of Goods kept and sold at small profits. House and Store located on Cor. of College Campus, opposite Brua Chapel. figj^Public Patronage Solicited. SAMUEL H. TAUaHINBAUSH, Prop'r. ifiiil M|iM| Isiliillfc Base Ball and % 9 & © Tgqqis Supplies : -t^fi -A SPECIALTY. 'T3-?i IVIr. \A/. H, MENGES, Our authorized agent at Gettysburg. N j Troy, N. Y., DANY, MAMOTACTOBBK OF SUPEfUOH BELLS. The 2,000 pound bell now ringing in the tower of Pennsylvania College was manufac-tured at this foundry. ADVERTISEMENTS. I V A V [ \ I. Classical Course for the Degree of A. B. II. Scientific Course for the Degree of B. S. III. Pest-Graduate Course for the Degree of Ph. D. IV. Special Course in all Departments. V. Elective Studies in Junior and Senior Year.-. VI. New Testament Greek and Hebrew in English Bible Department. Observatory, Laboratories and new Gymnasium. Four large buildings. All buildings heated with steam from central plant. Libraries, 25,000 volumes. Fine Museum. Expenses low. Department of Hygiene and Physical Culture in charge of an experienced physician. Accessible by frequent railroad trains. Location, on BATTLEFIELD of Gettysburg; most pleasant and healthy. PREPARATORY DEPARTMENT, in separate buildings, for boys and young men preparing for business or college, under special care of the principal and three assistants, residing with students in the building. For full particulars, apply for catalogue to HARVEY w. MCKNIGHT, D. D., LL. D., PKES'T.

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

The integration and inclusion of persons under international protection (i.e. persons granted asylum and refugees) into society proceeds through their contacts and interactions with institutions and residents in local communities where their reception and accommodation have been organised. In this process, the achievement of social, economic, cultural and all other dimensions of integration in local communities is facilitated by the activities of different national and local stakeholders in the integration system. Creating the conditions for Croatian citizens to familiarize themselves with refugees requires joint efforts by all system stakeholders and engagement to inform citizens and raise their awareness about the presence, rights and obligations of persons under protection, with a view to preventing and mitigating any negative manifestations of discrimination, exclusion and marginalisation, and to ensuring that persons under international protection become accepted and integrated members of local communities and society as a whole. With this in mind, this research has analysed capacities and challenges, and assessed the resources and needs of local and regional self-government units given their past or future experience with the reception and integration of persons under protection. Furthermore, this research has also identified the attitudes of Croatian citizens towards persons under protection and their readiness for the reception and integration of persons granted asylum in their local communities.The general purpose of the project is to support units of local (cities, towns and municipalities) and regional (counties) self-government in identifying the needs and challenges of integrating third-country nationals in need of international protection. To achieve the purpose of this research, both quantitative and qualitative research methodologies have been used. As a result, it was conducted as mixed-method research, that is, as two correlated studies. The quantitative segment of the research pertains to its first goal, which was to identify the attitudes of Croatian citizens and their readiness for the acceptance and integration of third-country nationals granted international protection in the Republic of Croatia, while its qualitative segment refers to the second research goal, to identify the needs of local and regional self-government units in the process of integrating third-country nationals granted international protection in the Republic of Croatia as well as the challenges they encounter or will encounter when it comes to the integration of persons granted asylum into Croatian society. The third research goal, to prepare checklists for assessment of needs and challenges of integration for local and regional self-government units and for persons granted international protection, has been achieved by synthesising the findings reached under the previous two goals and by preparing two checklists. One is intended for heads and staff of LSGUs and RGSUs so that they can assess the existing needs, resources and capacities of their communities in terms of planning and implementation of integration activities. The other is designed for persons granted asylum and serves for the self-assessment of their needs and the extent to which they are met. Accordingly, the starting point for tool selection and elaboration is the multidimensional concept of integration of aliens into the host society, which is focused on the processes and dimensions of integration of persons under international protection (either with full asylum or subsidiary protection status) into Croatian society as a whole, but also into individual local communities in Croatian regions covered by this research.Due to the specific character of the quantitative and qualitative methodological approaches, the report describes methodological aspects and results separately, first for the quantitative study conducted by a survey of citizen's attitudes towards the integration of persons under national protection, and then for the qualitative study of needs and challenges faced by local communities in the integration process. The target group of survey participants covered by the research was defined so as to include citizens living in selected counties (regional self-government units) and towns and municipalities (local self-government units). In order to form a sample of participants for the purposes of this research, Croatia was broken down into four regions: Eastern, Central and North-Western, Littoral and Istrian, and Dalmatian regions. In each region, the sample came to include between two and five counties (a total of 12) and between three and five towns (a total of 15). The Eastern Region encompassed the counties of Osijek-Baranja, Vukovar-Srijem and Požega-Slavonski Brod. The Central and North-Western Region included the City of Zagreb as well as the countries of Zagreb, Sisak-Moslavina, Bjelovar-Bilogora and Varaždin. The Littoral and Istrian Region covered Primorje-Gorski Kotar and Istria counties. The Region of Dalmatia consisted of Zadar and Split-Dalmatia counties.In the selected towns, the size of the sample was proportionate to the size of the town within its region, with the participants in each town selected by probability sampling. The sample of citizens aged 18 to 65 included 318 persons in each region, and probability sampling – together with the use of two levels of purposively selected clusters (region and town) – ensured that the sample structure, in terms of its socio-demographic profile, reflects the characteristics of the region's population, according to publicly available statistics. The sample formed in this manner and its size (N = 1,272) allowed inter-regional comparisons with regard to the relevant characteristics of the participants and measured constructs. Data were gathered using the CAPI (Computer Aided Personal Interviewing) method, in the period from 14 May to 10 June 2018. The response rate was 57%, which is quite high given the type of research in question.The survey questionnaire contained 67 items forming the following constructs and scales: (1) Attitude towards persons granted asylum; (2) Perception of realistic threat; (3) Perception of symbolic threat; (4) Support for the rights of persons granted asylum; (5) Perception of negative changes in the community; (6) Readiness to assist persons granted asylum; (7) Frequency of contacts with persons granted asylum; (8) Quality of contacts with persons granted asylum; (9) Sources of information about persons granted asylum; (10) Media portrayal of persons granted asylum; (11) Social proximity to persons granted asylum; (12) Attitude towards forms of acculturation; (13) Estimated number of persons granted asylum; (14) Change in the number of persons granted asylum; (15) Socio-demographic profile of participants. The scales used in this questionnaire show very good metric characteristics: a Cronbach's alpha internal reliability coefficient ranging from 0.77 to 0.93 and a clear construct validity and single-factor structure.The collected data were subject to a series of statistical analyses, including descriptive calculation of statistics (range, frequency, median measures, variability measures) at the levels of the aggregate sample and each region as well as inter-regional comparisons of the results derived from the measured constructs (variance analyses, t-tests, chi-squared tests). Also, by using regression analysis, a model was set to predict two forms of behavioural intentions among host populations: (1) readiness for social relations with asylum beneficiaries at different levels of proximity; and (2) readiness to help persons granted asylum in their integration. These two forms of behavioural intentions served as criterion variables, which were predicted on the basis of a set of predictors that included the participants' individual attributes (socio-demographic variables and regional affiliation), their religious and political orientation, their opinion about the number of asylum beneficiaries to be received by the country in future and about their social adjustment strategies (i.e. about acculturation strategies), their frequency of contacts with persons granted asylum and their perception of threats and expected changes in the community caused by the arrival of persons granted asylum (i.e. perceptions of realistic and symbolic threats, and expectations of negative changes in the community).The average results obtained on the aggregate sample show that, when it comes to attitudes towards persons granted asylum, the respondents express attitudes that are, on average, neutral. However, when assessing their perception of threat, they seem to feel a slight realistic threat, and a somewhat stronger symbolic threat. The participants also express what is, on average, a neutral attitude regarding the expected negative changes in the community. As for their readiness to help asylum beneficiaries personally, the participants are also neutral, stating they are not sure of their readiness in this regard, but showing a slight support for the rights of asylum beneficiaries. Concerning the frequency of contacts with persons granted asylum, slightly more than half of the participants (52.1%) reported that they had such contacts, describing them, on average, neutrally – as neither positive nor negative. Among those who reported such contacts, the majority stated that they were rare.The data collected clearly show that the mass media (print and online news outlets, television and radio) are the most common source of information for Croatian citizens – more than 90% of citizens receive information about persons granted asylum in this way. These are followed by social media, which are used as a source of information about asylum beneficiaries by nearly half of the participants (45.8%). It has been established that citizens deem the media portrayal of asylum beneficiaries slightly negative.As for social proximity, the participants are, on average, ready to accept persons granted asylum as their fellow workers or neighbours, where it is obvious that the citizens are, for the time being, not ready for the closest relations with asylum beneficiaries, although nearly 61% would be ready for friendly relations.The participants were also asked about acceptable acculturation strategies, that is, about how persons granted asylum should approach the Croatian culture and maintenance of their own culture. The majority of participants (70.7%) chose integration as the preferred acculturation strategy (both maintaining their own culture and accepting the culture of the host country). About one fifth of the participants champion assimilation as the preferred acculturation strategy; i.e. they expect persons granted asylum to relinquish their specific culture and accept only that of their host country. Separation, that it, the opinion that persons granted asylum should maintain only their own culture without accepting Croatian culture, is upheld by 3.7% of the participants. Looking at acculturation strategies as a continuum (from assimilation, through integration, to separation, or vice versa), the participants on average tend to support cultural integration of persons granted asylum.When it comes to estimating the number of persons granted asylum at the time of survey, only one fifth of the participants made a more or less accurate estimate. Somewhat more than a fourth of participants underestimated the actual number of asylum beneficiaries, whereas almost half of them overestimated the number of cases of granted asylum. These results are consistent with the replies regarding preferred projections of the number of asylum beneficiaries in the future. Specifically, the majority of participants (45.8%) feel that their number should remain the same, only slightly fewer are those who would reduce it (45.6%), while less than a tenth holds that the future number of asylum beneficiaries in Croatia should go up.The analysis of regional differences demonstrates that the least positive attitudes towards persons granted asylum, the highest perception of both realistic and symbolic threats, the lowest support for the rights of asylum beneficiaries, the highest expectations of negative changes, and the lowest readiness to assist are present among participants in the Dalmatian Region. It is followed by the Eastern Region, and then the Littoral and Central Regions, where these attitudes are more positive. The frequency of contacts with persons granted asylum is low in all the regions, with the lowest levels reported in the Eastern and Dalmatian regions. However, there are no regional differences in the quality of contacts, as it is everywhere seen as neutral. Readiness for close contacts is the lowest in Dalmatia, followed by the Eastern Region, with its highest levels reported in the Littoral and Central regions. The citizens of all regions choose integration as their preferred acculturation strategy, while participants in Dalmatia divided their preferences between assimilation and integration. The number of asylum beneficiaries is mistakenly estimated in all regions. Indeed, it is overestimated everywhere except the Eastern Region, where the figure is underestimated. Furthermore, while the citizens of the Central and Littoral regions would prefer to keep the future number of asylum beneficiaries at the same level, those in the Eastern and Dalmatian regions are keener to reduce it. When predicting the readiness for social proximity with asylum beneficiaries, the key predictors include the attitude towards the number of asylum beneficiaries in the future and acculturation strategies. The readiness for a higher level of proximity is demonstrated by those citizens who feel that the future number of asylum beneficiaries should be increased, as well as those who champion integration. The predictors of marginal importance include practising religion, where the participants who do not declare themselves as practicing believers tend to be ready for a higher level of proximity with persons granted asylum, as well as the perception of symbolic threat and the fear of negative changes in the community, where those who perceive a higher symbolic threat from asylum beneficiaries and expect more negative changes in the community due to the arrival of persons granted asylum tend to be ready for a lower level of proximity with them. These results generally apply to all of the four regions.When it comes to predicting the readiness to assist asylum beneficiaries personally, it can also be said that – allowing for minor regional particularities – the key factors include the participants' opinion that the number of asylum beneficiaries should increase in the future and, again, the perception of a higher symbolic and realistic threat. Those participants who feel that the future number of asylum beneficiaries should increase are readier to help, whereas those whose perception of threat from asylum beneficiaries is higher are also less prepared to assist them personally. Another highly significant predictor is the frequency of contacts with persons granted asylum. Those participants who reported more frequent contacts with asylum beneficiaries are also more prepared to assist them. Finally, the variables of marginal significance include gender and political orientation, where women and those on the left side of the political spectrum would be readier to help asylum beneficiaries.The conducted regression analyses show that the most frequent predictors for both criteria (social proximity and readiness for personal assistance) include the perception of symbolic and realistic threat, expectation of negative changes in the community due to the arrival of asylum beneficiaries, opinion that the future number of asylum beneficiaries in Croatia should be increased and the choice of integration as the preferred acculturation strategy. It follows that a more favourable attitude of Croatian citizens can be expected if they feel less threatened by persons granted asylum, that is, if they understand that their arrival does not pose a threat to the existing identity and culture nor jeopardise the resources of local communities, if they expect less negative changes in their communities due to the arrival of asylum beneficiaries, if they think that the number of asylum beneficiaries in Croatia needs to be increased in the future, and if they believe that integration is the acculturation strategy appropriate for Croatia.The second part of this research deals with the assessment of needs and challenges which are or will be encountered by LSGUs and RSGUs, and also of the capacities and resources required for integration with regard to the current or anticipated accommodation and stay of asylum beneficiaries in their local communities.This part of the research was conducted through a series of interviews and focus groups with different stakeholders in the integration system, which are in one way or another involved in or will in future be responsible for the processes of reception and integration of persons granted asylum. Stakeholders from LSGU and RSGU include representatives from county-level and town-level public authorities and various professional institutions, while the CSO stakeholders include representatives from the non-governmental sector, religious organisations and civic initiatives. The perspectives of integration processes were, whenever possible, complemented with those of asylum beneficiaries in the local communities in which they live. For sampling purposes, a list of 30 units (9 counties and 21 towns) was drawn up, taking into account the criteria of regional representation, town size, experience with the integration of asylum beneficiaries and available state-owned housing units. Along with the four regions, the City of Zagreb was taken separately as it considerably differs from other regions in terms of the number of integration stakeholders and capacities, as well as the number of asylum beneficiaries it hosts. The persons included in the sample had the attributes of schoolants based on their role and office they held, their experience and knowledge of the needs and challenges relating to the integration of asylum beneficiaries in local communities. In keeping with the principle of maximising the variability of key informants, a total of 168 interviews and four focus groups were conducted with 227 participants, including 26 interviews with persons granted asylum. Once all of the methodological requirements were met in the process of qualitative-data gathering, 158 transcripts obtained from 216 interviewees were subjected to analysis. The other transcripts did not contain any useful information because some interviewees were totally uninformed about the topic of the research. Of the total number of analysed transcripts, 143 contain data obtained from 191 representatives of municipalities, towns and counties, state-administration offices at the county-level, professional institutions and the civil sector, while 15 transcripts of interviews and focus groups contained information obtained from 26 asylum beneficiaries. The analysis made it possible to identify some specific features of statements made by representatives of the selected local communities about their needs, challenges, opportunities and expectations. A comparison has been made among the four regions and the City of Zagreb, and similarities and differences have been analysed among statements made by stakeholders from different sectors.The results for all regions (except the City of Zagreb) equally suggest that most of the integration-system stakeholders from LSGUs and RSGUs (towns, municipalities and counties) generally had no direct experience of contacts and work with persons granted asylum or, if they had, then they encountered asylum beneficiaries in rare, individual cases. On the other hand, interlocutors from Zagreb recounted and described experiences of direct and immediate encounters with persons granted asylum, mostly through participation in projects with SCOs and the OHRRNM, while CSOs in all the regions have very little direct experience with asylum beneficiaries. A large portion of LSGUs and RSGUs in each region state that they are not aware of the Action Plan for Integration, or are aware of it only partly, or since a short time ago. Stakeholders in various sectors and regions have not developed their own action plans and protocols for integration, independent of the Action Plan. Professional institutions do not have their own plans either, but many of them perform tasks relating to the integration of persons granted asylum as part of their daily work and remit, and some have their own internal prodecural protocols, most often based on their previous experience with marginalised groups or guidelines from relevant ministries. All stakeholders in all regions agree that the lack of funding poses a serious structural constraint and that allocations for integration activities should be increased. They stress that the entire budget is centralised and that they lack special resources earmarked for integration, noting, however, that budget allocations could be repurposed or activated if and when the need arises.When it comes to understanding the importance and indicators of successful integration, there are no major differences between either sectors or regions. As far as the key dimension of integration is concerned, all stakeholders across all regions highlight communication, that is, learning the Croatian language, as a crucial prerequisite for all other aspects of integration, especially for the inclusion of children in the education system, participation of adults in the labour market, addressing housing issues and, generally, enabling asylum beneficiaries to get along in local communities. In the Central Region, professional institutions claim that integration could also be facilitated by the community's experience with refugees during the Croatian War, and the history of coexistence with national minorities. In the Central Region, they feel that integration would be more successful if asylum beneficiaries were accommodated within the community rather than isolated, and if they were provided with appropriate care and inclusion in community life. All stakeholders across all regions voice some sort of concern because, when it comes to the accommodation of persons granted asylum, they expect negative reactions from the host population due to cultural and religious differences, especially in smaller communities, with the general opinion being that larger towns would be readier to accept asylum beneficiaries. Interlocutors in Zagreb are the most critical of the local community as a favourable environment for integration, with professional institutions stating that negative sentiments are the greatest problem, stemming primarily from fear of the unknown among the local population. Nonetheless, almost all of the interviewed asylum beneficiaries highlight the positive experiences they had with their acceptance in local communities, noting, however, that it took a while for them to feel accepted by their neighbours. Only three out of 26 interlocutors report having negative experiences upon their arrival in the community, consisting mainly of unpleasant verbal comments. Persons granted asylum generally do not see any major cultural barriers to their life in Croatia, but in their view the integration system is not well-organised and includes some contradictions.At the intraregional level alone, and particularly at the interregional level, the integration stakeholders from different local communities show considerable differences when estimating the integration capacity of their communities. The majority of LSGUs believe that organising language courses falls under the responsibility of the Ministry of Science and Education, expressing concerns about the duration of courses (too few lessons) and uncertainties about their funding, while RSGUs also stress their lack of human and logistic capacities to organise courses. Professional institutions shift the responsibility for organizing courses to administrative bodies – from the local, through the regional, to the national levels. Only representatives of Zagreb-based SCOs report more direct involvement in the organisation of courses – some of them offer them in a formalised manner, and others through voluntary engagement. As to the inclusion in the education system, most stakeholders stress the problem of slow-moving administration and emphasize the heavy teaching workload, suggesting that there is a need for additional teachers as well as the necessity to work additionally with asylee children. Further difficulties mentioned are related to the lack of personal documents and the issue of recognising diplomas and previously acquired qualifications. In the Littoral and Central regions, they also highlight a lack of interpreters and teaching assistants, over which they have no control, but depend on the relevant ministry.Most of stakeholders from LSGUs and RSGUs are actually unaware of the existing accommodation capacity because they do not own any housing units or have already allocated all they had to beneficiaries from certain social categories. They see a possible solution in the conversion of the existing vacant buildings or renting of private flats, where they report problems with landlords, i.e. the unwillingness of landlords to let out their flats to accommodate persons granted asylum and the high rents they impose. Persons granted asylum are mostly concerned about their initial accommodation in reception centres, with which they were partially (dis)satisfied and, in addition to prejudice by landlords, the interlocutors also stressed high prices. In their local communities, asylum beneficiaries have been recognised as a desirable workforce in sectors with labour shortfalls. The LSGU representatives stress the need for a skilled workforce in the construction and public works sectors and, in the Eastern Region, agriculture. In addition to feeling that employers should be informed of opportunities to hire asylum beneficiaries, LSGUs are somewhat keener to consider potential retraining and additional training schemes as well as efforts to overcome the language barrier, referring to professional services which should take over that task. Many see the opportunities to employ asylum beneficiaries primarily in low-skill and ancillary jobs, such as kitchen or warehouse assistants and so forth. While the asylum beneficiaries themselves are highly motivated to take part in the labour market, since they see employment as a key prerequisite to gaining independence, they are aware of the economic situation in Croatia and do not want to become a public charge, but rather an active and productive segment of the society.Almost all interlocutors attach great importance to public information and awareness-raising campaigns, and most of them also recognise the role of the media in this process and believe that it is extremely important to get the local population acquainted with good practices and examples of successful efforts to integrate asylum beneficiaries, and to inform them about their culture and customs. This would prevent the development of prejudice and discrimination, where the LSGU representatives often see their role in such efforts unlike RSGUs, among which only a few recognise it. Professional institutions also leave the role of awareness raising to the media and, for the time being, carry out awareness-raising activities in the form of workshops and cultural events mainly with support from CSOs in Zagreb. The training of staff members and professionals has also been stressed as extremely important, yet largely non-existent in most institutions, offices and organisations.Nearly all interviewees from all regions agree that asylum beneficiaries have been provided with adequate social welfare, just like all of its other beneficiaries. Some of the representatives of LSGUs and professional institutions from the Dalmatian and Eastern Regions noted that asylum beneficiaries were not supposed to be singled out, that is, afforded greater rights and priorities than domestic social-welfare beneficiaries. All local communities feel that asylum beneficiaries have been provided with adequate health-care, but the interviewees highlight a lack of physicians and the overload of the health system, as well as communications. When it comes to providing adequate social welfare and health care, a common problem stressed in all regions is the insufficient capacity of institutions, while other aggravating circumstances include slow systems, uninformed staff members, shortcomings in the monitoring of asylum beneficiaries, uncertainties about the financing of health-care services and lack of coordination between different stakeholders. The same issues are also reported by the asylum beneficiaries themselves.Professional institutions have, for the most part, already established cooperation with almost all stakeholders involved in the integration process. In this context, they most often point out line ministries, as well as significant cooperation with CSOs. Only the Central Region (including Zagreb) highlights the existing cooperation with LSGUs and the OHRRNM, or with international organisations. The LSGU and RSGU representatives are somewhat more likely to expect more significant engagement by and cooperation with CSOs, which they consider more capable of writing projects and mobilising funds for work with asylum beneficiaries or count on their human resources. Some professional institutions are also focused on inter-city and inter-county cooperation, for example, with other social-welfare centres, in order to compare their experiences and share good practices. The SCO stakeholders state national and local authorities make insufficient use of the capacity and experience of local SCOs.All stakeholders criticize administration primarily because of the lack of timely and transparent exchanges of information, given that they are perceived as responsible for the entire system. Stakeholders in local communities feel that they operate without specific guidelines and decisions, everything being left to improvisation. Professional institutions hold that the measures defined in the Action Plan are not applicable to the realities in the field, stressing that the system is not prepared to respond to current challenges and needs such as, for instance, securing accommodation and interpreters. There is also concern about the duplication of work by different institutions and organisations, and shifting responsibilities to CSOs. It has been stressed that a protocol in needed which would contain descriptions and guidelines for the implementation of steps in the integration of persons granted asylum, which should define the sequence of implementing integration measures, those in charge of their implementation, including their responsibilities, as well as the forms of their cooperation. Such a protocol and guidelines would enable LSGUs and RSGUs to rely on these documents in their work and to act in compliance therewith. All stakeholders emphasize the need to receive timely and reliable information about the number, structure and time of arrival of persons granted asylum in their areas because this information is crucial for them to be able to prepare themselves for different aspects of their integration. A distribution plan is a document cited by all self-government units as essential to launch preparations for the asylum beneficiaries, in accordance with the aforementioned protocol.All stakeholders highlight interpreters and cultural mediators as a very pressing need in all regions. It has been stressed that interpreters should be professionally trained, rather than semi-skilled individuals or family members, let alone children. All stakeholders realize that securing housing is a key prerequisite for the reception and integration of persons granted asylum, and that it falls within the remit of the central government, rather than the local community. The Eastern and Dalmatian Regions place special emphasis on the need to provide adequate accommodation for unaccompanied children under international protection. Also, all integration stakeholders feel that efforts are needed to speed up administrative procedures because there is a gap between what has been set forth in legislation and what can really be implemented due to technical barriers, including children's registration in school e-registers, medical records, access to Croatian language learning, and verification of previously acquired qualifications and job competencies which is a requirement for education or employment. To achieve all this, sound intersectorial cooperation is required.The integration stakeholders in all regions show a clear need to prepare, raise the awareness of and train the staff directly involved in the integration process for contacts with and providing services to persons granted asylum. Since professional institutions are places of direct and on-going contacts with asylum beneficiaries, there is a need for continuous training of their professional staff. The training of all integration stakeholders should include learning about the culture and customs of asylum beneficiaries and it should be based on the principles of intercultural communication. In some professional institutions whose staff are engaged in direct and intense work with families of asylum beneficiaries, such as counselling and psychosocial support, there is an increased need for continuous mental-health care and stress prevention among staff members through supervision and professional support.Given that they believe that the responsibility for integrating persons granted asylum rests primarily with the state, a number of LGSUs, professional institutions and some CSOs expect the state to bear the related costs. The LSGUs in the Central Region see the opportunity to secure funding by applying for EU projects and drawing money from EU funds. In the Dalmatian Region, the LSGUs expect the state to issue fewer instructions, and to focus more on direct care for asylum beneficiaries. At the LSGU level, help in meeting community needs in the integration process and their own efforts is expected from the Government of the RoC, primarily the OHRRNM as the central coordinating body. Some RSGUs believe that they will successfully carry out all tasks imposed by law and those received from the competent state authorities, and that they will tackle problems only once asylum beneficiaries arrive in their territory. LSGUs and RSGUs see their role in coordinating different integration process stakeholders, such as professional institutions and CSOs, at the town and county levels. Some LSGUs also see their role in supporting other stakeholders when they lack capacity in the integration process, and in networking with other institutions within the community. In this context, they stress their role in providing information to asylum beneficiaries and improving intersectorial cooperation because they "have a good overview of the activities of different services." Some LSGUs feel that a person should be assigned to each integration stakeholder as its key informant about how asylum beneficiaries can exercise their rights.The LSGUs see their key contribution to integration in their efforts to raise the awareness of and inform the public about the arrival of persons granted asylum and the process of their integration, being aware there resistance to their arrival in some communities. In the Eastern Region, they warn that greater resistance to the arrival of asylum beneficiaries may be expected in communities that are traditionally more closed and host a larger number of immigrants from Bosnia and Herzegovina, who were forced to leave their homes due to armed conflicts with the Muslims. In the Central and Littoral regions and the City of Zagreb, they believe that the experience they have with proven integration mechanisms for socially vulnerable groups, referring to members of the Roma national minority, will help them in the process of integrating asylum beneficiaries. The LSGUs feel they can also directly support integration efforts by providing initial financial assistance to asylum beneficiaries, helping in the process of their reception and accommodation, offering aid such as food and toiletries, facilitating children's inclusion in educational institutions, covering their kindergarten costs (Eastern and Littoral regions, Zagreb), as well as helping asylum beneficiaries to find employment. Professional institutions will address integration as part of their daily activities, by providing services for persons granted asylum as well as any other beneficiaries. The LSGUs, RSGUs and professional institutions see the important role of CSOs in complementing services provided to asylum beneficiaries by professional institutions. Most of the CSOs plan to expand their present activities to meet the specific needs of asylums beneficiaries, and represent a major integration potential for local communities, highlighting their networks of volunteers as a key asset in work with persons granted asylum. The CSOs feel that a coordination mechanism should be put in place at the LSGU level so as to bring together all the stakeholders, including the civil sector, and ensure transparent financing of services for asylum beneficiaries.Croatia has few communities with any reception and integration experience and most of the local communities covered by this research have not considered or prepared themselves for this challenge. Yet, the integration stakeholders in all units included in this research stress that they crucially need timely and reliable information about the plans for the arrival and distribution of persons granted asylum, and that information from the relevant ministries, particularly from the OHRRNM, will enable them to launch preparations for integration activities and possible reception of asylum beneficiaries. Finally, the recommendations derived from this research will facilitate improvements in policies and practices for the integration of persons under international protection, making it easier and less painful to achieve the objectives stemming from Croatia's commitments as an EU member state, as well as its legislation and action plans of the Government of the RoC.

The WSU Stewart Library Annual UC-UI Symposium took place from 2001-2007. The collection consists of memorabilia from the symposium including a yearly keepsake, posters, and presentations through panel discussions or individual lectures. ; Audio Recording ; The Wattis Brothers: Spanning Distances, Spanning Eras a commemorative lecture presented at the 2007 Utah Construction/ Utah International Symposium The Beginning of an Era by Dr. Stan Layton Thursday, October 18, 2007 2 Well thank you Gene for that very gracious introduction and thanks to all of you for being here today. I'm particularly gratified to see so many of my students in the audience. I am teaching a class in Utah history this very hour. I gave my students an exam two days ago and I told them if they didn't come here to listen to the old man they'd never get their exams back. Here they are. Not long ago as I was walking towards parking lot A1 a nicely dressed middle aged couple hailed me asked me for directions to the Waters Building. I was pleased to correct their pronunciation and point them toward the Wattis Building. Once again I found myself asking why the Wattis name is not better know in our larger community. Why is it not as immediately recognized as a Huntsman, Matheson, Bamberger, Eccles or Sadler? I've got to tell you my research assistance Stephanie as she read this paper last week and we talked about it over the weekend, she read that sentence and she said, " Wouldn't say, Dee be a better name for this purpose?" I said, " Stephanie, that's a joke." Edmund O. and William H. Wattis are men of towering importance in twentieth century Utah history. They put together a construction company that in true Horatio Alger fashion expanded in size and stature to become one of the largest in the nation and left an indelible mark on the Utah, Western American, Mexican and Australian landscapes. They served as model citizens, family men, community servants and philanthropists. Their business acumen still serves as a model for today's entrepreneurs and their eventful lives continue to fascinate historians. 3 I am sure that most of us in this room have had our lives impacted in some small way by the Wattis family. They influenced the place of my birth for example. For three generation on both sides of my family, as Gene intimated, all my forbearers had been born in Layton. All of the sudden there I was as a newborn in a hospital in Puyallup Washington. Condemn throughout my childhood to try to conceal my embarrassment at having entered the world at such an awful sounding place. That angst was not eased in the least by my mothers constant telling of a joke about two boys with the unlikely name of Atle and Allup who surprised a skunk as they were walking one day. " See Atle," yelled the one. " Pew Allup," replied the other. I even thought of having my dear old mom come and tell that joke for you, but unfortunately she passed away about three weeks ago. My parents had been gone to Washington a few years earlier. Having a small child but no money or prospects they gathered up their meager belongings and headed for the construction site of the Grand Cooley Dam, where Utah Construction Company was a major subcontractor. My mother gave me this magazine just a few days before she died. I didn't know that she had it, but she and my dad always, always treasured their time in Washington. Several other Davis County families in similar circumstances were already there and had gained work, maybe Stan and Viola Layton would be so lucky. They were. Ultimately the wielding skills my dad acquired on this job and others opened up greater opportunities, including employment at the Tacoma Ship Yard which was yet another Wattis related enterprise. It was then while he and my mother lived in 4 the neighboring community of Puyallup that I was born. I like to think that my dad was the man behind the wielding hood in this photo. How might your lives have been touched by the Wattis brothers, William H. and Edmund O? Perhaps simply by taking a class over here in our Wattis Building, or maybe flipping on a light switch in a Las Vegas hotel room, or enjoying fresh apple grown in irrigated orchards of central Washington, or maybe boating on our Pineview Reservoir. Certainly as President Milliner said tens of millions of lives have been impacted, and will continued to be impacted everyday by the dams built, transportation systems constructed and mines developed by the Wattis brothers, and their Utah Construction Company, later named Utah International. How delighted I am as a Utah historian to see William and Edmund Wattis begin to receive the recognition due them and what a special treat to have been selected for a research fund, fellowship funded by the heirs of their company and administered by the Stewart Library. Very, very much appreciated. Then to have these library administrators suggest that I focus specifically on the Wattis brothers was the perfect scenario for me. I had first run across W. H. in researching my master's thesis forty years ago. These same people, Joan Hubbard and others were also generous in funding two research assistants to help me with this work. Janice LeFevre who is in class now and didn't feel that she could be here, but her husband Steven is here and Steven we appreciate the sacrifices you and the rest of the family made in support of this fellowship this 5 summer. And Stephanie Combe who is here in right in front as is helping me with the visuals today. And they were just of immeasurable assistance all summer. For purposes of this research project the term the Wattis brothers means the two older brothers only. Edmund O. and William H. this is not to minimize the importance of younger brother Warren L. who also played a significant role in the company's success. Rather it is simply a necessity of establishing realistic limits on the scope of this work. Let us begin with a short survey of Utah Construction/ Utah International. Just to get a feel for the scope, diversification and significance of its enterprises. And this will be short. You've all seen the photos, you've heard Tom Alexander's excellent presentation, you have probably I see a number of you have some of the booklets published by the library and so you don't need a long survey here of the scope of their work. Utah Construction Company evolved from a twenty year affiliation with the four Corey Brothers. They were brothers to the Wattis mother. In a number of railroad and canal construction projects in Colorado, Utah, Wyoming, Montana and Oregon the Wattis brothers bought half the stock in the newly reorganized Corey Brothers incorporated in 1886. The company thrived for several years before collapsing in the financial crash of the mid 1890' s. From its ruins Utah Construction emerged without the Coreys as you heard last hour. Incorporated in the year 1900 Utah Construction Company first undertook small scale railroading projects in Idaho, then several larger ones in Nevada and California, which included that daunting 942 mile Feather River route and then in Utah which included a portion of the Denver and Rio Grande track between 6 Soldier Summit and Helper. Then in 1915 Utah Construction made its entry into dam building. Beginning with our own East Canyon Dam which is another way in which many of us have been impacted. Without East Canyon Dam and the irrigation water impounded there Davis County would never have enjoyed the prosperity it has. Gene mentioned our farm our 100 acre family farm. Every six days this summer I was there irrigating that farm and I took pride in the prosperity of the farm and green alpha and the corn that we produced and I couldn't have done it without that East Canyon Dam. Railroad construction and dam building projects much too numerous to be detailed here were the companies bread and butter throughout the 1920' s. Then came the granddaddy of all construction projects in 1931, Hoover Dam, began in 1931. Where in Utah Construction Company joined Morrison Knudson, Bechtel, Kaiser and others to form six companies, to form Six Companies the name of that conglomerate to span the mighty Colorado River. It is a measure of the reputation enjoyed by the Wattis brothers that William, and he according to the style of the day took to his initials W. H. and so I'm going to refer to him by that term throughout the remainder of the paper, he was named president of this huge conglomerate. And Edmund O., similarly went by his initials E. O., was named second vice president and they referred to each other by their respective initials and sign their names and other documents with those initials. As fate would have it both brothers died before the dam was completed in 1935. However the reputation gained by Utah Construction during this time allowed the company to continue to shine for another generation. Gene Sessions 7 and Sterling Sessions in their outstanding business biography list eighteen major dam building projects completed during the period 1936 and 1959 after their deaths by Utah Construction, including Pineview and Wanship in our own backyard. The warriors brought contracts in ship building including at that aforementioned Tacoma Ship Yard and road construction including the famous Alcan Highway. They had an important contract for a portion of that highway. After World War II the company entered into an entirely new phase, emphasizing mining which dominated its operations into the modern era, revived its financial strength and turned it into a multinational corporation. This paper advances the thesis that although E. O. and W. H. Wattis were not particularly well positioned by birth or education to achieve the remarkable success that they did, nevertheless we can identify certain character traits, experiences and opportunities that they took full advantage of in their quest for success. Pouring through hundreds of documents this summer my research assistance and I have identified six such factors of success we've called them, which I summarize in the following pages. First, these brothers had a remarkable knack for recognizing opportunity when they saw it and making the most of it. A good example of this aptitude is visible in their very first construction experience. Grading portions of the Union Pacific track as the initial transcontinental line approached Utah in 1868 and headed right for the Wattis farm in Uintah. The younger brother William was only ten years old and too young to hire on, but he undoubtedly observed the activity with wide eyed interest knowing that his older brother was one of the workers. 8 Edmund was only thirteen and had to have help in yoking his oxen, but his diligence paid off. And at the end of several months he brought home $ 225. This seemed like a small fortune to that cash strapped family. Of the 5,000 local men, Leonard Arrington tells us 5,000 worked on that project, only a handful used the experience as a career path in heavy construction. But E. O. Wattis was one. Opportunity came right down the tracks for these brothers and they jumped aboard. I'm indebted to my research assistant Janice LeFevre for putting it that way, but I love the way she said it. Opportunities came right down the tracks for these brothers and they jumped aboard. Second, both of these men reflected traditional agrarian values of hard work and perseverance. Farm youngsters learned the importance of looking after details and of staying with a task to its completion regardless of weather conditions. They learned safety consciousness and patience with animals. And it was of no small benefit to these boys that they were skilled in working with oxen, mules and draft horses. Both grew into large men who were strong and full of grit. Oh that's an excellent photo. I could not find a single job that they ever quit on. And I was interested in that Tom Alexander pointed out that that was a trait of David Eccles as well. Particularly revealing was E. O.' s involvement with the Coreys that is two uncles and three other men in the transportation of a wagon load of whiskey from Kelton, Utah to Boise, Idaho in the year 1868. Young Wattis was only thirteen years old but proved to be one of the steadiest of the group when bad weather 9 overtook them. All except him began nipping at that whiskey and all except him suffered frost bite. Third, was the development of the self confidence to stride forward on their own. Quite likely the single most fortuitous business decision they ever made was to end their partnership with the Coreys. Even though the implosion of Corey Brothers was cause by the panic of 1893, the break up of that company must have been difficult for the Wattis's on a personal level. The Coreys after all were family, uncles and cousins and the Wattis's had worked with them or for them since childhood and incorporated with them since 1886. Nevertheless the Coreys did not have the acumen or stability to thrive as a modern company. I'm convinced that they didn't, but that was only an intuitive and deductive conclusion and I was gratified as I listened to Tom's paper last hour that he apparently moved toward that same conclusion and he had the benefit of some primary source documentations to draw his conclusions from. But I know that numerous Corey cousins plugged in and out of the company. The elder Coreys insisted on dominating the decision making even though the Wattis brothers owned fifty- one percent of the stock and were better decision makers. And the elder uncle, Warren Corey, could be petty and vindictive and I was a little worried about advancing that point of view in those words, but I'm much reassured by Tom's paper. On of the truly remarkable document in twentieth century Utah political history is Warren Corey's open letter to his nephew W. H. Wattis published in the Salt Lake Tribune in August of 1928 reeking of spite this letter chides W. H. for being an unsuccessful candidate on 10 several previous occasions. Labels him a lame duck, obviously not understanding the meaning of that term and accuses him of being a disloyal party member and I know that that was not true based on a lot of years of research and so I wondered what was the cause of that animosity. There was something else there that I was not able to see from my research and again much indebted to Tom Alexander for having enlightened me and all of the audience this morning on that. The bitter animosity of this letter speaks volumes as to the Wattis' good fortune in being rid of the irascible man. By the same token the Wattis alignment with the Ogden financiers Thomas D. Dee, David Eccles and others following the breakup of the Coreys was undoubtedly the single most fortunate occurrence in their business lives. Fourth, was a commitment to a hands- on management style. No wonder they fit so well with David Eccles. Don't you agree? These were men who maximized their time on the construction site and minimized their time in the board room, especially during their early and middling years. They were comfortable with dust in their nose, blisters on their feet, calluses on their hands and dirt under their fingernails. In 1893 on one of his last jobs with Corey Brothers W. H. Wattis then 34 and a full partner was operating a slip plow on the Portland- Astoria job site when he received a surprise visit from his new financiers David Eccles, Thomas Dee and others and on that occasion one of them gave him a cigar. " I wish it had been a twenty- five cent piece," he later recalled, " Since I hadn't eaten food for a day and a half." This was a full partner. 11 The older brother held the same commitment to tenacity and detail the Wattis brothers were managers yes, and they grasped the big picture yes, but they were also detail men who understood the need to worry about on site activity. Incidentally this was no doubt the safety record of the company was so good even though their work involved blasting, working at great heights, spanning raging rivers, operating heavy equipment and sometimes supervising hundreds of men at a time. And while Tom could tell us of some dozen or so fatalities on that Feather River job that was nothing as compared to the hundreds, maybe as many as a thousand Chinese workers who were killed on the Central Pacific construction job in those two years of building the transcontinental railroad. Fifth, both men had the good fortune to marry talented, devoted and stable wives who liked each other and got on well together. The fact that both these women were well poised and possessed of good lucks would also be counted an advantage, especially in the 1920' s as the newspaper society pages found a growing audience of readers with and insatiable curiosity for news of the upper crust. Additionally such a spouse was essential to someone like W. H. who had developed political aspirations and began a series of campaigns for election to public office. W. H. married the striking Anna Maria Dorothea Sophie Standard and she went by Marie Dee, in 1889. He was nearly thirty she was twenty- three, her senior year report card from the Sacred Heart Academy reveals that she was as talented and sophisticated as she was beautiful. And isn't she something? 12 When I first met Stephanie as a student in my 1700 class three or four years ago, I was able to learn before the semester was over that her maiden name was Standard because her brother was also in the class and his name was Standard. When I got to know Marie Dee, I asked Stephanie about the relationship and she said yes, she's my great- great- grandmother and I was able to assure Stephanie that there is enough good looks represented in that woman to serve the Standard family for a hundred generations. She received a perfect score, 100, in all categories of citizenship that Sacred Heart Academy report card. Her academic achievement was equally impressive with scores ranging from ninety to ninety- eight in the nine subjects graded. She and W. H. had four children, two of whom died in childhood with in six months of each other. But I was pleased to learn that we have a great granddaughter of his. Say again? Okay Granddaughter and a great- great, oh how about? That's wonderful. E. O. on the other hand married the petite Martha Ann Bybee from nearby Riverdale in June 1879. When he was twenty- four and she was just sixteen, sixteen and a half. Martha was described by a grandson as a little on the plump side in her later years, though Stephanie and I wonder about that. The photos we have seen of her in her later years do not suggest that at all, including this one. But the grandson described her as full of energy and quote, " Very interested in civic activities." She was active in a local charity, the Martha Society that assisted the needy. And incidentally I have concluded that the Martha Society did not bear relationship to her name, but if somebody knows differently about that I would appreciate hearing the details. She also served as president of the Utah 13 Federation of Women's Clubs and she participated in countless other civic activities and municipal clubs. Having recovered from a serious illness through the healing hand of Christen Science she became an ardent convert to that faith. She and E. O. raised eight children, although one, a son Earl preceded him in death, the victim of an automobile accident. So is this the family? Oh the Child Culture Society that she was active in. Say it out loud Stephanie, she is where? The third one from the left? From my left as I'm looking at it? This one? Over here? Okay alright. Oh, that beautiful house, oh wow. 1915 Stephanie says. In looking at the personalities and lives of these men as individuals we can not improve on Linda Sillito's insightful taxonomy of W. H. as Mr. Outside and E. O. as Mr. Inside. William was gregarious, smiling, athletics and always at ease in the glare of the public spotlight. Edmund was comfortable with people, but somewhat more reserved more paperwork and detail oriented and a bit more inclined to worry. W. H. first came to my attention when I began researching my master's thesis as I mentioned. And I peaked in on that state republican convention of 1920. There he was front runner for the gubernatorial nomination moving easily among the delegates shaking hands smiling and asking for support. By the second vote he had begun to slip and by the third he had lost by a decisive margin to the nominee Charles Mabey. Newspaper accounts of the day pointed to W. H.' s recent indictment under the Lever Act as the likely reason for his fade. The Lever Act was a war time 14 measure that sought to prevent price gouging in the marketing of food and fuel. And W. H. as an executive of the U& I Sugar Company had been targeted by federal prosecutors. The act its self was poorly drawn and ill advised and was in fact declared unconstitutional in 1921 at which time all indictments were dismissed, but the damage had been done. The fact that W. H. was a Weber County man would not have worked in his favor. The Utah Republican Party was firmly controlled by a nepotistic Salt Lake City clique during that era and they played political hardball. By decades end W. H.' s sterling reputation as a business man hammered down all such barriers and won him the gubernatorial nomination. By then he was a man of such status that LDS Church President Heber Grant could write him saying, " I tried to get you on the phone all night last night until ten p. m." and then apologizing to him that he had to leave town for a week quote, " Before we had arrived on a decision on what do to in the affairs of the Utah- Idaho Sugar Company." W. H. was so popular with the local press that the press even reported on his fishing and hunting trips. He was a person so esteemed by his peers around the nation that he was named director of the U. S. Chamber of Commerce and entrepreneur so successful that he stood as president of one of the half dozen largest construction companies in the nation, a businessman so esteemed that the president of the United States sought his feed back on speeches. The nomination simply could not be denied him. But facing a very popular incumbent George Dern in the general election of 1928 W. H. was to garner only forty- one percent of the vote. 15 After that W. H. turned back to business and did not again seek public office. After all he had been defeated twice at the polls first in the congressional race on 1918 and now in the gubernatorial race 1928 and he had been frustrated three times in the nominating convention seeking the gubernatorial nomination in 1920, as previously mentioned, and in 1924 in seeking the U. S. senatorial nomination in 1922. By 1929 he had started to develop health problems nevertheless his natural charm and good humor continued on and served him well until death in 1931. Oft quoted, I'm sure many of you have heard this before but I can't resist repeating it here, it's a capsule that comes from the hospital room upon hearing of Six Companies successful bid on the Hoover Dam project. He's quoted by Linda Sillito in one of the Stewart Library booklets, comes from Joseph Lee Stevenson and goes as follows, " At St. Frances Hospital the press core found William H. sitting up wrapped in a silk bathrobe puffing on a long black stogy. His bushy white hair had been carefully brushed in to place by his wife and he was eager to talk. News of the winning bid had lifted his spirits. He grinned broadly for the photographers then said " Now this dam is just a dam, but it's a damn big dam," and his eyes twinkling. " Otherwise it was no different that others we've thrown up in a dozen place," end of that quote. Unlike his younger brother E. O. on the other hand had no political aspirations. Out side of business his constituency was his family. The only babies he kissed were his own and when he shook hands it was often for the purpose of slipping a dollar to his grandchildren. They call it the silver dollar handshake. 16 Unlike W. H. who loved golf, played it often and was photographed in golfing attire along with such celebrities as Heber J. Grant and Reed Smoot and Tom isn't Charles Nibley in there? Does that look like Nibley? Ya second from the right, ya. But unlike W. H. in this kind of environment and W. H. is second from the left E. O. played golf mostly as a social necessity. Simply taking off a suit coat he turned his suspenders the other way around and played in his business attire. E. O.' s idea of leisure time fun was being at home with his family riding scooters with the children, romping with the family dog, picking fruit and vegetables from his orchard and garden and joining in the many socials hosted at his beautiful home on Eccles Street or in the immediate neighborhood. Due to the press of business however E. O. was denied the time at home that he coveted. Christmas time was the exception. He always made it a point to be home for the holidays. Incidentally I should tell you that the E. O. Wattis family put together a wonderful twenty minute DVD featuring a number of clips from home videos shot by E. O.' s family when he was still alive and in that beautiful home on Eccles Avenue and I have watched that DVD its available here, its just wonderfully revealing and you can just feel how important it was to him to be home when ever he could be, which wasn't often. In fact that point is made in that DVD by one of his granddaughters that there was a time, almost a year when he was gone the entire time. 17 E. O. was quite tall for that day, standing a full six feet. Unlike his younger brother W. H. he never took on that middle age spread but remained slender. His curly hair, rosy cheeks, spectacles and pipe all fit the image of a dignified business man. E. O. was a bulldog, albeit a gentle one. His hallmark was tenacity and his genius was energy. One of his grandsons noted quote " My grandfather's education consisted of two or three years of formal schooling," unquote. He said that E. O. could write, but made a lot of grammatical mistakes and that he quote, " came up through the process with a long construction history of being on the site and doing the work," end of this quote. In today's vernacular he would probably be described as a workaholic. In a letter to his sister Mary Jane written from Oroville California in 1909 he mentioned that he had lost weight was down to 155 pounds, remember that's on a six foot frame. He said. " I am getting very tired of railroad work and I don't know whether I will ever take another job or not. It is very monotonous for me to always be away from home and I think that I am needed at home about as bad as anybody. Besides that I am fifty- four years old and have always worked very hard and have never had but very little pleasure in life. I don't think I have hardly had my share. My young life was spent in poverty and hard work and I am not in the best of health. W. H. left here a few days go and should reach Ogden tonight. I want to make a trip home very bad but am so badly crowded with the part of business that it is my duty to look after that I can not get away now," end of his quote. E. O. Worries in this letter that he will become even less happy as he 18 grows older, that he did or didn't, cannot be discerned from the historical record, but his health problems continued. In a letter written as early as 1914 he commented on his rheumatism. In 1927 he described his bladder infection and pending surgery which promised a ninety- five percent success probability. Two years later in 1929 he mentioned his cough, eczema, insomnia and urinary infection, puss in the urine. So he obviously did not enjoy that ninety- five percent probability success rate, but he was rather in the five percent. And in 1932 he complained of swollen feet, swollen feet and inner ear problems. What the historical record also reveals is that E. O. never did relax his work schedule to any significant degree. At the time of his death in 1934 he was president of six companies and Hoover Dam was in the final phase of construction and as always he was busy with on site visits production schedules, costs, press relations and dozens of other executive level tasks. The heart attack that took his like was sudden and massive. In approaching the conclusion of this paper I return to the thesis and advance the sixth factor of success, you thought I'd forgotten it. It's not a factor that can be offered for general applicability in a business management class for its unique to the Wattis brothers. Simply stated they had each other. E. O. and W. H. were a perfect match as business partners. Their individual personalities, aptitudes, likes and dislikes complemented the others to a consummate degree. Equally important they like and trusted each, a family trait. " There are very few families that have as strong as long a love for each other as ours have and none have any stronger," wrote E. O. in a 1909 letter noting that quote, " there have 19 never been any quarrels between any of us nor any hard feelings," unquote. Those are truly remarkable statements aren't they? As close as these two brothers were however they usually did not work in pairs. They were not joined at the hip to use that contemporary phrase. Indeed their trust was so implicit that they were frequently apart and engaged in different types of tasks. A revealing snap shot in time comes from the summer of 1922. I had hoped in pouring through those hundreds and hundreds of pages of documents I could I find them writing letters on the same day. And I could then share with you what different kinds of tasks and different approaches they were taking. I never was able quite to do that, but I see them close together here in the summer of 1922. W. H. who was then preparing his run for the U. S. Senate was participating in number of activities at Lagoon. They included umpiring a softball game between a Salt Lake and Ogden young men's republican clubs and attending several wrestling and boxing matches. In the distinctive newspaper style of the day that were topped off by a battle royal between five members of the Ethiopian race all in the ring at the same time. Contrast this with E. O. who's hectic travel schedule had made him almost invisible even to his wife, " I was surprise your father was in Kansas City," she wrote to a daughter June 15th after spending that anniversary alone. This is not to imply that E. O. worked while W. H. played. W. H. was just a little more extroverted, more readily given to conduction business on the golf course or in other recreational settings. And who can doubt that how important that is in the modern corporate world. E. O. took a quieter but more direct approach to 20 business. Again we see Mr. Outside and Mr. Inside in perfect compliment. The brothers used that friendship and bond to span distances over four thousand miles of track alone, plus many more of road, tunnels, canals, etc. and to span eras from the pre- railroad era, from the pre- railroad frontier to the industrial era when they died. Again going back to the comment President Millner made the monuments to industry they created would span many more eras and serve the purposes of society long into the indefinite future and you can take that from a historian who's maternity bill was paid by a father whose pay check was back in part by Wattis money long ago and far away in Puyallup Washington. Thank you. © 2007 WSU Stewart Library, All rights reserved.

DER VÖLKERKRIEG BAND 7 Der Völkerkrieg (-) Der Völkerkrieg Band 7 (7 / 1917) ( - ) Einband ( - ) [Abb.]: Erzherzog Joseph. ( - ) Titelseite ( - ) Impressum ( - ) Der Völkerkrieg. Der italienische Krieg während des dritten Kriegshalbjahres. Italien und der Vatikan während des dritten Kriegshalbjahres. Der türkische Krieg während des dritten Kriegshalbjahres. Die Türkei während des dritten Kriegshalbjahres. Aus Persien und Afghanistan. Von Februar 1915 bis Februar 1916. Die Ereignisse in Marokko. Von September 1914 bis Februar 1916. ( - ) [2 Abb.]: (1)Der Monte Santo nördlich von Görz am mittleren Isonzo. (2)Bersaglieri auf einem vorgeschobenen Posten am Isonzo. ( - ) [2 Abb.]: (1)Ein österreichisch-ungarischer Beobachtungsposten in Tirol. (2)Blick von Tarvis gegen Süden. ( - ) Der italienische Krieg während des dritten Kriegshalbjahres. Von Anfang August 1915 bis Mitte Februar 1916. Fortsetzung von Band VIII, Seiten 1 bis 149. ([1]) Das Rätsel der Isonzo-Front. ([1]) Zusammenfassende Darstellung der Kämpfe auf den italienischen Kriegsschauplätzen. Vom 10. August 1915 bis 15. Februar 1916. (3) Zwischen den Isonzo-Schlachten. Vom 10. August bis 11. Oktober 1915. (3) Der italienische Generalangriff vom Chiese zum Isonzo. Von Mitte Oktober bis Mitte November 1915. (5) [2 Abb.]: (1)Ein italienisches Maschinengewehr wird im Hochgebirge auf eine Höhenstellung gebracht. (2)Teile italienischer Geschütze werden auf Maultieren in die Bergstellungen gebracht. ( - ) [2 Abb.]: (1)Ein italienisches Panzerautomobil vor der Abfahrt zur Front. (2)Eine österreichisch-ungarische Elektro-Benzin-Feldbahn im Karstgebiet. ( - ) Die Parlamentsschlacht und die Winterkämpfe. Vom 9. November 1915 bis 15. Februar 1916. (10) Zwischen den Isonzoschlachten. (15) Die Kämpfe an der Isonzofront. Vom 10. August bis 11. Oktober 1915. (15) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. Alle wichtigeren italienischen Generalstabsmeldungen sind zur Ergänzung beigegeben. Vgl. die Karte Band VIII, S. 99. (15) [2 Abb.]: (1)Ein österreichisch-ungarischer Mörser in Deckung. (2)Ein italienisches schweres Geschütz in Stellung. ( - ) [2 Abb.]: (1)Drahthindernisse an der österreichisch-ungarischen Isonzofront. (2)Eine Wegsperre an der österreichisch-ungarischen Isonzofront. ( - ) Die Kämpfe um den Tolmeiner Brückenkopf. Vom 13. bis 23. August 1915. (26) Die Schlacht bei Tolmein und Flitsch. Vom 10. bis 20. September 1915. (31) [2 Abb.]: (1)Ein Lager österreichisch-ungarischer Truppen im Krn-Gebiet (Monte Nero). (2)Blick auf den oberen Isonzo. - Eine italienische Granate explodiert im Fluß. ( - ) [2 Abb.]: (1)Eine österreichisch-ungarische Talsperre im Krn-Gebiet (Monte Nero). (2)Aufstieg von Tragtieren im Krn-Gebiet (Monte Nero). ( - ) Die Kämpfe im Tiroler und Kärntner Grenzgebiet I. Vom 11. August bis 11. Oktober 1915. (33) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. Alle wichtigeren italienischen Generalstabsmeldungen sind zur Ergänzung beigegeben. Vgl. die Karten in Band VIII, zwischen Seiten 16 und 17 sowie S. 51 und 99. (33) [2 Abb.]: (1)Eine österreichisch-ungarische Gebirgskanone in Tirol in Feuerstellung. (2)Oesterreichisch-ungarische Vorposten im Gefecht in den Tiroler Bergen. ( - ) [2 Abb.]: (1)Innsbrucker Standschützen vor ihrem Abmarsch zur Front. (2)Ein gegen Feindessicht geschützter Fußweg an der österreichisch-ungarischen Tiroler Front. ( - ) [2 Abb.]: (1)Ein katholischer Geistlicher im Gespräch mit österreichisch-ungarischen Soldaten. (2)Unterstand österreichich-ungarischer Offiziere oberhalb des Forts Hensel im Saifnitztal. ( - ) [2 Abb.]: (1)Ein maskierter österreichisch-ungarischer Schützengraben in einem Tiroler Hochtal. (2)Der österreichisch-ungarische Armeekommandant dekoriert die Helden von Fort Hensel. ( - ) Die Kämpfe am Monte Piano. Vom 11. bis 15. August 1915. (44) Das Gefecht am Fedaja-Paß. Am 14./15. August 1915. (46) Die Kämpfe um den Tonalepaß. Vom 15. bis 25. August 1915. (47) Die italienische Niederlage bei Lafraun. Vom 15. bis 25. August 1915. (48) Die italienische Schlappe im Sextener Abschnitt. Vom 1. bis 6. September 1915. (50) Der Angriff auf den Paradiespaß südlich der Tonalestraße. Am 14. September 1915. (51) Das Gefecht um die Sedeh-Hütte. Vom 17. bis 25. September 1915. (52) Die Bestürmung und Eroberung des Monte Coston am 22. September 1915. (54) An der kärnterischen Grenze. (55) Episoden. (56) Die Proklamation d'Annunzios an die Bürgerschaft von Trient. (56) [2 Abb.]: (1)Straßenbild aus Vielgereuth (Folgaria). (2)Ein Artillerielaufgraben an der österreichisch-ungarischen Front in Tirol. ( - ) [2 Abb.]: (1)Generalmajor Goiginger mit seinem engeren Stab an der Tiroler Front. (2)An der Tiroler Front gefangene Italiener in Erwartung ihres Mittagessens. ( - ) Eine italienische Heldentat. (57) Ein Fliegerangriff auf Brescia. (57) Der italienische Generalangriff vom Chiesefluß bis zum Isonzo. (58) Die vierte Isonzoschlacht. Vom 12. Oktober bis zum 8. November 1915. (58) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. (58) [2 Abb.]: (1)Tiroler Standschützen auf einem Felsgrat. (2)Oesterreichisch-ungarische Truppen bei einem Aufstieg durch Moränen. ( - ) [2 Abb.]: (1)Eine Maschinengewehrabteilung der Tiroler Landesschützen. (2)Von den österreichisch-ungarischen Truppen gebaute Drahtseilbahn zur Beförderung von Munition und Proviant im Kampfgebiet an der Tiroler Front. ( - ) [2 Abb.]: (1)Ein österreichisch-ungarischer 30,5 cm Mörser im Feuer an der Isonzofront. (2)Sandkörbe werden zum Ausbau der österreichisch-ungarischen Stellungen am Isonzo an die Front gebracht. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Truppen in einem Dorfe an der Isonzofront. (2)Ein österreichisch-ungarischer Scheinwerferzug auf dem Marsche zur Isonzofront. ( - ) Der Verlauf der vierten Isonzoschlacht. Vom 17. Oktober bis 3. November 1915. (67) [2 Abb.]: (1)Um Monte San Michele gefangen genommene Italiener beim Abtransport. (2)In italienische Gefangenschaft geratene österreichisch-ungarische Soldaten hinter der Kampffront. ( - ) [2 Abb.]: (1)Brotbäckerei in Erdbacköfen hinter der österreichisch-ungarischen Isonzofront. (2)Oesterreichisch-ungarische Truppen ruhen hinter der Isonzofront in einem Zeltlager, das durch Zweige gegen Fliegersicht geschützt ist. ( - ) Am Monte San Michele. Aus den Kämpfen der ersten Novembertage 1915. Bericht aus dem K.u.K. Kriegspressequartier vom 12. November 1915. (73) Episoden aus der vierten (dritten) Isonzo-Schlacht. Bericht aus dem K.u.K. Kriegspressequartier vom 29. November 1915. (76) Die Kämpfe im Tiroler und Kärntner Grenzgebiet II. Vom 12. Oktober bis 12. November 1915. (79) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. Alle wichtigeren italienischen Generalstabsmeldungen sind zur Ergänzung beigegeben. (79) Die österreichisch-ungarischen Sperrforts im Tiroler und Kärntner Grenzgebiet unter italienischem Feuer. (85) [2 Abb.]: (1)Ein österreichisch-ungarischer Beobachtungsposten in den völlig zusammengeschossenen Klostergebäulichkeiten des Monte Santo bei Görz. (2)Ein Unterstand österreichisch-ungarischer Truppen auf der Podgorahöhe nördlich von Görz. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Offiziersmesse im Krngebiet. Der Regimentskommandeur sitzt in der Mitte. (2)Oesterreichisch-ungarisches Lager an der Isonzofront. ( - ) Episoden. (90) Ein Nachfolger Sepp Innerkoflers. (90) Der Ziegenhirt. (90) Von den Verteidigern der Naglerspitze. (91) Die Winterkämpfe. Die Parlamentsschlacht und die Winterkämpfe am Isonzo. Vom 9. November 1915 bis 15. Februar 1916. (92) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. (92) [2 Abb.]: (1)Das Kampfgebiet des Col die Lana. (2)Oesterreichisch-ungarische Truppen beim Bau eines Unterstandes in den Dolomiten. ( - ) [2 Abb.]: (1)Die Cadini, Marmarolles und der Monte Cristallo von der Plätzwiese aus. (2)Gesamtansicht von Riva am Gardasee. ( - ) [Abb.]: Blick in das Isonzotal. - Im Hintergrund Artillerie in Tätigkeit. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Truppen kehren nach der Ablösung aus der Schwarmlinie vom Doberdo-Plateau in ihre Standquartiere zurück. (2)Aus einem Schützengraben der österreichisch-ungarischen Isonzofront. ( - ) [2 Abb.]: (1)Eine Straße in der Stadt Görz nach einer Beschießung. (2)Die Reste der Klosterkirche auf dem Monte Santo bei Görz. ( - ) [2 Abb.]: (1)Ungarische Husaren als Vorposten in der Isonzofront. (2)Oesterreichisch-ungarische Truppen beim Bau von Schützengräben an der Isonzofront. ( - ) Die Parlamentsschlacht. (Die fünfte Isonzoschlacht). Vom 9. November bis Anfang Dezember 1915. (109) Ratternder Tod. (112) Die Wiedereroberung des Kirchenrückens von Oslavija. Am 14. und 24. Januar 1916. (113) In den österreichisch-ungarischen Schützengräben und hinter der Front auf der Doberdo-Hochfläche. (114) Im Winter auf den Höhen des Krn. (118) Im Kampf um den Rombon. (119) [2 Abb.]: (1)Eine österreichisch-ungarische Patrouille erklimmt eine Felsenwand an der Tiroler Grenze. (2)Ein italienisches Geschütz wird im Tiroler Kampfgebiet in eine Bergstellung gebracht. ( - ) [2 Abb.]: (1)Transport italienischer Gefangener in Tirol. (2)Ein russisches Maschinengewehr in Stellung gegen die Italiener an der kärntnerischen Front. ( - ) Die Beschießung von Görz. Vom 18. Oktober 1915 bis Mitte Februar 1916. (121) [2 Abb.]: (1)Transport österreichisch-ungarischer Verwundeten von einer Bergstellung in den Dolomiten nach den Verbandplatz. (2)Oesterreichisch-ungarische Soldaten bei einem Handgranatenangriff aus einem Schützengraben in den Dolomiten. ( - ) [2 Abb.]: (1)Eine österreichisch-ungarische Patrouille unter Führung des Tiroler Dichters Hauptmann Arthur von Wallpach im Hochgebirge an der Tiroler Grenze. (2)Ein Alpini-Vorposten an der Tiroler Grenze. ( - ) Episoden. (126) Die Zerstörung des Schlosses Duino durch die Italiener und der österreichisch-ungarische Denkmälerschutz in der Kriegszone. (126) Eine Nachtkanonade am Isonzo. (127) Ein Patrouillenkampf. (127) [2 Abb.]: (1)Befestigungen vor den österreichisch-ungarischen Stellungen der Tiroler Front. (2)Ein italienischer Schützengraben am Großen Pal an der Kärntner Front. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Heldengräber in den Dolomiten. (2)Oesterreichisch-ungarische Truppen vor ihren verschneiten Unterständen in den Dolomiten. ( - ) Die Kämpfe in den Tiroler und Kärntner Grenzgebieten III. Vom 13. November 1915 bis 15. Februar 1916. (129) Chronologische Uebersicht nach den österreichisch-ungarischen Generalstabsmeldungen. Alle wichtigeren italienischen Generalstabsmeldungen sind zur Ergänzung beigegeben. (129) Im Winter in den Hochgebirgsstellungen der Tiroler und Kärntner Front. (136) [2 Abb.]: (1)Ein Kampfflugzeug der österreichisch-ungarischen Armee. (2)Landung eines österreichisch-ungarischen Kampfflugzeuges nach dem erfolgreichen Bombardement einer oberitalienischen Festung. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarisches Wasserflugzeug über der Adria. (2)Start eines Wasserflugzeugs der österreichisch-ungarischen Marine. ( - ) Die Luftangriffe auf Verona, Mailand, Schio und Brescia am 14. November 1915 sowie am 14. und 15. Februar 1916. (138) Die Luft- und Seekämpfe in der Adria. (141) Die Luftkämpfe. Von Mitte August 1915 bis Mitte Februar 1916. (141) Chronologische Uebersicht nach den Meldungen des K.u.K. Flottenkommandos und ergänzenden Mitteilungen. (141) Der Luftangriff auf Venedig. Am 5. September 1915. (144) Die Luftangriffe auf Triest und Venedig. Am 24. und 25. Oktober 1915. (145) Von den Flottenkämpfen in der Adria. Von Mitte August 1915 bis Mitte Februar 1916. (147) Chronologische Ueberischt nach den Meldungen des K.u.K. Flottenkommandos und ergänzenden Mitteilungen. (147) Der Untergang des "U 3". Am 12. August 1915. (149) Die italienische amtliche Kriegsberichterstattung. (150) Der Gewinn und die Verluste Italiener. (151) [Karte]: Uebersichtskarte der besetzten Landesteile an der Südwestfront Ende 1915. (151) Von den österreichisch-ungarischen Heerführern. (152) Nach den amtlichen Meldungen und ergänzenden Mitteilungen. Kundgebungen und Auszeichnungen. (152) [2 Abb.]: (1)Der Kommandeur der Südwestfront Generalmajor Herzog Eugen (links) und Erzherzog Josef bei einer Besichtigung der Isonzofront. ( - ) [2 Abb.]: (1)Major Prinz Elias von Bourbon Parma und Feldzeugmeister Wurm bei der Beobachtung eines Artilleriegefechtes an der Isonzofront. (2)General d. Kav. Erzherzog Josef dekoriert Mannschaften seines Korps für ihr tapferes Verhalten vor dem Feinde an der Isonzofront. ( - ) Die Feier des Geburtstags des Kaisers Franz Josef. Der Gedenktag des hundertjährigen Bestandes der vier Tiroler Kaiserjäger-Regimenter. (153) Besuche des Erzherzog-Thronfolgers und des Armeekommandanten Erzherzogs Friedrich an der Südwestfront. (154) Von den italienischen Heerführern. (155) Nach den amtlichen Meldungen und ergänzenden Mitteilungen. Kundgebungen. (155) Personalien und Auszeichnungen. (156) Die Besuche des Generals Joffre und des Feldmarschalls Kitchener und des Ministerpräsidenten Briand an der italienischen Front. (156) Der König von Italien an der Front. (158) Luigi Cadorna. (158) [2 Abb.]: (1)König Victor Emanuel von Italien mit dem Grafen von Turin auf einer Inspektionsreise an der Front. (2)General Joffre und König Victor Emanuel von Italien beim Frühstück während eines Besuches an der italienischen Front. ( - ) [2 Abb.]: (1)Der französische Generalissimus Joffre besichtigt bei seinem Besuch der italienischen Front ein schweres italienisches Geschütz. (2)Feldmarschall Lord Kitchener bei seinem Besuch im italienischen Hauptquartier (Von links nach rechts: Oberst Pennella, General Diaz, Lord Kitchener, General Cadorna). ( - ) Vom italienischen Heer. (161) [4 Abb.]: (1)Vize-Admiral Camillo Corsi. Der italienische Marineminister. (2)Vittorio Emanuele Orlando. Der italienische Justizminister. (3)Luigi Luzzatti. Der frühere italienische Ministerpräsident und Finanzminister. (4)Marchese Camillo Garoni. Der italienische Gesandte in Konstantinopel. ( - ) [2 Abb.]: (1)Die Loggetta vor dem Markusturm in Venedig gegen Fliegerangriffe mit Sandsäcken geschützt. (2)Der Saal zur Herstellung von Geschossen in einer italienischen Munitionsfabrik. ( - ) Die Italiener in den besetzten Gebieten. (166) Italien und der Vatikan während des dritten Kriegshalbjahres . Von Anfang August 1915 bis Mitte Februar 1916. Fortsetzung von Band VIII, Seiten 150 bis 174. ([167]) Der Umschwung in der italienischen Stimmung. ([167]) Maßnahmen der italienischen Regierung. Nach den amtlichen Meldungen und ergänzenden Mitteilungen. (171) Personalien. (171) Die italienische Kriegserklärung an die Türkei und ihre Gründe. (172) Der Bruch zwischen Italien und Bulgarien. (174) Der Beitritt Italiens zum Londoner Vertrag. (174) Italiens Teilnahme an den Balkankämpfen. (175) Militärische Maßnahmen. (176) Maßnahmen gegen die Angehörigen feindlicher Staaten. (177) Von den nordafrikanischen Kolonien Italiens. Nach den amtlichen Meldungen und ergänzenden Mitteilungen. (178) Die erste Kriegstagung des Parlaments. (179) Vor der Eröffnung. (179) Die Mitteilungen der Regierung an das Parlament. (180) Das Vertrauensvotum für die Regierung. (184) Die Genehmigung des provisorischen Haushaltsplanes und die Vertagung. (188) [2 Abb.]: (1)Gabriele d'Annunzio hält in Aquileja eine Ansprahe am Gedenktage für die an der Front Gefallenen. (2)Der französische Ministerpräsident Briand verläßt bei seiner Ankunft in Rom mit dem italienischen Ministerpräsidenten Salandra das Bahnhofgebäude. ( - ) [3 Abb.]: (1)Kardinal Serafino Bannutelli † 18. August 1915. (2)Kardinal Rafaele Scapinelli. Apostolischer Nuntius in Oesterreich-Ungarn. (3)Kardinal Andreas Frühwirth. Apostolischer Nuntius in Deutschland. ( - ) Die Verhandlungen des Senats. (190) [3 Abb.]: (1)General Sir Charles Carmichael Monro. Der Oberbefehlshaber des Dardanellenkorps der Alliierten. (2)Generalmajor W.R. Birdwood. Kommandeur der Australier und Neu-Seeländer. (3)Ein englisches Truppentransportschiff für die Dardanellen bestimmt vor dem Auslaufen in Spithead. ( - ) [2 Abb.]: (1)Das britische Schlachtschiff "Henry IV." vor den Dardanellen. (2)Aus einem Lager türkischer Truppen. ( - ) Die finanziellen und wirtschaftlichen Verhältnisse Italiens im dritten Kriegshalbjahr. (193) Kundgebungen der Regierung. (198) Die Rede des Ministers Barzilai in Neapel am 26. September 1915. (198) Die Rede des Justizministers Orlando in Palermo. Am 20. November 1915. (200) [Abb.]: Konstantinopel. ( - ) [2 Abb.]: (1)Ein Truppenausschiffungsplatz in der Nähe von Gallipoli. (2)Konstantinopel. Mündung der "Süßen Wasser" von Europa in das "Goldene Horn". ( - ) Die Reden des Ministers Barzilai in Bologna, Padua und Mailand. Am 15., 17. und 25. Januar 1916. (202) Die Reise Salandras nach Turin, Mailand und Genua. Am 20. Januar und 1. bis 3. Februar 1916. (203) Vom König. Die amtlichen Meldungen. (204) Die Beziehungen zu den verbündeten Staaten. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (205) Der militärische und wirtschaftliche Zusammenschluß der Entente. (205) Die Vorbereitungen für den zukünftigen Wirtschaftskrieg. (208) Der Vatikan. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (208) Personalien. (208) Kundgebungen. (208) Die Kriegsfürsorge des Heiligen Stuhles. (212) Die römische Frage. (212) Der Besuch des Kardinals Mercier im Vatikan. Vom 14. Januar bis 25. Februar 1916. (213) Der türkische Krieg während des dritten Kriegshalbjahres. Von Anfang August 1915 bis Anfang Februar 1916. Fortsetzung von Band VIII, Seiten 175 bis 312. ([216]) Die Politik der Flankenbedrohung. ([216]) [2 Abb.]: (1)Kontre-Admiral Le Bon verteilt das französische Kriegskreuz an Mannschaften des Kreuzers "Dupleix" im Hafen von Mudros. (2)Generalmajor W. R. Birdwood, der Kommandeur der Australier und Neuseeländer, auf der Gallipoli-Halbinsel. ( - ) [2 Abb.]: (1)Das türkische Linienschiff "Barbaroß Hairedin" (früher Kurfürst Friedrich Wilhelm), das am 8. August 1815 in den Dardanellen versenkt wurde. (2)Das britische Unterseeboot "E. 7", das am 4. September 1915 in den Dardanellen zum Sinken gebracht wurde. ( - ) Der Kampf um die Dardanellen und die Räumung der Gallipoli-Halbinsel. Vom 6. August 1915 bis 2. Februar 1916. (218) Vom Oberkommando des englisch-französischen Expeditionskorps. (218) Chronologische Uebersicht nach den Meldungen des türkischen Hauptquartiers. Die wichtigeren englischen und französischen Meldungen sind beigegeben. (218) [2 Abb.]: (1)Unterstände der "Anzac"-Truppen an der Suvla-Bucht. (2)Türkische Gefangene werden von britischen Truppen hinter die Front gebracht. ( - ) [2 Abb.]: (1)Französisches Geschütz in Feuerstellung bei Sedd-ül-Bahr. (2)Blick über das Gelände gegen die Suvla-Bucht, in dem die "Anzac"-Truppen vorzudringen versuchten. ( - ) [2 Abb.]: (1)Von der Räumung der Stellungen an der Suvla-Bucht. - Ein britisches Geschütz mit seiner Bedienungsmannschaft wird am hellen Tage auf einem Floß zu einem Transportdampfer gezogen. (2)Am Tage der Räumung der Südspitze der Halbinsel Gallipoli. - Eine türkische Granate schlägt nahe dem Landungssteg des Lancashire-Abschnittes ins Meer. ( - ) [2 Abb.]: (1)Das englische Linienschiff "Cornwallis" im Feuer gegen die türkischen Stellungen in den Bergen zur Deckung der Räumung der englischen Dardanellen-Stellungen, die im Hintergrunde brennen. (2)Verwundete britische Soldaten werden im Hafen von Malta aus Barken in ein Hospitalschiff gebracht. ( - ) Zusammenfassende Darstellung. (250) Die Landung in der Suvla-Buch. Nach türkischen und deutschen Berichten und Meldungen. (253) Der Bericht des Generals Sir Jan Hamilton. (254) Nach englischen Berichten. (256) Die Schlachten bei Anafarta am 21., 28. und 29. August 1915. (260) [Karte]: Uebersichtskarte über die Umgebung der Suvla-Bucht. (261) Die Kämpfe im September und Oktober 1915. (262) Die Erbeutung des U-Bootes "Turquoise" am 30. Oktober 1915. (263) Der Entschluß zum Rückzug und die Räumung von Gallipoli. (264) [2 Abb.]: (1)Kampfflieger Hauptmann Buddecke. (2)Eine Fliegeraufnahme eines Teiles der Dardanellen. ( - ) [2 Abb.]: (1)Das ehemalige französische Unterseeboot "Turquoise" verläßt nach der Taufe als "Müstedjib Onbaschi" die Landungstelle. (2)Der Turm des britischen Unterseebootes "E.15", der von einer Granate getroffen wurde (vgl. VIII, S. 218 und 232). ( - ) Die K. u. K. Mörser auf Gallipoli. (268) Aus den verlassenen Lagern der Entente auf der Gallipolihalbinsel. (270) Episoden. (272) Die englische Sorge für die türkische Marine. (272) "Goeben"- und "Breslau"-Leute im Kampfe um Gallipoli. (273) Das englisch-französische Dardanellenheer und seine Verluste. (274) Freude und Anerkennung über die Vertreibung der Entente von Gallipoli. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (278) Die Ereignisse im Schwarzen Meer. Von Anfang August 1915 bis Anfang Februar 1916. (279) Chronologische Uebersicht nach den Meldungen des türkischen Hauptquartiers. Einige Meldungen des russischen Großen Generalstabs sind zur Ergänzung beigegeben. (279) Personalien. (280) Deutsche Unterseeboote im Schwarzen Meere. (280) [2 Abb.]: (1)Großfürst Nikolai Nikolajewitsch als Oberkommandierender an der Kaukasusfront. (2)Der russische General Judenitsch beim Studium des russischen Vormarsches auf Erzerum. ( - ) [2 Abb.]: (1)Türkische Kolonne bei einem Einkehrhaus im Taurusgebirge. (2)Türkische Kolonne auf dem Marsch durch das Taurusgebirge. ( - ) Die Ereignisse im östlichen Mittelländischen und im Aegäischen Meer. Von Anfang August 1915 bis Mitte Februar 1916. Nach den amtlichen Meldungen und ergänzenden Mitteilungen. (281) Blockade-Maßnahmen. (281) Chronologische Uebersicht. Die zahlreichen Meldungen über die Versenkung von Handelsschiffen sind hier nicht berücksichtigt. (282) Die Kämpfe im Kaukasus und in Persien. Von Anfang August 1915 bis Anfang Februar 1916. (286) Der Wechsel im Oberbefehl der russischen Kaukasusarmee. (286) Chronologische Uebersicht nach den Meldungen des türkischen Hauptquartiers. Einzelne amtliche russische Meldungen sind beigegeben. (287) Zusammenfassende Darstellung. (297) Die deutsche Rote Kreuz-Expedition in Erzindien. (299) Die Kämpfe am Persischen Golf. Von Anfang August 1915 bis Anfang Februar 1916. (301) Die Verkündigung des Heiligen Kriegs für die Schiiten. (301) Vom Oberkommando der türkischen und britischen Irakarmeen. (301) Die Uebertragung des Oberbefehls der türkischen Bagdad-Armee an Feldmarschall von der Goltz. (301) Der Wechsel im Kommando der britischen Irak-Armee. (302) Chronologische Uebersicht nach den Meldungen des Türkischen Hauptquartiers. Einzelne amtliche britische Meldungen und Mitteilungen sind beigegeben. (302) Zusammenfassende Darstellung. (311) [2 Abb.]: (1)Der russische Oberkommandierende in Persien General Baratow nimmt am russischen Weihnachtstag am 8. Januar 1916 in Teheran die Parade einer Kosaken Brigade ab. (2)Kosaken im Kaukasus auf einem Erkundigungsritt. ( - ) [2 Abb.]: (1)Eine britisch-indische Maschinengewehr-Abteilung in Mesopotamien. (2)Fliegeraufnahme einer britischen Schiffbrücke über den Tigris mit einem Kanonenboot zur Bewachung. ( - ) Vom britischen Expeditionskorps in Mesopotamien. (315) Die Ereignisse in Syrien und Aegypten. Von Anfang August 1915 bis Anfang Februar 1916. (317) Personalien. (317) Chronologische Uebersicht nach den Meldungen des türkischen Hauptquartiers und ergänzenden Mitteilungen. (317) Aus Syrien. (317) An der Ostgrenze Aegyptens. (318) An der Westgrenze Aegyptens. (318) Syrien, die empfindlichere Stelle der Türkei. (319) [3 Abb.]: (1)General Sir John Nixon. Der britische Kommandeur in Mesopotamien. (2)Generalleutnant Sir Percy Lake. Der neue britische Kommandeur in Mesopotamien. (3)Blick auf die Stadt Bagdad. ( - ) [2 Abb.]: (1)General Sir John Nixon mit den Offizieren seines Stabes in seinem Hauptquartier. (2)Der britische General Townshend auf dem Vormarsch nach Bagdad in seinem Hauptquartier. ( - ) Von der Verteidigung Aegyptens. (321) Die Kämpfe in Südwest-Arabien. (321) Die Araber des Hedschas für den "Heiligen Krieg". (321) Chronologische Uebersicht. Nach den amtlichen türkischen und britischen Meldungen und ergänzenden Mitteilungen. (321) Die englische Darstellung. (324) Vom Sultan und den osmanischen Heerführern. Nach den amtlichen Meldungen und ergänzenden Mitteilungen. (326) Vom Sultan. (326) Ernennungen und Auszeichnungen. (326) Völkerrechtsverletzungen der Alliierten. (327) Die Türkei während des dritten Kriegshalbjahres. Von Anfang August 1915 bis Februar 1916. Fortsetzung von Band VIII, Seiten 313 bis 320. ([328]) Von der türkischen Regierung. Nach amtlichen Meldungen und ergänzenden Mitteilungen. ([328]) Personalien. Die Erklärung des "Heiligen Kriegs" gegen Italien. Militärische und Verwaltungs-Maßnahmen. ([328]) Maßnahmen gegen die Angehörigen feindlicher Staaten. ([328]) [Abb.]: Generalfeldmarschall von der Goltz Pascha mit seinen Stabsoffizieren. Von links nach rechts: Adjut. Hauptmann Adil; Major Medschib; Oberst Schükri-Bey; von der Goltz Pascha; Oberleutnant Wilhelmi-Bey; Adjut. Hauptmann Riza-Bey. ( - ) [2 Abb.]: (1)Ein britischer Pferdetransport auf dem Tigris beim Vormarsch auf Bagdad. (2)Fliegeraufnahme von Schützengräben (rechts) zum Schutze eines britischen Lagers zwischen einem Palmenhain und einem Sumpf am Ufer des infolge der Regenzeit stark gestiegenen Tigris. ( - ) Die Türkei, die Verbündeten und Neutralen. (329) Der Wechsel in der deutschen Botschaft. (329) Die Beziehungen zu den Verbündeten. (329) Von den Beziehungen zu Griechenland und zum Vatikan. (330) Vom türkischen Parlament. (331) Der Schluß der ersten Kriegstagung. Vom 28. September bis 13. November 1915. (331) Von der zweiten Kriegstagung. Vom 14. November 1915 bis Februar 1916. (334) [2 Abb.]: (1)Die türkische Wüstenarmee versorgt sich in einer Oase mit Wasser. (2)Blick auf ein türkisches Zeltlager in der ägyptischen Wüste. ( - ) [2 Abb.]: (1)Deutsche Sanitätsoffiziere mit einem türkischen Hodscha vor einem türkischen Lazarett. (2)Aus dem Garnisonslazarett in Jerusalem. ( - ) Finanzielle und wirtschaftliche Maßnahmen. (337) Nachrichten aus Aegypten. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (339) Aus Persien und Afghanistan. Von Februar 1915 bis Februar 1916. Fortsetzung von Band IV, Seiten 186 und 240. ([341]) Nachrichten aus Persien. ([341]) Nachrichten aus Afghanistan. (342) Die Ereignisse in Marokko. Von September 1914 bis Februar 1916. Fortsetzung von Band I, Seiten 155 und 156. ([343]) Amtliche Meldungen. ([343]) Die kriegerischen Ereignisse. ([343]) [2 Abb.]: (1)Halil-Bey. Der türkische Minister des Aeußeren. (2)Vom Begräbnis des Freiherrn v. Wangenheim, des verstorbenen deutschen Botschafters in Konstantinopel. - In erster Reihe die türkischen Minister. ( - ) [2 Abb.]: (1)Der Schah von Persien (von links gesehen der zweite auf dem Bilde) besichtigt in Teheran ein russisches Flugzeug. (2)Persisches Militär in einer Straße von Teheran. ( - ) Der Völkerkrieg. Das deutsche Reich während des dritten Kriegshalbjahres. Die Ereignisse an der Ostfront im dritten Kriegshalbjahr. Von August 1915 bis Februar 1916. ( - ) Das deutsche Reich während des dritten Kriegshalbjahres. Von August 1915 bis Februar 1916. Fortsetzung von Band VII, Seiten 1 bis 73. ([1]) Die Deutschen auf dem Wege zur einigen und freien Nation. ([1]) Von der Reichsregierung. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (4) Personalien. (4) Kundgebungen und Proteste. (4) Ueber die Kriegsziele und Friedensabsichten. (4) [3 Abb.]: (1)Dr. Karl Johannes Kaempf. Stadtältester von Berlin. Präsident des deutschen Reichstags. (2)Philipp Scheidemann. Redakteur; Erster Vizepräsident des deutschen Reichstags. (3)Heinrich Dove. Geh. Justizrat; Zweiter Vizepräsident des deutschen Reichstags. ( - ) [3 Abb.]: Karl Friedrich Oskar Freiherr v. Gamp-Massaunen. Wirkl. Geh. Ober-Regierungsrat und Mitglied des deutschen Reichstags. (2)Friedrich Viktor Kuno Graf v. Westarp. Oberverwaltungsgerichtsrat und Mitglied des deutschen Reichstags.(3)Dr. Ernst v. Heydebrand und der Lasa. Landrat a.D. und Mitglied des deutschen Reichstags. ( - ) Proteste. (6) Militärische Maßnahmen. (7) Maßnahmen gegen die Angehörigen feindlicher Staaten. Verwaltungsmaßnahmen. (8) Die fünfte Kriegstagung des deutschen Reichstags. Vom 19. bis 27. August 1915. (8) Die Rede des Reichskanzlers am 19. August 1915. (8) [3 Abb.]: (1)Dr. Peter Spahn. Oberverwaltungsgerichtspräsident und Mitglied des deutschen Reichstags. (2)Adolf Gröber. Landgerichtsrat und Mitglied des deutschen Reichstags. (3)Matthias Erzberger. Schriftsteller und Mitglied des deutschen Reichstags. ( - ) [3 Abb.]: (1)Eugen Schiffer. Oberverwaltungsgerichtsrat und Mitglied des deutschen Reichstags. (2)Ernst Bassermann. Rechtsanwalt und Mitglied des deutschen Reichstags. (3)Dr. Gustav Stresemann. Syndikus des Verbands sächsischer Industrieller und Mitglied des deutschen Reichstags. ( - ) Die Rede des Schatzsekretärs und die Bewilligung des neues Kriegskredits von 10 Milliarden Mark am 20. August 1915. (18) [3 Abb.]: (1)Dr. Friedrich Naumann. Pfarrer a.D. und Mitglied des deutschen Reichstags. (2)Friedrich v. Payer. Geh. Rat, Rechtsanwalt und Mitglied des deutschen Reichstags. (3)Dr. Konrad Haußmann. Rechtsanwalt und Mitglied des deutschen Reichstags. ( - ) [3 Abb.]: (1)Dr. Georg Gradnauer. Redakteur und Mitglied des deutschen Reichstags. (2)Eduard Bernstein. Schriftsteller und Mitglied des deutschen Reichstags. (3)Dr. Eduard David. Redakteur und Mitglied des deutschen Reichstags. ( - ) [Abb.]: Die deutsche Kaiserin Auguste Viktoria und die deutsche Kronprinzessin Cäcilie mit ihren Söhnen den Prinzen Wilhelm, Louis Ferdinand, Hubertus und Friedrich. ( - ) [2 Abb.]: (1)Feldmarschall Graf Haeseler an der Front. (2)Die Ansprache des Reichskanzlers von Bethmann Hollweg bei der Enthüllung des "Eisernen Hindenburg" auf dem Königsplatz zu Berlin. Auf der Estrade Prinzessin August Wilhelm in der Mitte, links Frau v. Hindenburg, rechts Frau Ludendorff. ( - ) Die Sitzungen des Reichstags bis zum Schluß der fünften Kriegstagung. Vom 21. bis 27. August 1915. (29) Die sechste Kriegstagung des deutschen Reichstags. (32) Der erste Teil der Tagung. Vom 30. November bis 21. Dezember 1915. (32) Die Sitzung vom 30. November 1915. (32) [2 Abb.]: (1)Eine russische Schleichpatrouille. (2)Ein russisches Kampfflugzeug. Einer der Fliegeroffiziere befestigt eine Bombe am Apparat. ( - ) [2 Abb.]: (1)Russische schwere Artillerie in Feuerstellung. (2)Ein bombensicherer russischer Unterstand an der Ostfront. ( - ) Die sozialdemokratische Friedensinterpellation und die Ansprachen des Reichskanzlers am 9. Dezember 1915. (33) [2 Abb.]: (1)Eine erbeutete russische Bomben-Schleudermaschine. (2)Erbeutete russische Leuchtraketen. ( - ) [2 Abb.]: (1)Ein an der Ostfront erbeutetes japanisches Schiffsgeschütz. (2)Bei den Kämpfen an der Ostfront eroberte russiche Maschinengewehre. ( - ) Die Genehmigung eines neues Kriegskredits und anderer Vorlagen. Vom 14. bis 21. Dezember 1915. (44) Der zweite Teil der Tagung. Vom 11. bis 18. Januar 1916. (49) Aenderungen in den Reichstagsfraktionen. (53) Deutschlands wirtschaftliche und soziale Organisation während des dritten Kriegshalbjahres. (54) Die staatswirtschaftliche Organisation. (54) [2 Abb.]: (1)Gefangene Russsen werden von deutschen und österreichisch-ungarischen Offizieren verhört. (2)Der Beobachtungsposten einer deutschen Batterie. ( - ) [2 Abb.]: (1)Ein deutscher Verwundetentransport aus der Feuerlinie der Ostfront nach einem Etappenort. (2)Eine deutsche Feldbäckerei hinter der Ostfront. ( - ) Der Kampf gegen den Kriegswucher. (59) Der Nahrungsmittelaufwand. (62) [Tabelle]: Die Konsumgenossenschaft Berlin und Umgegend, denen etwa 125 Großberliner Verkaufsstellen angeschlossen sind, haben nach den Preiszusammenstellungen des statistischen Amtes der Stadt Berlin folgende Normalpreise (für ein Pfund, bei Zitronen für ein Stück) genommen. (63) [3 Tabellen]: (64) [2 Abb.]: (1)Oesterreichisch-ungarische Arbeitssoldaten an der Ostfront beim Mittagessen. (2)Oesterreichisch-ungarisches Feldgeschütz in gedeckter Stellung an der Ostfront. ( - ) [2 Abb.]: (1)Vernähen eines schwer verletzten Pferdes durch österreichisch-ungarische Veterinäre. (2)Vom Stiftungszug des Grafen Anton Karolyi. - Ein verwundeter österreichisch-ungarischer Soldat wird einwaggoniert. ( - ) Das Börsen- und Bankwesen. (65) [Tabelle]: (65) [2 Tabellen]: (1)Zweite Kriegsanleihe. Zeichnungsergebnis im Vergleich mit den früheren, wie folgt: (2)Die Gliederung der Zeichnungen zigt das nachstehende Bild: (67) [Tabelle]: Erfolge der dritten Kriegsanleihe: (68) [3 Tabellen]: (1)"Die wirtschaftlichen Kräfte Deutschlands im Kriege": (2)Deckung der Reichsbanknoten. (3)Goldbestand und Goldzuwachs. (69) Industrie, Handel und Handwerk. (71) [Tabelle]: Nach den Mitte Oktober 1915 vorliegenden Geschäftsabschlüssen gaben Dividenden: (72) [2 Abb.]: (1)Eine russische Artilleriestellung mit Fliegerdeckung. (2)Ein österreichisch-ungarischer 30,5 cm Mörser im Feuer. ( - ) [2 Abb.]: (1)Erbeutete fahrbare russische Schützendeckung mit Schießscharten. (2)Eine erbeutete Maschine, die von den Russen bei ihrem Rückzug zum Aufreißen und Zerstören der Landstraßen benutzt wurde. ( - ) Der Arbeitsmarkt. (78) [2 Tabellen]: (1)Uebersicht über die Arbeitsmarktverhältnisse während des dritten Kriegshalbjahres: (2)Es kamen dabei Arbeitssuchende auf je 100 Stellen: (79) Die Kriegswohlfahrt. (81) Von den Beziehungen zu den verbündeten Staaten. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (83) Kundgebungen, Auszeichnungen und Personalien. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (84) Vom Kaiser. Personalien. (84) Des Kaisers Geburtstag. (85) Kundgebungen. (86) Auszeichnungen. (88) [2 Abb.]: (1)Russische Gefangene werden von deutschen Ulanen hinter die Front gebracht. (2)Eine österreichisch-ungarische Ulanen-Patrouille erhält Erfrischungen in einem russischen Dorfe. ( - ) [2 Abb.]: (1)Ein österreichisch-ungarischer 30,5 cm Mörser auf dem Transport in die Stellung. (2)Eroberte russische Befestigungen und Unterstände am Ufer eines Flusses. ( - ) Von der deutschen Kaiserin und der Kronprinzessin. (89) Von den deutschen Bundesfürsten und freien Hansestädten. (89) Ernennungen. (89) Kundgebungen. (89) Ordensstiftungen. (90) Vom Reichskanzler. (91) Personalien. (93) Von Ostpreußens Kriegsnot. Von Anfang des Krieges bis Februar 1916. (93) Kundgebungen und Maßnahmen. (93) Von der Zerstörung Ostpreußens. (94) [2 Abb.]: (1)Von einem Kampffeld vor Riga unmittelbar nach der Beendigung des Kampfes. (2)Aus einem von den Russen fluchtartig verlassenen festungsartig ausgebauten Schützengraben. ( - ) [2 Abb.]: (1)Das Quartier eines deutschen Bataillonsstabs vor Dünaburg. (2)Deutsche Soldaten vor einem Küchenunterstande im Walde vor Dünaburg. ( - ) Vom Wiederaufbau Ostpreußens. (97) Besuche und Auszeichnungen. Nach amtlichen Berichten und ergänzenden Mitteilungen. (98) Kriegsmaßnahmen in Elsaß-Lothringen. Von Beginn des Krieges bis Februar 1916. (99) Maßnahmen und Kundgebungen. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (99) Die Kriegsschäden. (100) Maßnahmen zur Linderung der Kriegsschäden. (101) Die Ereignisse an der Ostfront im dritten Kriegshalbjahr. Von Anfang August 1915 bis Februar 1916. Fortsetzung von Band IX, Seiten 1 bis 192. ([103]) Der gemeine Soldat. Der Grundstein der deutschen Erfolge. ([103]) Zusammenfassende Darstellung. Von Anfang August 1915 bis Anfang Februar 1916. (104) Die völlige Zertrümmerung des westrussischen Festungssystems. Vom 11. August bis 4. September 1915. (104) [2 Abb.]: (1)Ansicht der Stadt Kowno mit der von deutschen Pionieren erbauten Pontonbrücke. (2)Blick auf die Festung Kowno am Zusammenfluß von Njemen und Wilia aus einem deutschen Flugzeug. ( - ) [2 Abb.]: (1)Doppelte Eisengitter vor der Festung Kowno, im Hintergrund Drahtverhaue. (2)Deutsche Offiziere besichtigen die Wirkung deutscher schwerer Granaten in Fort I von Kowno. ( - ) Der Wechsel im Oberbefehl der russischen Armeen, ihre Neugruppierung, ihre Offensive im Süden und ihre Defensive im Norden. Von Anfang September bis 6. Oktober 1915. (110) Oberbefehl, Neugruppierung und Operationsplan der Russen. (110) Der Fortgang der Offensive der Verbündeten in Wolhynien und Galizien und die russische Gegenoffensive. (111) [Karte]: Uebersichtskarte über die Entwicklung der Ostfront von Mitte März bis Ende Oktober 1915. ([115]) Die Defensivschlacht zwischen Riga und Pinsk. (116) Der Stellungskampf und die russischen Vorstöße an der Düna, gegen Baranowitschi, gegen Styr- und Strypafront und gegen Czernowitz. Vom 6. Oktober 1915 bis 1. Februar 1916. (120) [2 Abb.]: (1)Eine von den Russen zerstörte Brauerei in der Festung Kowno. (2)Trichter eines 42 cm-Geschosses im Betonmauerwerk eines Forts der Festung Kowno. ( - ) [2 Abb.]: (1)Eine "Grabenstreiche" in der Kehle des Forts VII der Festung Kowno. (2)Eine betonierte Grabenstreiche in der Kehle des Forts VIII der Festung Kowno. ( - ) Die Offensive der Heeresgruppe des Generalfeldmarschalls v. Hindenburg. Vom 12. August bis 14. September 1915. (123) Chronologische Uebersicht nach den Meldungen d. deutschen Obersten Heeresleitung. Einzelne Meldungen des russischen Großen Generalstabs sind zur Ergänzung beigegeben. (123) [2 Abb.]: (1)Die von den Russen gesprengten Festungswerke von Ossowiec. (2)Die Kehlkaserne im Zentralwerk des Forts I der Festung Ossowiec, mit bombensicheren Fensterläden. ( - ) [2 Abb.]: (1)Die von den Russen vor ihrem Abzug gesprengten Kasematten der Festung Ossowiec. (2)Die von den Russen vor ihrem Abzug niedergebrannten Vorrätshäuser der Festung Ossowiec; im Hintergrund der Lagerplatz einer deutschen Proviantkolonne. ( - ) Der Vormarsch zwischen Dubissa und Düna. (131) Die Räumung von Riga, Dünaburg, Wilna und Minsk. (132) [2 Abb.]: (1)Deutsche Pioniere bauen eine Notbrücke über den Njemen in der Festung Grodno. (2)Gefangene Russen auf dem Abtransport bei Grodno. ( - ) [2 Abb.]: (1)Aus dem erst kurz vor der Eroberung feriggestellten Forts der Höhe 202 der Festung Grodno. (2)Die von den Russen vor ihrem Abzug gesprengte Brücke über den Njemen in der Festung Grodno. ( - ) Die Erstürmung des Brückenkorps von Friedrichstadt. Am 3. September 1915. (133) Die Eroberung von Kowno. Vom 6. bis 17. August 1915. (134) [Karte]: Uebersichtskarte über das Kampfgelände um die Festung Kowno. (135) [2 Abb.]: (1)In einem Außenfort der Festung Grodno erobertes russisches Festungsgeschütz. (2)Das deutsche Artilleriedepot der Festung Grodno läßt unter der Leitung eines seiner Schittmeister durch hessischen Landsturm eine in der äußersten Fortslinie vergrabene 28 cm-Haubitzbatterie japanischer Herkunft bergen. ( - ) [2 Abb.]: (1)Der Inhalt erbeuteter russischer Munitionswagen wird auf seine Brauchbarkeit hin untersucht. (2)Von der zerstörten Eisenbahnbrücke über den Njemen in der Festung Grodno. ( - ) Die Besetzung von Ossowiec. Am 23. August 1915. (141) [Karte]: Uebersichtskarte über das Gelände um die Festung Ossowiec. (143) Der Vormarsch nach der Eroberung von Kowno und die Räumung von Olita. Vom 19. bis 26. August 1915. (143) Die Einnahme von Grodno. Vom 1. bis 4. September 1915. (144) [Karte]: Uebersichtskarte über das Kampfgelände um die Festung Grodno. (145) Die Eroberung von Nowo-Georgiewsk (Modlin) vom 6. bis 20. August 1915. (147) Der Angriff und die Eroberung. (147) [Karte]: Uebersichtskarte über das Kampfgelände um Nowo-Georgiewsk. (Vgl. die Uebersichtskarte in Band IV vor S. 33). (149) [2 Abb.]: (1)Die Pontonbrücke zur Zitadelle der Festung Nowo-Georgiewsk. (2)Die von den Russen gesprengte Eisenbahnbrücke über den Narew in der Festung Nowo-Georgiewsk. ( - ) [2 Abb.]: (1)Ein erbeutetes russisches 28 cm-Geschütz in der Festung Nowo-Georgiewsk. (2)Eine Beutesammelstelle in der Festung Nowo-Georgiewsk. ( - ) Die Beute. (154) Die Zustände in Nowo-Georgiewsk vor dem Fall. (154) [2 Abb.]: (1)Die Wirkung eines der schweren Mörser in den Festungswerken von Nowo-Georgiewsk. (2)Von den Kasematten des Forts II der Festung Nowo-Georgiewsk. Davor zerstörte Hindernisse. ( - ) [2 Abb.]: (1)Deutsche Feldpost beim Sortieren der Postsäcke im Hofe eines von den russischen Bewohnern verlassenen Hauses hinter der Front. (2)Russische Gefangene werden in einem Dorfe hinter der Front zum Abtransport gesammelt. ( - ) Die Offensive der Heeresgruppen Prinz Leopold von Bayern und v. Mackensen. Vom 11. August bis 4. September 1915. (158) Chronologische Uebersicht nach den Meldungen der deutschen Obersten Heeresleitung und des österreichisch-ungarischen Generalstabs. (158) [2 Abb.]: (1)Deutsche Truppen lagern vor einem von den Russen vor ihrem Abmarsch in Brand gesteckten Dorfe. (2)Aus einem von den Russen bei ihrem Rückzug in Brand gesteckten russischen Dorfe. ( - ) [2 Abb.]: (1)Ein russisches Dorf, das von den Russen vor ihrer Flucht in Brand gesteckt wurde. (2)Von den Russen auf ihrem Rückzug zur Auswanderung gezwungene polnische Juden rasten auf der Flucht. ( - ) Die Einschließung, Zerstörung und Einnahme von Brest-Litowsk. Vom 16. bis 26. August 1915. (165) Die Einschließung. (165) [Karte]: Uebersichtskarte über das Kampfgelände um Brest-Litowsk. (167) Die Eroberung und Zerstörung. (168) [2 Abb.]: (1)Die russische Kirche eines Dorfes im Bialowieska-Forst mit einer deutschen Reiterpatrouille. (2)Deutsche Soldaten im Quartier in einer russischen Kirche Russisch-Polens. ( - ) [2 Abb.]: (1)Deutsche Kavallerie überschreitet den Bug bei Ogrodniki auf einer Pontonbrücke. (2)Die Maschinengewehre einer deutschen Abteilung werden auf Pferden an die Front gebracht. ( - ) Im Bialowieska-Forst. Vom 25. August bis 1. September 1915. (173) Auf den Spuren der Bug-Armee I. Polnische Eindrücke aus dem Sommer 1915. - Berichte aus dem deutschen Großen Hauptquartier vom 12. und 13. November 1915. (174) Die Offensive auf dem südöstlichen Kriegsschauplatz. Vom 11. August bis 1. September 1915. (184) Chronologische Uebersicht nach den Meldungen des österreichisch-ungarischen Generalstabs und der deutschen Obersten Heeresleitung. (184) [2 Abb.]: (1)Deutsche Soldaten bei den Aufräumungsarbeiten der von den Russen zerstörten Lesna-Brücke bei Wistycze nördlich von Brest-Litowsk. (2)Deutsche Soldaten bei den Bergungsarbeiten vor der von den Russen in Brand gesteckten Zitadelle in Brest-Litowsk. ( - ) [2 Abb.]: (1)Ein von den Russen völlig niedergebrannter Stadtteil von Brest-Litowsk. - Es stehen nur noch die Oefen und vereinzelte Brandmauern. (2)Deutsche Soldaten beim Löschen eines brennenden Häuserblocks in dem von den Russen vor ihrem Abzug in Brand gesteckten Brest-Litowsk. ( - ) Der Durchbruch bei Gologory und Brzezany an der Zlota-Lipa. Am 27. August 1915. (188) Die Eroberung von Luck. Am 31. August 1915. (190) [2 Abb.]: (1)Die von den Russen gesprengte Bug-Brücke bei Brest-Litowsk. (2)Aus dem durch die Beschießung völlig zerstörten Fort Dubinniki bei Brest-Litowsk. ( - ) [2 Abb.]: (1)Generalleutnant Hofmann. (2)General d. Inf. Freiherr v. Plettenberg, Kommandeur des Gardekorps , links von ihm Major von Kummer, rechts Prinz Eitel Friedrich und Hauptmann von Fritsch. ( - ) Die Einnahme von Brody. Am 1. September 1915. (193) Der Wechsel im russischen Oberkommando. Nach den amtlichen Meldungen und ergänzenden Mitteilungen. (193) Der Fortgang der Offensive südlich der Sumpfzone und die russische Gegenoffensive. Vom 2. September bis 4. Oktober 1915. (195) Chronologische Uebersicht nach den Meldungen des österreichisch-ungarischen Generalstabs und der deutschen Obersten Heeresleitung. (195) [2 Abb.]: (1)Deutsche Soldaten und gefangene Russen vor einer Kirche in Ostgalizien. (2)Oesterreichisch-ungarische Soldaten an einem Dorfbrunnen in Ostgalizien. ( - ) [2 Abb.]: (1)Arbeitskolonnen der deutschen Südarmee auf der Rast. (2)Vor der deutschen Feldpost in Kolomea. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Ulanen durchqueren einen Fluß in Ostgalizien. (2)Aus einem russischen Zeltlager am Dnjestr. ( - ) [2 Abb.]: (1)Aus einem vordersten österreichisch-ungarischen Schützengraben in Wolhynien. (2)Ein österreichisch-ungarisches Bataillonskommando vor seinen Unterständen in Wolhynien. ( - ) Der Vormarsch auf Dubno und seine Besetzung. Vom 2. bis 8. September 1915. (206) Die Panik in Wolhynien. (208) Von den Kämpfen zwischen Strypa uns Sereth. Vom 4. bis 18. September 1915. (209) Episoden. (211) Im Dorf. (211) Das Lösegeld. Die Heimkehr. (212) Die Defensiv-Schlacht zwischen Riga und Pinsk. Vom 5. September bis 4. Oktober 1915. (212) Chronologische Uebersicht nach den Meldungen der deutschen Obersten Heeresleitung und des österreichisch-ungarischen Generalstabs. (212) [2 Abb.]: (1)Offiziere eines vorgeschobenen deutschen Kommandos am Styr studieren die Karte. (2)Die Wirkung einer österreichisch-ungarischen Granate. ( - ) [2 Abb.]: (1)Von österreichisch-ungarischen Truppen in Ostgalizien gefangen genommene Russen werden abtransportiert. (2)Ein von den Russen bei ihrem Rückzug völlig zerstörtes Dorf in Ostgalizien. ( - ) [2 Abb.]: (1)Gefallene Russen werden unter Aufsicht deutscher Feldgendarmen von Ortsbewohnern in Ostgalizien beerdigt. (2)Eine österreichisch-ungarische Proviantkolonne beim Überschreiten eines Flusses in Ostgalizien. ( - ) [2 Abb.]: (1)Oesterreichisch-ungarische Sanitätssoldaten beim Filtrieren von Trinkwasser. (2)Von einem österreichisch-ungarischen Verbandplatz hinter der Front. ( - ) Zwischen Jakobstadt und Friedrichstadt. (222) Die Kämpfe an der Dünafront im Monat September 1915. (223) [2 Abb.]: (1)Mit Roggen-Mieten verkleidete russische Drahtverhaue. (2)Maschinengewehr in einem deutschen Schützengraben. ( - ) [2 Abb.]: (1)Deutsche Infanterie im Vorgehen. (2)Deutsche Kolonnen durchziehen eine Straßenenge vor Wilna. ( - ) Die deutsche Heereskavallerie östlich Wilna. Im September 1915. (225) Die Einnahme von Smorgon. Am 18. September 1915. (230) In Wilna nach dem Einzug der Deutschen. Am 18. September 1915. (232) [2 Abb.]: (1)Gefangene Russen auf dem Marsch hinter die Front. (2)Eine von den Deutschen gestürmte russische Feldstellung vor Wilna, unmittelbar nach dem Sturm. ( - ) [2 Abb.]: (1)Der Stab der 1. Kavalleriedivision, die erfolgreich östlich Wilna operierte. Von links nach rechts: Vorne sitzend: Leutnant v. der Ley, Leutnant Fuchs, Leutnant Freiherr v. Lyncker, Oberleutnant Arndts. In der Mitte stehend: Katholischer Divisions-Pfarrer Wilke, Rittmeister von Falkenhayn, Rittmeister vonHauenschild, Hauptmann Freiherr von Gienanth, Generalleutnant Brecht, Major v. Diebitsch, Intendantur-Assessor Möller, Rittmeister Winter, Rittmeister Kloß, Oberleutnant Thies. Im Hintergrund stehend: Leutnant Ollmann, Oberleutnant Rexin, Oberstabsarzt Dr. Guß. (2)Die Stadt Wilna aus der Vogelschau. ( - ) Auf den Spuren der Bugarmee. II. Die Landzunge von Pinsk. - Bericht aus dem deutschen Großen Hauptquartier vom 20. November 1915 (vgl. S. 174 f.) (233) Episoden. Ein Besuch in der "Sanierungsanstalt". (236) Russische Geschichten. (237) Ein Reiterstück. Aus einem Feldpostbrief der "Kölnischen Volkszeitung". (238) Aus dem russischen Wilna. (238) Der Stellungskampf nördlich der Sumpfzone. Vom 5. Oktober 1915 bis 2. Februar 1916. (239) Chronologische Uebersicht nach den Meldungen der deutschen Obersten Heeresleitung und des österreichisch-ungarischen Generalstabs. (239) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte I. - Vom Rigaischen Busen bis zur Bahnlinie Tuckum - Riga. - Vgl. die Anschlußkarte S. 243. (241) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte II. - Um den Tirul-Sumpf; von der Aa bis zur Misse. - Vgl. die Anschlußkarten S. 241 und 247. (243) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte III, - Um Riga; von der Misse bis zur Düna. - Vgl. die Anschlußkarten S. 243 und 249. (247) [2 Abb.]: (1)Die von den Russen vor ihrem Rückzug zerstörte Holzbrücke über den Szczara-Fluß bei dem Dorfe Szczara, das im Hintergrund brennt. Neben der zerstörten Brücke ein Notsteg. (2)Ein Kampffeld an der Szczara mit dem Gefechtsstand eines deutschen Kommandeurs. ( - ) [2 Abb.]: (1)Bei den deutschen Truppen im Gebiet der Nebenflüsse des oberen Njemen im "schwarzen Rußland". "Hurra! Die Etappe hat frische Wäsche gebracht!" (2)Eine deutsche rückwärtige Stellung im "schwarzen Rußland", die zum Teil in Anlehnung an vorhandene Häuser von Armierungsarbeiten unter Leitung von Pionieren ausgebaut wurde. ( - ) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte IV. - Der Düna entlang bis Friedrichstadt. - Vgl. die Anschlußkarten S. 247 und 251. ([249]) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte V. - Der Düna entlang bis Jakobstadt. - Vgl. die Anschlußkarten S. 249 und 255. ([251]) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte VI. - Der Düna entlang zwischen Jakobstadt und Illuxt. - Vgl. die Anschlußkarten S. 251 und 259. (255) [2 Abb.]: (1)Beschwerliche Fahrt einer k.u.k. Goulaschkanone im Sumpfgebiet der Poljesje. (2)Blick auf ein hügeliges Schlachtfeld bei Pinsk nach der Vertreibung der Russen durch die Verbündeten. ( - ) [2 Abb.]: (1)Deutsche Soldaten mit ihren Maschinengewehren quartieren sich für die Nacht in einem verlassenen Hause ein. (2)Rast deutscher Truppen auf der Verfolgung der Russen durch das Sumpfgebiet der Poljesje. ( - ) Vor Riga. Mitte Oktober und Anfang November 1915. (257) Vor Dünaburg. (258) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte VII. - Vor Dünaburg; von Illuxt bis über die Bahnlinie Wilna - Dünaburg. - Vgl. die Anschlußkarten S. 255 und S. 261. (259) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte VIII. - Der Widsy; vom Dryswjaty-See bis über die Disna.- Vgl. die Anschlußkarten S. 259 und S. 263. (261) Russische Stimmen über die deutschen Wintervorbereitungen. (262) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte IX. - Ueber die Bahnlinie Swenzjany - Glubokoje bis zum Narocz-See. - Vgl. die Anschlußkarten S. 261 und S. 265. (263) Im Poljesjegebiet. (264) [2 Abb.]: (1)Von der deutschen Küstenverteidigung Kurlands an der Ostsee. (2)Von den Russen auf ihrem eiligen Rückzug in einem Walde Kurlands zurückgelassene Wagen und Pferde. ( - ) [2 Abb.]: (1)Partie aus dem Sumpfgebiet der Poljesje in Wolhynien. (2)Drahthindernisse vor einer Stellung der Verbündeten im Sumpfgebiet der Poljesje in Wolhynien. ( - ) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte X. - Vom Narocz-See bis zur Wilia. - Vgl. S. 263 und S. 267. (265) Episoden. (266) Der Bergarbeiter aus Oberschlesien. (266) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XI. - Von der Wilia um Smorgon bis zur Berezyna. - Vgl. die Anschlußkarten S. 265 und S. 269. (267) Nachts im Unterstand. (268) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XII. - Von Wischnew der Olschanka und Beresina entlang. - Vgl. die Anschlußkarten S. 267 und S. 271. (269) Der Stellungskampf südlich der Sumpfzone und die russischen Offensiven. Vom 5. Oktober 1915 bis 1. Februar 1916. (270) Chronologische Uebersicht nach den Meldungen des österreichisch-ungarischen Generalstabs und der deutschen Obersten Heeresleitung. (270) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XIII. - Von der Beresina bis zum Serwetsch. - Vgl. S. 269 und S. 273. (271) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XIV. - Vor Baranowitschi; der Schtschara entlang. - Vgl. die Anschlußkarten S. 271 und S. 275. (273) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XV. - Der Schtschara entlang. - Vgl. die Anschlußkarten S. 273 und S. 277. (275) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XVI. - Von der Schtschara am Oginski-Kanal entlang. - Vgl. die Anschlußkarten S. 275 und S. 279. (277) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XVII. - Vor Pinsk; vom Oginski-Kanal bis zum Strumen. - Vgl. die Anschlußkarten S. 277 und S. 281. (279) [2 Abb.]: (1)Eine österreichisch-ungarische Telegraphen-Fernsignal-Station an der Nordostfront. (2)Russische Stellungen am Steilufer des Pruth nach ihrer Erstürmung. ( - ) [2 Abb.]: (1)Eine österreichisch-ungarische Kavallerie-Patrouille zieht in ein Dorf Ostgaliziens ein. (2)Ein österreichisch-ungarisches 30,5 cm-Geschütz wird geladen. ( - ) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XVIII. - Südlich Pinsk. - Vgl. die Anschlußkarten S. 279 und S. 283. ([281]) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XIX. - Von der Wiesielucha zum Styr. (283) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XX. - Am Styr und am Kormin. (285) [2 Karten]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Maßstab und Legende vgl. S. 285. - Vgl. die Anschlußkarten S. 285 und S. 291. (1)Uebersichtskarte XXI. - Vom Kormin bis zur Putilowka. (2)Uebersichtskarte XXII. - Von der Putilowka bis zur Ikwa. ([287]) [2 Abb.]: (1)Kaiser Wilhelm verabschiedet sich nach dem Besuch einer ungarischen Honved-Division an der Strypa von General Emanuel Werz. (2)Kaiser Wilhelm schreitet beim Besuch der Truppen der Verbündeten an der Strypa mit General Graf v. Bothmer die Front österreichisch-ungarischer Truppen ab. ( - ) [2 Abb.]: (1)Großherzog Friedrich II. von Baden beim Besuch der Festung Grodno. Rechts neben ihm General v. Scholz, der Führer der VIII. Armee, links General v. Held, der deutsche Gouverneur von Grodno. (2)Erzherzog Thronfolger Karl Franz Josef bei einem Besuch der besetzten Teile Polens in Lublin. ( - ) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXIII. - Von Dubno bis Krzemieniec. - Maßstab vgl. S. 287 u. 295. (291) Die Schlacht bei Szartorysk. Vom 16. Oktober bis 14. November 1915. (294) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXIV. - Von der Ikwa bis zum Sereth. - Vgl. S. 291 und 297. (295) [2 Abb.]: (1)General d. Inf. v. Bothmer mit seinem zweiten Generalstabschef Oberstleutnant Hemmer. (2)General d. Inf. v. Beseler, der Eroberer von Nowo-Georgiewsk, mit seinen Offizieren. ( - ) [2 Abb.]: (1)Der Armeekommandant Feldzeugmeister Paul Puhallo v. Brlog mit seinem Stabe. (2)Der Armeekommandant Freiherr v. Pflanzer-Baltin nimmt die Meldung eines von einem Aufklärungsfluge zurückgekehrten Fliegeroffiziers entgegen. ( - ) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXV. - Vom Sereth der Strypa entlang. - Vgl. S. 295 u. 299. (297) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXVI. - Vor Buczacz der Strypa entlang. - Vgl. S. 297 u. 301. (299) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXVII. - Dem Dnjestr entlang, von der Strypa-Mündung bis zur Sereth-Mündung. Maßstab und Legende vgl. S. 299. - Vgl. die Anschlußkarten S. 299 und 305. ([301]) Die Kämpfe um Siemikowce. Vom 31. Oktober bis 5. November 1915. (302) Die Durchbruchsschlacht an der bessarabischen Grenze. Vom 24. Dezember 1915 bis 20. Januar 1916. (303) Die Absichten und Vorbereitungen der russischen Offensive. (303) Die "Weihnachtsschlacht". (304) [Karte]: Der ungefähre Verlauf der Front der Verbündeten im Osten um die Jahreswende 1915/1916. Uebersichtskarte XXVIII. - Vom Dnjestr bis zur rumänischen Grenze. - Vgl. S. 301. ([305]) Die "Neujahrsschlacht". (306) Die "Wasserweiheschlacht". (307) Auf den übrigen Teilen der Front südlich der Sumpfzone. (309) General Iwanows neue Angriffstaktik. (310) In Czernowitz während des russischen Durchbruchsversuchs. (311) Episoden. (311) Ein Kampf der Seelenkraft. (311) Aus der Durchbruchsschlacht an der bessarabischen Grenze. (312) Von den russischen Verlusten. (313) Vergeltung russischer Völkerrechtsverletzungen. (313) Von den Fürsten und Heerführern der Verbündeten. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (314) Kundgebungen und Auszeichnungen. (314) Besuche an der Front, in den eroberten Festungen und in den besetzten Gebieten. (316) [2 Abb.]: (1)Der russische Generalissimus Großfürst Nikolai Nikolajewitsch mit seinem Stabe und den englischen, französischen und japanischen Militärattachés vor dem Hauptquartier in Baranowitschi Anfang September 1915. (2)Zar Nikolaus schreitet mit dem Thronfolger Großfürst Alexei Nikolajewitsch die Front eines Kosaken-Regiments ab. ( - ) [2 Abb.]: (1)Generalfeldmarschall Prinz Leopold von Bayern mit dem Stabe der Division v. Menges. (2)General d. Inf. Fabeck (†) mit seinem Stabe. ( - ) Die Feier des 86. Geburtstages des Kaisers Wilhelm. Die Feier des 58. Geburtstages des Kaisers Wilhelm. (318) Vom Zaren und den russischen Heerführern. Nach amtlichen Meldungen und ergänzenden Mitteilungen. (318) Vom Zaren. Besuche an der Ostfront. (318) Auszeichnungen. Von den russischen Heerführern. (320) Aus den besetzten Gebieten. (321) Von der deutschen Verwaltung in Kurland. Von der deutschen Verwaltung in Litauen und Suwalki. (321) Von der Verwaltung der Verbündeten in Polen. Von Juni 1915 bis Februar 1916 (Fortsetzung von Bd. VI, S. 244 bis 248). (322) Die Abgrenzung der Verwaltungsbezirke und allgemeine Notstandsmaßnahmen. (322) Von der deutschen Verwaltung. (322) Von der österreichisch-ungarischen Verwaltung. (324) Vom Wiederaufbau Galiziens. (324) [2 Abb.]: (1)Generalmajor Erich Freiherr v. Diller, österreichisch-ungarischer Generalgouverneur in Russisch-Polen. (2)Der Armeekommandant Feldmarschall Erzherzog Friedrich und Freiherr Konrad v. Hötzendorf bei der Feier des Geburtstages des Kaisers Franz Josef am 18. August 1915 im Standort des Hauptquartiers. ( - ) [2 Abb.]: (1)Die Generalität und Geistlichkeit Warschaus erwartet den Generalgouverneur v. Beseler zur Eröffnungsfeier der Universität Warschau. (2)Die Verteilung von Lebensmitteln an die Zivilbevölkerung auf dem Marktplatz von Lodz durch die deutsche Verwaltung. ( - ) Einband ( - ) Einband ( - )

FEBRUARY, 1907 YOL. XIY. HO. 8 GETTYSBURG COLLEGE GETTYSBURG, PA. v*itm****%im**#wxn*mfriim***+*. PRESS Of W. fl. BAMMOND. '1 ■] >/,.-.• H ,( it-* PHra .»»»n . .■» ki .•»•»■»• cI /^/^ I \C"N The National Organization ot ^^.U^±-J^r^^r^J^JJ~-Jt^>^ Brain Brokers. Commonwealth Trust Bldg., Phila., Pa. Offices in Twelve Other Cities. Come and Have a Good Shave.,. or HAIR-CUT at Harry B. Seta's BARBER SHOP 35 Baltimore St. BARBERS' SUPPLIES A SPECIALTY. Also, choice line of fine Cigars. R. A. WONDERS Comer Cigar ParlorSv A full line of Cigars, Tobacco, Pipes, etc. Scott's Corner, opp. Eagle Hotel] GETTYSBURG, PA. Pool Parlors in Connection. IP YOU CALL ON C. A. Bloeher, deuueleiv Centre Square, He can serve you in anything you may want in REPAIRING or JEWELRY. - M'v.i.7'1.?' ?'•;■ ;-v/-i '{■■'■! ' ;?4 " > " . WE RECOMMEND THESE FIRMS. Established 1867 by Allen Walton Allen K. Walton, Pres. and Treas. Root. J. Walton, Superintendent. Hummelstown Brown Stone Gompanji, and Manufacturers of BUILDING STONE, SAWED FLAGGING, and TILE, ■' [■.■!■■■ ■!■■ ■ ^i*--11:—: l;- '"I 1 i ft ni'»■ dKMi^aai^MHIIUiHmBWHaBK^BB THE MERCURY. 213 There is a natural and proper desire which we all share to more or less extent—that is, the desire for the esteem of others. A lack of this feeling is indicative of a defective character and results in carelessness and boorishness. Yet that this senti-ment is often magnified into over sensitiveness to others opin-ions is evident in many departments of college work. In the class room it is responsible for much of the hesitancy to an-swer general questions, and how many fear to ask questions lest they are ridiculed tor stupidity or criticized for trying to impress the teacher, or as college vernacular has it, " work the Profs." Thus one of the most effective ways of keeping up a live interest in a recitation is lost. The suppression of the im-pulse to ask and answer questions leads to inattention and study-ing for words at the expense of thought. " Every problem solved is the origin of the other problems to be solved. When men have no questions to ask, not only have their lips become para-lyzed but the brain has become atrophied." Another and very similar phase is the reluctance to seek, privately, the help, advice, or friendship of a professor, lest it be interpreted by college mates as courting favors. Thus the opportunity for enjoying helpful personal relations with a teacher goes by unimproved. This same feeling may sometimes prompt a generosity, which is simply the outcome of the fear of being considered mean and stingy, and which seriously handicaps the one with a meagre allowance. Modesty, that rare virtue, may dwindle into lack of inde-pendence until originality is crushed and personality weakened. There are many times in a student's college days when there is need to stand firm for his opinions and rights, and not yield weakly to college bossism nor allow his enthusiasm to be dampened by depreciating remarks of others. It seems to me that this lack of independence is the fault of much of the present neglect of opportunity for development offered by the literary societies. The Freshman starts enthusiastically to work ; carefully and willingly he prepares his first debates and essays, but bye and bye, he allows his own convictions to be influenced by the lethargy and carelessness of others, who look ■ 214 THE MERCURY. on in good natured amusement at his enthusiasm. He takes for a model upper classmen who pronounce literary a farce— their loyalty consisting in attendance when others put forth some special effort for their entertainment. On the other hand independence may be developed into arrogance and egotism, which is as fatal to the acquisition of friends or of knowledge. When one imagines his own opin-ions infallible, the ministrations of text-book and teacher tall upon stony ground. Ambition is essential to the attainment of the college ideal. Yet when one centers his determination on high marks and honors, looking upon stooped shoulders, ruined eyesight and pale cheeks as marks of heroic self-mastery—as honorable scars, when he cuts himself off from many of the rarest pleas-ures of college life, when he, self centered, refuses to take part or support with his enthusiasm, the general college organiza-tion, there is evidently a sad loss of perspective. If the ambi-tion is directed along athletic or other lines, the distortion of view is evinced in the determination to be the star, demanding everyone to play into his hands, disregarding the rights of others and the best interests of the college. Society offering opportunity for culture and polish, a most effective background for college life, is very often brought into too great prominence, crowding out true sociality, tending to-ward snobbishness, in the adherence to false standards in the choice of friends—standards which too often have little refer-ence to intellectuality or true moral worth ; interfering with working hours, either in actually subtracting from the regular periods for study and recitation or physically disabling for the best work. Lessons are hurriedly prepared ; gradually forced by accumulating work, dishonest means for preparation are resorted to, thus defeating the very end of class work. Per-haps the most subtle danger of the society enthusiast is the idea which creeps in, that the " smart set " and the "fast set" are synonomous, and a feeling of gratification to be classed among them. Money, time, health and character are recklessly squandered. Under such conditions a college course can scarce but prove a failure. . ," . . biht J THE MERCURY. 215 Quite apart from all this is the confusion and indistinctness of view which is the natural result of the sudden transition from the dim light of acceptance of fact, without questioning the full searchlight of philosophy, ethical metaphysics and science. The great foundation principle—the freedom of the will and existence of God must be tested and answered by each individual himself. Faith is changed to honest doubt. All is confusion. To stop here means skepticism, the most dangerous mental bias. The reaction must be balanced by deeper study and thought, and the softening influence of intel-lectual men. In a brief way I have tried to suggest some of the mistakes ±0 which we as students are subject—to one this and to another that. None of us are impervious. Should then, conscience, a friend, or professor, lay a detaining hand upon our shoulder with the intreaty, " O, student, come away from your work, or from your play, and consider awhile," do not shake him off in angef or impatience, and continue in the old way, lest when college days are over we look back with that wish so often heard—" O, that I could begin over, how differently I would do!" For it is possible to produca a masterpiece. Neither is talent, nor the most expensive art materials the chief requisite, but the power to see things as they really are. The words of Dr. Flurringare as a clarion calling us to our best efforts—"To the true man of alert intelligence, pure heart, and strong will, the college represents a new birth and a new life. College is simply another name for opportunity. Opportunity, widest, deepest, highest, richest." ■■•■^■■IB 2\6 THE MERCURY. BOY PRISONERS IN PHILADELPHIA. A PAPER READ AT SEMINARY BY F., '04. *HK name of Judge Lindsey, of Denver, is on the lips of people all over our country today. The current maga-zines are filled with praises for him and with accounts of his work. This " Boys' Judge " and " Friend of the Boys," this reformer and statesman, has endeared himself to many hearts. His efforts in his public career have been largely along lines hitherto unventured and untried, and his convictions have not lacked courage. One field in which he has specialised and in which he has become an expert authority is that of the prob-lems of boys in the city. Judge Lindsey is perfectly familiar with boy life; he understands the " gang " and its habits; he sympathizes with the boys in their temptations and struggles , and, as their judge in the Juvenile Courts, he has proved him-self a true friend, as well as a revolutionizer in the methods of treatment of young prisoners. If you have been following up the work of Judge Lindsey, what I shall try to tell you in this paper may be somewhat repetitious. But, entirely independent of this " Prince of Reformers " and regardless of the work be-ing done in any other city, I shall venture to describe the life of the boy prisoners in Philadelphia, as I cull it from personal experience. Have you ever noticed the large, brown-stone building, ap-parently an old-fashioned residence, at the corner of 15th and Arch Streets? Only a few doors away from our Lutheran Pub-lication House and a block from the Broad Street Station, stands this grim House of Detention. The passer-by frequently may notice heads at the first-floor windows—close-clipped heads and mischievous-looking faces, and his first thought likely is : " This must be a house for idiots " (at least that was my own first thought). One goes up the stone steps, rings the door-bell, and quickly an officer appears inside and unlocks the door. General interior impressions set one's imagination in motion, and he almost involuntarily feels that once this broad hallway and wide staircase, as well as the spacious adjoining T MamMfKUmim-iB au^nja^i ,»»—.—■ »■ - THE MERCURY. 217 rooms must have been the scene of wealth and splendor and perhaps even of gayety. But present changed conditions so impress themselves upon the visitor's senses that he at once comes to a realization of the plainness and the soberness of the situation as it is today. On one side of the hall is the office and court-room, and in the rear of this a large dining-room. Across the hallway, the full depth of the building, extends a large " living-room." Up stairs are the bed-rooms, and the like. Just back of the house is a paved court, or yard, of con-siderable size. This, in brief, is the Philadelphia House of De-tention for boys arrested in the city. The management of the institution now seems to be partly, if not largely, in the hands of the municipal Department of Public Safety and partly in the control of a philanthropic or-ganization ot women, who have at heart the welfare of the youth of the city. Outside is the system of probation officers to look after the boys dismissed on probation. Within the House are the necessary officers, in uniform, and clerks, besides the matron and her lady assistants. These officers are men of ex-perience and of sympathy, as well as of some discipline. One of them, I recall, had held a position of responsibility in a Re-formatory for young men for years. A more motherly, kinder-hearted, yet strict, woman than the matron, one could not wish to see. Her whole soul is absorbed in the elevation and im-provement of the boys under her care. Doubtless she is the first real " mother" many of the boys ever have known. Every morning, also, the magistrate and his officers, hold a session of Juvenile Court right there in the office of the House of Detention. The house physician makes his visits, as do the representatives of the Health Department, and various Chris-tian workers bent on the educational, the moral, and the spirit-ual, improvement of the incarcerated youth. With this glimpse at its management, let us pass on to a con-sideration of the purpose and plan of the House, or of its workings. Formerly, boy culprits were ordinarily classed as criminals, and were shut up with the mass of older prisoners in the common jail. Obviously and naturally such a method ■■■^■■■■■■i 220 THE MERCURY. thoughts. It crbps out in various ways. All are more or less rude and rough, though they treat a visitor respectfully and civilly. They seem glad when anyone comes to talk to them, or to read. Whether it is a result of curiosity, or an evidence of an inborn inclination to petty theft, the boys occasionally would look at, and touch with their fingers, any pin I happened to be wearing, or my watch. As a rule, they were attentive and seemed eager to learn. With some of the little fellows, I was really greatly pleased. All seemed to long for freedom, though a few evidently looked upon the Reformatory as a matter of fact and a punishment to be expected. Some asked me to take messages to, or to get things for them from, their homes. This, of course, it was necessary to refuse to do. The average visitor, I guess, is greatly surprised at the long list of crimes and charges for which mere boys are arrested and tried. Some of the offences along the line of immorality are almost as incredible as they are shocking. Truely we have little idea " how the otlier half lives." The matron keeps a diary of the hearings, and it was interesting to glance over it, as well as over the official records. Here are some of the charges: Street running; running away from home; incorrigi-bility; petty theft; stealing of junk and iron from railroads and foundries; stealing clothing; fighting, in which one boy may have cut another with a knife ; immorality; indecency; criminal assault, and rape ! To me, the most shocking cases were ones like these, and, although I hardly see how it could be a physical possibility, the charges nevertheless stood against the boys: A boy of seven years accused ot rape upon a little girl three years old; a crowd of boys had enticed the child to a vacant lot, and then had their horrible, devilish sport with her. Boys ot twelve and fifteen years had immoral relations with girls of eight and ten years of age. It is awful enough to think of, and far worse to occur. Just one case, of little Eddie Stewart, may serve as an in-teresting illustration. This boy, a bright faced, honest looking lad, ten years old,.was arrested because he had taken bed-clothing from his home and sold it, and was then found, out on i-lt-M'B in,*miti*. THE MERCURY. 221 the streets. From the testimony and investigations, it proved that he came from a rather poor family. The boy had lost his mother two years after his birth. At the time of the mother's death, a daughter, aged seven years, became the only " mother " in the home. The father was a drunkard, and seemed to care but little whether his boy was clothed and fed, or not. Imagine that boy's bringing-up, with a sister only five years older than himself to look after him ! Are you surprised that the boy ran .away from home, because no one wanted him? Since he was without a mother really, do you wonder that his moral sense •was little developed, and that his freedom gave a bad bent to his growing character? It is scarcely surprising that the boy even stole, and lived the life of the street. And yet that boy had many admirable traits about him. He changed wonder-fully under the care of the matron, and would do anything for her. He seemed to need, and to want, a mother. Eddie Stewart had the making of a man in him. The matron soon recognized this, and was making every effort to secure him a home with a good family in the country. He needed to be removed from his old associations, away from the city, where he could start afresh, forget his past days, and develop a manly ■character. The matron had been trying to get the boy a home, -and had spoken to him about it. He longed to get out from his imprisonment. When we saw him, he at once thought we were the friends who should take him to the country : ". Am I going now ?" and it was truly hard and sad to have to tell him that we could not take him. The child was sorely disappointed, but he still had before him the bright vision of a home in the country. One leaves that institution, the House of Detention, with a feeling of sadness and pity, a sense of concern for those " men in the making," and a keen sense ct his responsibility to hu-manity. It is such a noble work for a class of people who arouse one's sympathy more than one's censure. If, out in our ministry any of us should get to a city in which such reform work is conducted, would it not be good, if we were to take an interest in the boy prisoners ? Think of the possibilities for good anmi ImmMMMtitu 222 THE MERCURY. which lie in those young lives. Think of the hard time which they have had in life. Think of the true, worthy men to be developed from this class of boys. Think of the eternity of bliss to which you may save them, if you will but come into touch with them, and try to put Jesus Christ into their hearts I Isn't it worth while? THE LAMENT OF DANAE. (From the Greek of Simonides of Ceos). QPHNOI CHARLES WILLIAM HEATHCOTE, '05. When Perseus and Danae in the well carved chest layr And the seething tempest blew it over the bay, And as thus over her tear stained cheeks came fear, She threw her loving arm around Perseus dear. " Oh my dear child," said she, " Indeed such is our woe,. As thou sleepest here safe from every foe, For thou slumberest undisturbed in thy heart, While thou art borne along in the brazen bark, Oh my child around thee hovers the murky night, For indeed the dark shades keep the stars from sight. And the rough billows around us thou heedest not, For thou sleepest soundly as on a dewny cot." " If this fear were real to thee, Thou wouldst listen to me, But thus," I say, " Sleep on child, E'en though the deep sea is wild. May help, father Zeus from thee, Come to my dear child and me, If I pray too bold a prayer, Be merciful to my child, my dear." THE MERCURY. 223 CAPE COD CALLS. Provincetown by the Sea. RBV. GEORGE C. HENRY, '76. I HAVE always regarded it as a particularly "happy gale" which " blew us from " Boston across the wide bay to this old, quaint town on the sands of Cape Cod ; for every knot of the'way from "The Hub" to here was pleasant. Down from the dock out into one of the finest harbors in the world we went a steaming on .that summer morning. The very air was filled with historic associations, and object after object added to the effect. How else indeed, when such names as " Warren," « Independence," " Revere," " Hull," " Winthrop," distinguish the islands? Over the Harbor Bar, out into the waters of Mas-sachusetts Bay, the sea shimmering in the golden sunshine, by Minot's Ledge Lighthouse three miles from the nearest shore, where two of Uncle Sam's servants faithfully " keep the lower lights a-burning," " tho' storms be many and waters deep," and waves dash tumultuously over the very top. And now the open sea is to our left while to our right about seven miles away runs the Massachusetts coast-line. The historian's blood flows a bit here ; for yonder is Plymouth and its " Rock." Farther down we are looking toward Marshfield which at once suggests the colossal Commoner, Daniel Webster ; for there on his farm his body has been sleeping since that October day in 1852 and the waves have been chanting his requiem. Provincetown, that's the name; and everybody that gets to Boston should go over there to the tip end of. Cape Cod ; for we should love all our history ; and one fact to know even be-fore you get there is that it was here that the pilgrims first landed Nov. 11, 1620 o. s. Owing to the much sand, they found it not to their liking as an abiding place, and, accordingly they " got cleare of a sandie poynt" and " by God's mercy struck into the Harbour (Plymouth) which was greater than Cape Cod, compast with goodly land, and in the Bay two fine islands uninhabited, with okes, pines, etc., a most hopeful place, ■P iiufei ■' ' 224 THE MEKCUKY. innumerable store of fowl, etc., etc.," so runs the old record, "Mount's Relation." Up along the main street, Commercial, is the Town Hall, an indispensible accompaniment of a New England village, and b:fore it is a massive upright piece of granite with a copy of the original covenant first formed in the Mayflower's cabin, in bronze letters. On the very day they set foot on these shores, an act fraught with century-long consequences, this covenant was drawn up by these stern men who had not come three thousand miles to these shores to play housekeeping. It be-gins, as did everything with them, " In the name of God, Amen," and then " by these presents" they "solemnly and mutually in the presence of God and of one another covenant and combine " themselves •' together into a civil body politike for etc., etc." It is to this that their forty-seven men, high-souled and cour-ageous did set their hands. The list begins with John Carver; and seventh on the list after John Carver and following Miles Standish and John Alden, is Samuel Fuller, ancester of my old venerable, and lately deceased friend " Uncle" Thomas Fuller, in whose humble but inviting abode out along the South Mountain the printed line of lineal descent from this mighty progenitor was carefully framed and proudly shown by "Aunt Nancy " to every visitor. An old town, indeed. Its compact town-seal has engraved on the encircled scroll: "Compact Nov. 11, 1620. Birthplace of American Liberty." Immediately be-low comes " Precinct of Cape Cod, 1714." Beneath that: "In-corporated 1727." A busy port was this town in its day. The long wharves and bobbing docks jutting out into the harbor could tell many a tale of whalers and codders who in days long past sailed away to northern seas to be gone, perchance, for years, or, it may be, to the Grand Banks of Newfoundland codding out of sight of land from May until November, "For men must work and women must weep, And there's little to earn and manj to keep." Sometimes, however, these merchantmen of the sea made fine hauls. " Cap'n" Lewis told us of a friend of his in "ante-bellum" days, who after an eighteen months absence one voy-age, brought home 1,300 barrels of whale oil each barrel con- »■»•' HHHMv i ^,*^ EXCHANGES. Shakespeare seems to be the favorite theme of the essayists this month. Judging from the number and the quality of the articles on him and his works, great interest is taken in Shakes-pearean study in our colleges. We will first let The Philoma-thean Monthly decide the question, " was Shakespeare a greater poet than Milton ? " The writer at the outset confesses her be. lief in the superiority of the former and at once sets about in a 242 THE MERCURY. I series of contrasts to vindicate her belief. Shakespeare knew human nature better than Milton did; he sympathized in the joys and sorrows of others while Milton found refuge within himself; Milton's thoughts ran in a single deep channel, Shakes-peare's in many; the latter is practical and interesting, the former idealistic and complicated. Milton gives us man as he would have made him, Shakespeare portrays him as he is. The conclusion is strongly in favor of Shakespeare, more so than some critics would allow, " In passion he is far superior; in perception he is more quick and intelligent; in sympathy he is infinitely greater; in intellect he is more intuitive and clear; in ideality he is undoubtedly more serene and vivid, and in the universal mind he is more united, harmonious and complete." Having thus so decisively established Shakespeare's place' as a poet, we will now have him set before us as a " Tragic Artist." The Petkiomenite does this in the December and Jan-uary numbers. We learn that in the short space of seven years he gave to the world such masterpieces as have never been equaled. Our judgment of him as a tragic artist must be based upon the six plays, " Timon of Athens," " Romeo and Juliet," "Othello," "King Lear," Hamlet," and "Macbeth." This last named is typical and illustrates his superior skill in all tragic lines. His genius is beyond comparison. " His uni-versality, his breadth of sympathy, and his humor, run so smoothly and so gracefully, that the reader gives scarcely a thought to the form. His pictures are the height of attractive-ness, he charms the eye, and stimulates the imagination. It is an education in itself to study him." Shakespeare is also a humorist. The Fotum of November and December contains an excellent article on the humor in Shakespeare. Here we find " humor in all its varied forms. * * There never was a man * * who has conceivd the ludicrous with such a genuine taste and represented it with so true an art. * * * In his conception of humor he stands alone, there is no second." The Touchstone also speaks of humor in Shakespeare. In our quotations above it is painfully noticeable that each writer «' THE MERCURY. 243 resorts to a series of superlative terms to set forth the great-ness of their subject. This resort to superlative terms may very often be taken as a sign of weakness in the writer's analy-sis. It is a fact of observation that in critical and analytical essays the conclusions are superlative in direct proportion to the weakness and superficiality of the writers study of the subject. But here in Touchstone is a purely analytical study of Shakespeare's humor without any weakening superlative laud-ation. The reason for the humor is set forth. " It (the comic scene) goes back tor its source to the early English mystery and morality plays. In these there is a frequent juxtaposition of the serious and the comic. * * The comic element was added as a means of holding the attention of the audience. * * * The English drama is the product of the English people, not something fashioned according to set laws. To the English no great gulf separates the serious and the comic, and much of the splendor of their literature lies in the wise inter-mixture of high seriousness, as Matthew Arnold calls it, and humor." And now we have some characters analyzed. The Sorosis comes forth with two articles, " Portia" and " Lady Mac-beth." In Portia we find " one of the loveliest of women portraits to be found anywhere in literature. Fine in char-acter as in face, noble in heart as in name, ' The poor rude world hath not her fellow.' Thoughtful yet full of laughter, dignified yet gay and gracious, quick of intellect and swift in judgment yet never severe and merciless, a kind and indulgent mistress, a true friend, a loving wife—could one want more to make * * his ideal of a perfect woman?" " Lady Mac beth," is she ' fiend' or woman ? To many critics she is the former, but she is a woman—a woman possessing a wonder-fully developed will power which enabled her successfully to accomplish anything she ardently willed to do. Her sin lies in her worshipful devotion to her husband, a man utterly devoid of even a single noble trait, save perhaps his love for her. * * * Her fate seems a pitiless one and we must pity her—a woman of splendid possibilities, who succumbed WWflS\m^MmiM\it^aB^v^MMlt 244 THE MERCURY. to the ambition of another and was ruined." " Brutus " in The Juniata Echo is set forth as a successful moralist but im-practical and unsuccessful as a diplomat. " At fault even in his intense patriotism; impractical, but to his high ideals ever true." The College Student brings Caliban before us as " the most unique creation of the world's greatest dramatist." He is purely the result of imagination, and for this reason can be compared only with others of like nature. He is not like the witches in " Macbeth," and he resembles neither the demons of Milton nor the monsters of Dante. All these lack the variety of qualities and those distinct qualities which make up the mind of Caliban. His moral nature presents an interesting problem. " The moral phases of his moral being are grand in their very lack of consistency with human ideas. In a word, although from a purely human standpoint he has no code of morals, he seems to be governed by some vague, indefinite law which throws a better light on his whole character." His great ele-vating characteristic is his poetic instinct. " He always speaks in poetry, which, when we remember that Shakespeare's lesser lights never spoke in poetry, shows him to be of no mean posi-tion in the drama. * * * The pure beauty of his lofty poetical instinct standing in bold relief against the dark back-ground of his sinful and wayward mind seems to place him in a light in which the background itself is lost." In other words poetical instinct covers a multitude of sins. PATRONIZE OUR ADVERTISER'S i. FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. * Telephone No. 97. s. Ben-d-er 37 Baltimore St., Gettysburg, Pa. The Windsor Hotel 1217=2 Filbert St., Philadelphia. Headquarters for Students. Thoroughly Renovated, Refurnished and Remodeled FRANK M. SCHEIBLEY, Manager. Graduate of Lafayette College 1898. A. G. Spalding & Bros. Largest Manufacturers in the World of Official Athletic Supplies Base Ball Lawn Tennis Foot Ball Archery Roque Ouoits Cricket Lacrosse Golf Implements for all Sports Spalding's Official Base Bsvll Guide for 1906. Edited by Henry Chadwick. The most complete and up-to-date book ever published on the subject. Fully illustrated. Price 10 Cents. For over a quarter of a century Spalding's Trade-Mark on Spalding's Official League Ball is the adopted ball of the National League, and must be used in all match games. Every requisite for Lawn Ten-nis and Golf. Base Ball implements has marked the advancement in this particular sport. Spalding's Trade Mark on our Athletic Implement gives you an advantage over the other player as you have a better article, lasts longer, gives more satisfaction. Every Base Ball Manager should send at once/or a copy of Spalding's Spring and Sum-mer Catalogue—FREE. A. G. SPALDING «3 BROS. New York, Chicago, Boston, Buffalo, Washington, San Francisco, Philadelphia, Kansas City, Montreal, Canada, New Orleans, London England. Denver, Pittsburg. Cincinnati, Syracuse, St. Louis, Minneapolis, Baltimore, Hamburg, Germany I m HVI m ■ mil ■■ JI.J ummmmiffllmnVl I RH PATRONIZE OUR ADVERTISERS. Conklin's Filling ST(£11 For busy people. No bother. Tills itself. Cleans itself. No dropper. Nothing to take apart. Nothing to spill. A dip in ink, a touch of thumb to nickel cres-cent and the pen is full, ready to write. All the best dealers everywhere— Stationers, Druggists, Jewelers—handle the Conklin Pen or can supply it if you in-sist upon having it. Costs no more than other fountain pens of best grade. 100 styles and sizes to select from shown in our catalog furnished free upon request. Any make or style of fountain pen repaired promptly. THE CONKLIN PEN CO. 514-516-518 Jefferson Aw., Toledo, Ohio. Sole Manufacturers Conklin Self-Filling Pen *t PATRONIZE OUR ADVERTISERS. EMIL ZOTHE COLLEGE EMBLEMS Engraver, Designer and Manufacturing Jeweler, 722 CHESTNUT STREET, PHILADELPHIA Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes All Goods ordered through F. A. Faust. CHAS. S. MUMPER, S! FURNITURE Picture Frames of All Sorts. Repair work done promptly. i^-I will also buy or exchange any second-hand furniture 40ham»ersbTirgSt., - GETTYSBURG, PA. SEFTON & FLEMMING'S LIVERY Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrangements by telegram or letter. Lock Box 257. J. I. MUMPER. 41 Baltimore St., Gettysburg, Pa, The improvements to our Studio have proven a perfect success and we are now better prepared than ever to give you satisfactory work . Under New Management The Peoples Drug Store Invites you to visit them and select your needs from a fresh, new, and up-to-date stock. C. WM. BEALES, PEi.G. Prop. D. J. Swartz Country Produce Groceries Cigars and Tonacco Dealer in GETTYSBURG. Shoes Repaired —BY— J. H- BH^ES, 115 Baltimore St., near Court House. Good Work Guaranteed. ^^^WWBWIwCTKlBMi/gmpJiRllfflBBiJBBl I'ittwftihit&Ei PATRONIZE OUR ADVERTISERS. HOTEL GETTYSBURG HEADQUARTERS FOR BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES 82.00 PER DAY. Li-tre^ry jPLtta.criaisci. MI. E. Zinn, Proprietor. :fl7e ^lleirjarj Hardware Go. Manufacturer's Agent and Jobber of Hardware, Oils, Paints and Queensware Gettysburg, Pa. THE ONLY JOBBING HOUSE IN ADAMS COUNTY D. A. RUrT. L. E. ENTERLINE. THE "R. & E." STOUE m > 36 Baltimore Stfleet, Next Citizens' Trust Co. Gettysburg, Pa. Sunday School Lesson Helps and Supplies. P. ANSTADT & SONS PUBLISHERS BOOK AMD JOB PRINTING OF ALL KINDS Write for Prices. YORK, PA. ■ wm««i w*w 1*1 my'iM'wxwiWW*i'IWI9* )' I

Issue 59.6 of the Review for Religious, 2000. ; NOVEMBER: DECEMBER 2000 ,VOLUME 59 NUMBER 6 Review for Religious (ISSN 0034-639X) is published bimonthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for.Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, iVlO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP Mount St. Mary's Seminary; Emmitsburg, Maryland 21727 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subsEription rates. ©2000 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. Jew rel,g,ous LIVING OUR CATHOLIC LEGACIES Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming sJ Clare Boehmer ASC Philip C. Fischer SJ Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm James and Joan Felling Adrian Gaudin SC Kathryn Richards FSP Joel Rippinger OSB. Bishop Carlos A. Sevilla SJ Patricia Wittberg SC NOVEMBER DECEMBER 2000 VOLUME 59 NUMBER 6 contents 566 spiritual practice Retrieving the Practice of Silence Donald J. Goergen oP enters us into an appreciation of silence that we might commit ourselves more to its observance. 575 The Dangers of Solitude Kenneth C. Russell, guiding readers through some 12th-century advice to hermits, shows its 2 l st-cenrury relevance to hermits and others as well. 584 A Spiritual Direction Mary Beth Moore SC gazes at, listens to, a few moments of reality and possibility within contemporary sisterly living. 594 a witness response Contemplative Religious Witness: A Redemptoristine Monastery Dennis J. Billy CSSR finds the life of a group of contemplative sisters very much present to his apostolic mission, and happily reflects that the reverse is true as well. 601 AVowed Response to the Postmodern World Andr~ Maureen Soete SSND seeks ways for the vowed life to contribute more vigorously, more effectively, to the alleviation of troubles in our troubled world. Review for Religious 608 examples from the past Mary Ward: Centuries Her Scroll Lawrence F. Barmann sketches the life story of Mary Ward, the saintly English founder of the Institute of the Blessed Virgin Mary, as an inspiration for us living in the current ecclesial milieu. 614 627 St. Catherine's Letters: Human Love, Gracious Authority Stan Parmisano OP finds that in style and content the letters of Catherine of Siena (1347-1380) have surprising and challenging and charming relevance for persons living today. Katharine Drexel's Cultural Relevance Now Normandie J. Gaitley SSJ sketches the life of the recently canonized Mother Katharine Drexel SBS (1858-1955), a Philadelphia debutante who used her inheritance to serve Native Americans and African Americans. 633 643 vocation When Vocations Happen by Accident Elizabeth Julian RSM describes with quiet enthusiasm her sense of a flexible small community in New Zealand that fosters acquaintance and has shown itself to foster vocations. Vocational Support Donald Macdonald SMM speaks of the human need of support in one's vocation and of the providential availability of that support if we are alert to its manifold presence. departments 564 Prisms 650 Canonical Counsel: Responsibilities of the Novice Director 656 Book Reviews 666 Indexes to Volume 59 November-December 2000 prisms Whave come to appreciate the rich complexi.ty of the biblical term jubilee, espe-cially as we have looked toward the new millennium. But as we approach the Advent and Christmas seasons of the year 2000, one focus of jubilee stands out. Jubilee implies celebration. Advent and Christmas seasons pro-vide an opportune moment for us to consider what it is that we celebrate. Celebrati6n often means bringing people together, sometimes those dearest to us, and at other times the "crowd" that comes together only for special occasions. Celebration can include elegant banquets or simple fin-ger food. It may suggest a refined cocktail party or a noisy beer-keg-and-pretzels get-together. Celebration can imply long-term planning or it may be a spur-of-the- moment, spontaneous occasion. We celebrate beginnings, like newborn babies and the wedding day; we celebrate completions, like school graduations and retirements. We observe national patriotic days, and we take time for religious festivals. But for all the aspects of a jubilee year of forgiveness, justice, and reconciliation, what is it that we most cele-brate? The biblical notion of jubilee celebrates, above all, our being God's people and our living like God's sons and daughters. This planet called Earth is "home" for us because it is God's home. Our space-age view of our planet Earth has brought home to us how much we all are "stewards," not owners, of God's gift to us. Review for Religious What is striking is how our jubilee celebrations enter us into the Gospel Prodigal Son parable. Whether we more identify with one who hopes to see life as only an arena of personal delights and squanderings or whether we more identify with the other who defines life as a kind of slavery with weighty obligations and grim duties, we realize how much we need a jubilee understanding of life. Both sons, in Jesus' famous parable, understand neither the father who helped bring them into life nor the life which this father wants to share with them. The first son in his self-cen-tered celebrating misses the point of celebration. The second son in his self-defined servitude also misses the idea of celebra-tion. Just as the father in the parable goes out of the way to meet each son, so God continues to break into our life to call us to a reality of biblical jubilee. Advent is our jubilee celebration of our longing and desire to dwell in the house of the Lord all the days of our life. Christmas is our jubilee celebration of God's desire and longing to come and play forever among the children of Earth. Advent and Christmas are at the center of our understanding jubilee because both seas~ons emphasize the heart of all our reasons to celebrate: God calls us sons and daughters, and we know the redemptive salvation that Jesus brought, of living in God's home all the days of our life. David L. Fleming SJ thank you for your ~uppor~throughout thi~ pa~t yoar and pray that (~od~rieh o a nd~ abundant iubiloo Advont and ~hri~tma~ Th~ Mitor~ and ,of Revi~ ~orRoligiou~ . " November-December 2000 spiritua practice DONALD J. GOERGEN Retrieving the Practice of Silence Jesus experienced the need for quiet. "In the morn-ing, while it was still very dark, he got up and went out to a deserted place, and there he prayed"(Mk 1:35, NRSV). What did he seek there? What did he find? The Book of Psalms is quoted in the New Testament more often than any other book of the Hebrew Bible. What role did the psalms play in the prayer of Jesus? "Be still, and know that I am God" (Ps 46:10). How often in the course of his life did Jesus pray over verses like that, or this: "For God alone my soul waits in silence; from him comes my salvation"? (Ps 62:1). There are few things in human life more important, both personally and communally, than discovering the value of silence. Spirituality and religion are important dimensions of human and social life, and so are silence and stillness. Other civilizations, perhaps more pastoral, more agrarian ones, had greater opportunities for the practice of silence. Our times seem less fortunate in that regard. Yet silence is essential to wholesome living. My purpose in these reflections is to help us appreciate silence more and commit ourselves to practicing it. Donald J. Goergen OP wrote on celibacy for our May- June 1998 issue. His address is Friends of God Dominican Ashram; 720 35th Street; Kenosha, Wisconsin 53140. Review for Religious Worship, Charity, and Silence Which is more important, love of God or love of neighbor? (Mk 12:28-31). It does not take much to realize that this question is falsely posed. Which is more important, inhaling or exhaling, yang or yin? St. Anselm spoke of God as "the Being a greater than which cannot be conceived." Certainly, for one who believes, God alone deserves to be worshiped. Adoration and praise are the only appro-priate responses to God. Although there is nothing in human life more important than love of God, the God of Jesus instructs us that there is something that must precede or accompany it. "So, when you are offering your gift at the altar, if you remem-ber that your brother or sister has something against you, leave your gift there before the altar and go first be reconciled to your brother or sister, and then come and offer your gift" (Mt 5:23- 24). "Those who say 'I love God,' and hate their brothers or sis-ters, are liars; for those who do not love a brother or sister whom they have seen cannot love God whom they have not seen. The commandment we have from him is this: those who love God must love their brothers and sisters also" (1 Jn 4:20-21). As important as worship is, equally important is the practice of charity, love of neighbor, the "works of mercy" (Mr 25:31-46). The revolution in Jesus' teaching was not that he understood love of God, the Shema (Dr 6:4-5), as the core of the Hebrew Scriptures. Almost every practicing and devout Jew understood that to be the great com-mandment. But Jesus' placing love of neighbor (Lv 19:18; Mk 12:31) on a par with love of God, that was revolutionary, and for him that was what true religion is about. For Jesus, the second commandment is not secondary, not second in the sense of less significant. According to Matthew, it is "like" the "great and first" commandment (Mr 22:38-39). Luke (10:27) reports them as really one commandment. True worship or love of God is inseparable from true com-passion or love of neighbor. But what do love of God and love of neighbor, or worship and the works of mercy, have to do with the practice of silence? Abhishiktananda, or Henri Le Saux, the French monk who came to India in 1948 and immersed himself in its reli-gious environment, wrote: Now if something has passed in this long discourse by the way of words, yet beyond words, if you have heard in the words of the Upanishads some echo of what the Spirit has November-Decenlber 2000 Goergen ¯ Retrieving the Practice of Silence certainly whispered in your heart when you sat in contem-plation of the mystery of the Father and the Son, then you will discover by yourselves the secret of what is called the Advaitic or Upanishadic prayer. It can be summed up in one Hebrew phrase of Psalm 65, which Jerome translates: silen-tium tibi laus. Silence is praise for you. Silence in prayer, silence in thanksgiving, prayer, and adoration, silence in meditation, silence inside and outside as the most essential preparation for this stillness of the soul in which alone the Spirit can work at his pleasure.~ The contemplative and interior journey, the love and worship of God, are dependent on silence. But charity or love of neigh-bor depends on silence too. A loving kindness toward our human companions on this earth requires the silent journey inward just as true worship of God requires it. Can there be true love of neigh-bor without confronting the truth about ourselves? Can we expect reconciliation and forgiveness in our world if we ourselves are not yet ready to forgive? If we are to transform our world, we must also be working on becoming transformed ourselves. Social engage-ment requires time apart. Silence is essential if we are to deepen our love for God and our love for our neighbor. Silence, Solitude, and Simplicity What does silence sound like? What does it look like? Are there different kinds of silence? Now there was a great wind, so strong that it was splitting mountains and breaking rocks in pieces before the Lord, but the Lord was not in the wind; and after the wind an earth-quake, but the Lord was not in the earthquake; and after the earthquake a fire, but the Lord was not in the fire; and after the fire a sound of sheer silence. When Elijah heard it, he wrapped his face in his mantle and went out and stood at the entrance of the cave. (1 Kg 19:11-13) True silence, the inner stillness, the still point, is an achieve-ment to be sought, yet always remains a grace. But it is a grace upon which we must focus our attention. It requires discipline, which does not guarantee interior silence, but rather prepares the way. We must devote time to "the practice of silence," the practice of interior and contemplative prayer, the practice of an awareness that is the fruit of quieting the mind.2 Such "quiet" is not easily obtained in our world today. Not Review for Religious that a busy, technological, urban society is the enemy of silence, but neither is it a friend. Modern social and commercial life cannot prevent the pursuit of silence, but neither do they encourage or value it. Entertainment is a noisy industry. The more channels we have on television, the better. But then they must be filled--with "stuff," whatever it be. They compete for attention; thus, the more out-rageous, the more likely the success. The Internet now multiplies ways to distract us from an inner stillness. Not to find television entertaining seems quaint. To see it or the overuse of the Internet as distraction from true entertain-ment, a life with God quietly pursued, is sec-ular heresy. For silence is not the stuff of which modern societies, commerce, or edu-cation are ordinarily made. Not that the media, the schools, the churches, market-places, and businesses are avowed enemies of silence; they are just uneasy with it. We are talking about a disciplined silence that requires resolve. Its close friends are solitude and simplicity. These compan-ions reveal how countercultural true silence really is. Solitude is one of silence's most cherished friends. Yet how difficult it is in our world today to find solitude, to pursue solitude, to practice solitude. We are "driven" away from it. We can hardly face the silence within ourselves. We flee. As Francis Thompson wrote: I fled Him, down the nights and down the days; I fled Him, down the arches of the years; I fled Him, down the labyrinthine ways Of my own mind; and in the mist of tears I hid from Him, and under running laughter.3 The running is aided by all the activities of our world, justified by the needs of our world, and rationalized by "This is just our world and that's the way it is." To desire silence we must value solitude. We identify aloneness with loneliness. But, until we are at home with ourselves, we will always be lonely, no matter how busy, how "with it," how much with others we might be. As we know, marriage is no cure for loneliness. Neither is single life. Dietrich Modern social and commercial life cannot prevent the pursuit of silence, but neither do they encourage or value it. November-December 2000 Goergen ¯ Retrieving tbe Practice of Silence Bonhoeffer once cautioned us to be wary of the person who lives with another or in community who cannot be alone, or who lives alone but cannot live in community.4 Sociality and solitude are two sides of the same coin: we can-not find one without the other. Silence lives on solitude. We must find ways to structure it into our lives on a regular basis, like the food we eat. Where can we find that place apart, that space for being alone, and for how long can we keep ourselves there with-out being taken up by distractions~ Where can we go to practice silence? Or how in the midst of activity can we find that cell within? s One of solitude's companions is simplicity of life. Simplicity inside requires simplicity outside. A cluttered, thing-filled, con-sumer- intensive environment is hardly the place in which to prac-tice an awareness that few things in life are important. The world immediately outside myself needs to reflect what I am trying to attain within myself. Simplicity in life is an outward expression of simplicity within. One's "within" and "without" go together. And now we can see more clearly why our current economic world can easily become an enemy of silence. The pursuit of silence eventu-ally becomes a pursuit of simplicity of life--which is a recognizable enemy to a consumer economy, a global and ever expanding mar-ket economy. Not that the market is evil; it is just easy prey to the pretension that it alone is important, the be-all and end-all of human life. The practices of silence, solitude, and simplicity enable us to see the truth about economic pursuits: How inhumane they can be when given priority in life, how grounded in greed they become! Kinds of Silence There are a variety of silences.6 Silence can be either destruc-tive or constructive.7 Destructive silence is refusing to speak when a word is called for, a word of consolation, of affection, of chal-lenge. Destructive silence can be passive aggression, a refusal to participate, a lack of care, a form of punishment, unconscionable noncommunication. But silence as context for an interior journey is positive. Silence as a socia! context is the absence of noise in our imme-diate environment. There are different degrees of environmental silence. A noiseless environment is difficult to find in modern Review for Religious urban settings. One can distinguish rural silences and urban silences. For someone unaccustomed to rural silences, the sound of the cricket or the howl of a coyote can be disturbing. There are sounds to which we have become accustomed and those to which we are not. Familiar sounds need not destroy environmen-tal silence, but can blend with it. There is a silent stillness to the vastness of nature: the sounds and silence of the ocean, the moun-tains, the desert, the plains. Each is a different environment and a different silence. On a windless day, sitting atop one of the mountain peaks of the Sangre de Cristo range near Christ in the Desert Monastery in northern New Mexico, one can hear an almost Human silence absolute environmental silence. Human silence is the presence of nonspeech, call be a silence It is not necessarily noncommunication or non-of solitude, communitarian. Silence itself can communicate abundantly, and it is amazing what can be corn- but it can also be municated without words. Human silence can be a silence of solitude, but it can also be commu- communitarian. nitarian. A solemn silence can prevail in Christian or Buddhist monasteries or a Hindu ashram, in a synagogue, church, or mosque. These settings or "environments" can be sacred space. There are times and places when human speech is out of place or out of season. Human silence can be community silence, but there is also personal silence. An individual person can cultivate silence--by seeking environmental silence, or sacred space, or solitude, but also by the practice of silence: avoiding unnecessary speech, c~eating personal space, the silence of one's own room, withdrawing to "the cell within," lis-tening to music, allowing absorption in art and beauty, acquiring an inner stillness and the practice of meditation. Personal silence itself is not only oriented toward calm, tran-quillity, and an absence of stress, but ultimately toward interior silence, the silencing of the mind, even if this is rare or only momentary. I remember a conversation with a cloistered Dominican nun, who had a doctorate and had been teaching before joining this cloistered contemplative community. When I asked why she had joined the monastery, she replied, "I needed to stop thinking if I was going to start praying." The human being is a reflective being, but also a contemplative being that sometimes needs to move beyond thoughts (mental silence) as well as wordsv-~z-~'~---)-'[-i November-December 2000 Goergen ¯ Retrieving the Practice of Silence (verbal silence). The interior journey is in fact directed toward this deep silence within, this cave of the heart, this still point, this soul of the soul, this human spirit. Spiritual silence is the human spirit at peace, the silence of the spirit in its communion with the Spirit of God, the divine Spirit, the Holy Spirit. This is mystical silence, with its dark nights, its ecstatic joy, its calm recollection, its deep rest. Silence of any sort is most often not constant, but periodic, coming at intervals, having a rhythm of its own. Deep silence, mystical silence, is not an achievement but a grace. Thus one can speak of the grace of silence, a grace that is present in varied ways and at varied levels, exteriorly and interiorly: the prayer of silence, the silent Presence, the Holy Mystery. It is this mystery that we cel-ebrate in liturgy and seek in contemplation. We experience litur-gical silence, a pastoral silence, intimate silences, times and places not to speak, for which words are inappropriate, occasions on which only silence can communicate. Silence can communicate from within a depth beyond words. In community, in friendship, in ministry, and in prayer there must be silence as well as speech. Divine silence is God's very own silence, God's very own self-communication, God's' awesome and incomprehensible transcen-dence, God's overwhelming intimate immanence, God's elusive presence and mysterious absence, God's truth and God's beauty, the Nameless One whose name is Father, Son, and Spirit, the One- Who-Is, the One-Who-Is-With-Us, the silence of being, the sound of ore, the soundlessness of communion, the union of God and humanity, the union of Word and flesh, the triune union, the incor-poration of humanity into the silent triunity of its Creator. There is ultimately no distinction between divine Silence and divine Speech. They are one 'and the same. God's speech is silent, and God's silence speaks. Silence and Theology .The practice of silence is necessary not only for the spiritual journey and to sustain our humanity. It is also essential for doing theology. Theologians are accountable for their theology to their professional peers, to their varied communities of faith, and to society at large for the quality, fidelity, and social implications of their work. They cannot absolve themselves of this threefold responsibility. But the theologian is also accountable to God. One Review for Religious does not stand before the Holy Mystery, the mysterium fascinans et tremendum, without asking the Holy Spirit for courage, guid-ance, and wisdom. In other words, all theology must begin with prayer. It has both a reflective moment and a contemplative moment. It is not an ego project, but a work of the Spirit. Theology cannot be done apart from silence. The practice of silence, of placing oneself in the presence of God, of meditation, of listening, of longing are all part of doing theology. Theology can too easily become words, verbal batdes, polemic, agenda ridden, jargon, rather than revelatory, illuminating, con-nected to life, committed to Truth. This happens when theolo-gians neglect the practice of contemplative silence--which would make them aware of both the inadequacy and the necessity of words for communicating the divine mystery. A theologian needs to be practiced in the art of silence. So does the magisterium in the church need to practice it. "Roma locuta est," the saying goes. But think of the symbolic power in "Roma tacuit." What a wonderful example that could be. Magisterial authority must reflect that we are a learning church as well as a teaching church. Is not part of the crisis over author-ity the ways in which the church exercises its authority? We do not grant authority easily to those who do not listen. Silence gives value to words. Apart from words, silence can be sterile, but apart from silence words lose their power. As Ecclesiastes (3:7) says, "There is a time for keeping silence, a time for speaking." Silence is a work of the Spirit. True silence is ulti-mately prayer. It speaks with authority. It communicates truth. It creates community. It is the voice of the soul, of the human spirit, and of the Holy Spirit. Can we afford to allow its practice to become peripheral in our lives? In The Sleeping Beauty, Ralph Harper points to the value of silence for our world: Each order of experience has its own a.tmosphere. The atmo-sphere of presence, of giving, of wholeness, is silence. We know that serious things have to be done in silence, because we do not have words to measure the immeasurable. In silence people love, pray, listen, compose, paint, write, think, suffer. These experiences are all occasions of giving and receiving, of some encounter with forces that are inex-haustible and independent of us. These are easily distin-guishable from our routines and possessiveness as silence is distinct from noise.8 November-December 2000 Goergen ¯ Retrieving the Practice of Silence Not only nuns and monks, but all of us need to retrieve the art and practice of silence. We need to dip deeply into the silent abyss of self, of God, of God in the self and the self in God, We need to explore the emptiness and the fullness that lie within us. We need silence. Notes 1 Abhishiktananda, "The Upanishads and Advaitic Experience," in The Further Shore (New Delhi: I.S.P.C.K., 1984), p. 117. 2 Buddhist traditions also see a triple relationship: compassion, rooted ¯ in egolessness, which in turn is rooted in mindfulness. These three are intimately connected. See Sogyal Rinpoche, The Tibetan Book of Living and Dying (San Francisco: Harper, 1992), esp. pp. 59-72, 116-122, 188-201. 3 The first lines of "The Hound of Heaven." 4 Dietrich Bonhoeffer, Life Together (New York: Harper and Row, Publishers, 1954), esp. pp. 76~89. "Let him who cannot be alone beware of community. Let him who is not in community beware of being alone. ¯. The mark of solitude is silence, as speech is the mark of community. Silence and speech have the same inner correspondence and difference as do solitude and community. One does not exist without the other. Right speech comes out of silence, and right silence out of speech. Silence does not mean dumbness, as speech does not mean chatter. Dumbness does not create solitude and chatter does not create fellowship" (p. 78). s See Catherine of Siena: The Dialogue, trans. Suzanne Noffke OP (New York: Paulist Press, 1980), on the "cell of self-knowledge," pp. 25, 118, 122, 125, 135, and 158. 6 Theodore Pereira in "Eloquence in Silence, Healing in Stillness," Indian Theological Studies 33 (June 1996): 99-126, has written about different types of silences. 7 "Silence itself is expressed in several ways. We know silences of contempt and of joy, of pain and of pleasure, of consent and of solitude." Jean-Luc Marion, God without Being (Chicago: University of Chicago Press, 1991), pp. 53-54. ~ Ralph Harper, The Sleeping Beauty (London: Harvill Press, 1955), pp. 110-111. The word "men" in the original was changed to "people" to accommodate current usage. Review for Religious KENNETH C. RUSSELL The Dangers of Solitude ~o~e~oe ldi!a nTgheerrse oisf as ololintugd tera. dAitniodn t hoef wwaarrnniinngg sw hoauvlde- bneo th ceormmiets solely from cenobites suspicious of solitaries off doing "their own thing." Religious who have the highest regard for the blessings and joys of the life of aloneness with God have tempered their enthusiasm with cautionary words about the special difficulties the solitary is likely to encounter. Thomas Merton, for example, warns that "sordid difficulties and uncertainties" attend .the life of even interior solitude,l Authors from the first centuries of the church conjure up frightening pictures of the demons who lie in wait for the unsuspecting hermit, while modern writers warn newcomers to the desert that solitude will force them to confront the disturbing image of their true self. The message is clear: more awaits the novice hermit than the beauties of nature and the spiritual delights which ancient and contemporary enthusiasts of the eremitical life tend to emphasize. I suppose that most contemporary solitaries would agree that demons in one guise or another must be wrestled with and that it can, indeed, be a distressing experience to come face to face with the self we usually avoid in a flurry of activity. However, I also suspect that most hermits are somewhat amused by both the modern and the ancient depiction of their lot. They would be only too happy to confess that there are no monsters writhing in the Kenneth C. Russell last wrote for our March-April 2000 issue. His address remains 40 Landry Street, Apt. 1505; Vanier, Ontario; K1L 8K4 Canada. November-December 2000 E5-7-5 Russell ¯ The Dangers of Solitude corners of their huts and that the identity crisis so precious to their contemporaries does not keep them awake nights. What they actually confront, it seems, is a routine cycle of sun and cloud on a prairie stretching clear to the horizon. There are no mountains or valleys to speak of. Their bad days are as unremarkable as their good ones. They struggle against subtle temptations, not spectacular ones. It has always been so. The 12th-century Cistercian Aelred of Rievaulx recognized this in his hard-hitting Letter to a Recluse, addressed to his elderly sister but written with less seasoned solitaries in mind? So did his contemporaries Peter the Venerable and Bernard of Portes, who wrote shorter and less theologically dense letters to male recluses who had asked their advice.3 Twelfth-century recluses lived in circumstances that are quite different from those in which most modern hermits seek solitude. But this does not mean that the letters of Peter and Bernard are merely quaint witnesses to a bygone era. The basics of the eremitical life are constant across the centuries. They are also unaffected by the way in which different solitaries choose to live the eremitical life. Whether the solitary is a recluse, a hermit, or a homeless wanderer like Benedict Joseph Labre does not radically modify the eremitical life. Consequently the letters Peter and Bernard wrote to 12th-century male monastic recluses remain relevant to male and female solitaries of all kinds, even today. Indeed, it seems to me that their practical orientation makes them especially useful. Therefore, I want to focus on the difficulties these authors see arising when the honeymoon period of the eremitical life--which may last a good long time--is finally over. In highlighting some of the minor difficulties which can grow into major problems if not attended to, it is not my intention to present a negative view of the solitary life. It does have dark days; it would not be a human enterprise if it did not. However, in focusing on the gray periods, I am not denying its spells of fine weather. I am merely reiterating the warning uttered down the centuries that people who wander off into the desert on their own had better know what they are about. Peter the Venerable's Letter to Ghislebert Peter the Venerable, the great abbot of Cluny, was, by his own admission, a very busy man. In fact, he shocks us a bit by admitting that he read the letters from a Cluniac recluse named Ghislebert in Review for Religious his choir stall on Holy Saturday. He claims that he had simply not been able to find a moment to read them earlier. Peter may have been rushed, but he nevertheless knew something about the eremitical life. Not only did he himself periodically spend time in solitude, but he had pastoral experience in directing monks who sought a solitary retreat for a limited period or for life. There were actually a large number of hermits living in the woods near Cluny. Peter the Venerable, then, knew what he was talking about when he replied to Ghislebert's request for guidance. The key to Peter's advice is the emphasis he puts on the idea that, as a recluse, Ghislebert has been buried with Christ. We do not know the nature of the liturgical ceremony with which Ghislebert was committed to his cell, but other sources indicate that the idea of being buried with Christ and dead to the world was sometimes dramatically represented by using funeral rites to initiate such enclosure. In any case, Peter emphasizes that, if his effort to live as a recluse is going to succeed, Ghislebert had better be sure that he is indeed dead to the world and the world dead to him. To drive home the point, Peter quotes the desert father Arsenius: "Flee people, be silent, and you will be saved." In short, be what you have set out to be and all will be well. Although we may feel a little ill-at-ease with the medieval idea of the recluse being rather literally buried with Christ, it is obvious that any new solitary needs to make a definitive break with the world and his or her past to get off to a good start. He or she has to be serious about being marginal. But, for all the images of being cut off and buried, the reality is that a living human being goes into the desert. He or she wants to be there, of course, but the spiritual and especially the psychological conditioning to solitude is not achieved by a mere act of will. The hermit, in fact, begins with some interior dividedness. Part of the self has no interest in disappearing. Inevitably the life force will rise up against the isolation and denial of achievement that the solitary life demands. Hermits also soon discover, as the Carthusian Guigo II puts it, that they are a crowd unto themselves. They are, indeed, the doorway through which the world presses into the cell. They may succeed in finding a quiet spot on the sidelines of society, but the Hermits soon discover that they are a crowd unto themselves. November-December 2000 Russell ¯ The Dangers of Solitude internal vacuum created by their withdrawal makes them vulnerable to the imagination's readiness to reassert their right to a place in the world. Since hermits have what we might term a "weak" present, the mind tends to take refuge in either the past or the future. Bernard of Portes will highlight the way in which the past crowds into the hermit's mind. Peter the Venerable puts more emphasis on the daydreams about the future which exploit the hermit's status to draw him away from his solitude. He pictures the monk turned hermit imagining that he feels the tabs of a bishop's miter on the back of his necl~ or fantasizing that he is the wise, holy, and much admired abbot of a large monastic community. This is all nonsense, of course, and surely most beginners are as amused by the tricks the imagination plays as Peter the Venerable is. What is not funny is that these silly thoughts can trouble prayer. It is also true, unfortunately, that small threads can weave themselves into strong ropes. If hermits are not careful, they can convince themselves that they are made for something better than the sorry life of a solitary. A more serious pressure to "return from the dead" and reenter the hustle and bustle of.life, bit by bit, springs from the essential nature of the solitary existence. Hermits have to live without the external momentum that social interaction usually provides. They are not carried along by the excitement of what is going on at their workplace, nor can they look forward to parties or sports events to distract them. Unfortunately, unless solitaries maintain their focus on whatever is the task of the moment, their day-to-day existence will begin to feel dull and wearisome. The obvious way to relieve this lethargy is for the solitary to engage in a small amount of pastoral or counseling activity. This sounds like a psychologically sound idea, especially to modern Christians, who are more than a little suspicious of the way hermits pull away from the good causes "activists" think so important. Peter the Venerable, however, is not so sure. He is afraid that this public ministry will become addictive. Instead of relieving the hermits' boredom so that they can return to the solitary life refreshed, each turn outward makes solitude all the more unbearable and the turn away from it all the easier. What looks like a solution to the pressures of the eremitical regime can destroy a hermit's ability to live the solitary life. "Doing good" can do a hermit in. A second consequence of the turn outward is that the solitaries' Review for Religious availability attracts people who offer two enticing things: prestige and cash. Since the strict eremitical life deprives hermits of the ordinary opportunities to see themselves mirrored in the reaction of others, Peter the Venerable rightly fears that Ghislebert will take the high esteem in which he is held by those he helps as the true measure of his worth. The abbot sees a further danger in the money that the hermit will be offered for his services. With all the good intentions in the world, Ghislebert can easily find himself managing a little charitable fund which will grow, as such things do, until, as Peter puts it, he is putting up buildings and demolishing himself. Peter's point would seem to be that hermits who are not perfectly honest about their motivations can make a place for themselves in the world. They can keep an address in the woods, as it were, and still be part of society. The price they pay, unfortunately, is the abandonment of their original commitment. History offers many examples which confirm that the hardest thing in the world for solitaries is actually to be what they profess to be. Aelred of Rievaulx was very hard on the way in which solitaries drift into outside activities. He sharply admonished them to wake up to the facts of their vocation. "When you are pressured to get involved: Tu sede, tu tace, tu sustine. Sit still, keep quiet, and stick it out! Period! Leave the doing of good deeds to those who .have the responsibility for such tasks." The solitary's fundamental temptation, it seems, is to focus on something other than God. According to Peter, this can be anything from good works to an obsession with health or appearance. "Doing good" can do a hermit in. Bernard of Portes's Letter to Rainald The Carthusian Bernard of Portes agrees with Peter the Venerable that solitaries need to be on guard against the distractions that are likely to entice them away from their fundamental commitment. He is particularly sensitive, however, to the spiritual and psychological repercussions of the hermit's withdrawal from society. He understands very well that the social self will not go lightly into solitude. Though hermits are united to all believers and, indeed, all humanity in their union with Christ in his church, the social self wants to strut its stuff in the midst of the diversions November-December 2000 Russell * The Dangers of Solitude Hermits do not have the social status they enjoyed in the 12th century. of the marketplace. It does not want to be shut away with not much more than God to focus on. Therefore, Bernard warns Rainald that he must expect a spell of bad weather sooner or later. One day he might be hit by a wave of sadness and the next be in a bad mood and irritable. He will find tapes from his past running in his head while he reedits the script of what he said and did. A troupe of lewd thoughts will stage its floor show one day, and lukewarnmess flood in the next. It seems that there is no escape from these inner storms and flat stretches. Indeed, Bernard maintains that hermits go into the desert specifically t6 wrestle with these elements that distract us from God. They are, we might say, the psychological echoes of a hermit's attachment to the world he or she claims to have renounced. Bernard of Portes warns hermits that, because they are no longer carried along by the current of daily life in society, they will be the targets of acedia and sadness. Acedia, a listless psychospiritual condition, weighs so heavily on its victims that some escape from the boredom o'f the here and now into dreams of what has been and might yet be while others slip into the torpor of chronic fatigue. This affliction, which involves a hanging back from the initial vocational commitment and a failure to actualize it in the present moment, "detemporalizes" hermits. It weakens their focus on the here and now and sets them adrift. Therefore they look outward for things to occupy their mind and fill their time. Bernard says it is very important for hermits to give their life a certain self-generated dynamism by moving from one activity to another th~'oughout the day. Oddly enough, this is in accord with the traditional wisdom that the secret of the eremitical life is "Keep it moving." Bernard also emphasizes meditation and advises Rainald to be totally present to the words he is saying when he recites the Office. Bernard, it is quite clear, believes that acedia can be held at bay if a hermit puts his or her mind to it and lives in the present moment. Sadness, however, is another matter. Bernard seems convinced that an occasional period of feeling down is an inescapable feature of the eremitical life. Sadness is, I suppose, a pit into which an Review for Religious individual ill-suited for solitude might tumble, but this does not seem to be what Bernard has in mind. He is describing, not a chronic or pathological condition, but the normal downturns of life--which the hermit feels more intensely because of his or her isolation. On the spiritual level, the alternation of these strong and weak periods is inevitable in view of the ebb and flow of God's grace. If acedia pulls one away from the present, sadness can be said to sink one into it. Sadness is the clouding over of the eternal horizon of hope which draws us forward. Without the attraction of the ultimate goal--which is, remember, the sole dynamic element in a hermit's life--the individual is oppressed by the miseries of the present. For no good reason, anger can well up in the solitary and rail away at the self or other people: "Nothing they do is ever any good, and nothing I try ever works out!" Such slack times call for patience, because, once again, the temptation is to shift attention away from God and the love that is his due. The self, whether proud or inadequate, whether much sought after or neglected, must not become the primary object of the hermit's attention. Application to Modern Hermits Is any of this applicable to modern hermits living in country cabins and cheap city apartments? I think so. Times have certainly changed, but the leisure of the hermit can still go flat, and money remains a worrisome issue. Unlike their 12th-century counterparts, modern hermits do not have to figure out how to channel their excess funds to the poor without attracting a crowd of beggars, but they do have to worry about how to live apart from the world and still earn their keep. Unless they are supported by a religious congregation or order, paying their bills and providing some measure of stability in an unsettled time can be a real preoccupation. Indeed, it can shipwreck their project altogether. Pride, which Peter the Venerable and Bernard of Portes see as a major threat to hermits, would seem to be less of a worry these days. Solitaries are looked up to once again, but the applause is not unanimous. In fact, many people who give their lives to the service of Christ and his poor question the sense of such a calling. Certainly hermits do not have the social status they enjoyed in the 12th century. In any case, while many religious who become November-December 2000 Russell ¯ The Dangers of Solitude With no one else to worry about, they can become obsessed with every ache. solitaries identify themselves as hermits, most lay hermits have no official status of any kind. They live a hidden life which is just that, hidden. The lack of social status does not mean, of course, that hermits are immune to the temptation to take a little secret pride in the uniqueness of their calling. Pride, however, does not seem to be the great danger it was to hermits in the Middle Ages. Certainly relevant today, however, is the emphasis Peter the Venerable and Bernard of Portes put on the need for the hermit to exist in the now. This almost Buddhist focus on being present to the moment is for both of them basic to the eremitical life. Without this absorption in the here and now, distractions press in. The hermit, to borrow a phrase from the world of sports, "loses his or her concentration" on the worship of God in unending prayer. This is a major problem, but, given the restrictions of the solitary life, it manifests itself in small and sometimes silly ways. For example, hermits may get too wrapped up in their work or turn repairs to their dwelling into a full-scale redecorating project. They can become finicky fussbudgets who insist that every item in their cell be lined up just so. Worse yet, with no one else to worry about, they can become obsessed with every ache and sniffle. What are we to make of Peter the Venerable's condemnation of the tendency of hermits to make themselves useful to their fel-low Christians by offering them the fruit, as it were, of their con-templative silence? Must we conclude that he, and Bernard as well, would censure the spiritual direction and parish activities in which some contemporary hermits get involved? Not necessarily. In their letters both authors emphasize--and we must keep in mind that they were writing to recluses, that is, to solitaries who in theory were totally cut off from the world--that the singularity of the eremitical life means that hermits will have to work out what is best for them. Therefore, while Bernard borrows from the cus-toms of the Carthusians to make all kinds of suggestions to Rainald about the details of his life, he realizes that it is up to the hermit to exercise discretion in choosing what suits him. Consequently, we can conclude that, although Peter and Bernard show that it is easy for hermits to delude themselves about why they are rendering this or that occasional service, it is up to them to determine, after Review for Religious taking counsel, what fosters their aloneness with God and what hinders it. I suspect that there are times when novice solitaries, going through a dark period, might welcome the sight of a few demons raising cain in their living room. They might even be glad to summon up the self-absorption required for the drama of a first-class identity crisis. Anything exciting and novel would be a relief. What they have to contend with, however, day in and day out, as Peter and Bernard remind them, is the subtle task of remaining faithful to their original commitment in all kinds of psychological weather. They have much to gain and much to lose. Peter the Venerable and Bernard of Portes, who shared a high regard for the solitary life, warn them, therefore, to take care. Notes ' Thomas Merton, "Notes for a Philosophy of Solitude," in his Disputed Questions (New York: Farrar, Straus, and Giroux, 1960; Noonday Book, 1976), p. 165. 2 A Rule of Life for a Recluse, trans. Mary Paul MacPherson, in The Works of Aelred of Rievaulx, Vol. 1: Treatises, The Pastoral Prayer, Cistercian Fathers Series, no. 2 (Spencer, Massachusetts: Cistercian Publications, 1971). 3 Neither the letter of Peter the Venerable to Ghislebert nor Bernard of Portes's letter to Rainald has, as far as I know, been translated into English. The Latin text and a French translation of Bernard's letter can be found in Lettres des premiers chartreux, Vol. 2, introduction, critical text, French translation, and notes by "un chartreux" (Sources chr~tiennes, no. 274; Paris: Cerf, 1980), pp. 50-79. For the Latin text of Peter's letter, see Giles Constable, The Letters of Peter the Venerable, Vol. 1 (Cambridge: Harvard University Press, 1967), pp. 27-41. November-December 2000 MARY BETH MOORE A Spiritual Direction Connie drew the heavy drape across the window, noting the ast gray light filtering from the west. She turned on a small lamp on one side of the room and lit the vanilla candle at the other. Immediately its aroma permeated the small space. She selected a Mozart disc from the handful of CDs near the love seat, placed it carefully on the turntable, pressed play, and adjusted the volume so that the maestro's graceful, precise notes were barely audible, as subtle as the candle. She paused, looking slowly to each corner until satisfied by the atmosphere she had created. Free of clutter, the parlor was just large enough for the love seat, chair, and coffee table. She sat down on the chair. Connie never sat until she was satisfied. She was a short, heavy woman and, since it was not easy for her to get out of a chair, she considered the act of getting into it. She had a few moments before her guest arrived, and this time was also planned. The guest or, more precisely, the directee required the kind of attention one must work up to. So she made an effort to appreciate the room for its own sake. She awaited the security these preparations usually brought. She summoned the attitude of inner peace which any directee had a right to expect of her, breathing deeply, ignoring the slight pulse in her legs, ankles, even noting the contradiction between attending to a pleas-ant carnal sensation--the candle--and determinedly shutting out the unpleasant. She made herself breathe. Connie had been a spiritual director for almost twenty years, Mary Beth Moore SC writes from 3496 Jerusalem Avenue; Wantagh, New York 11793. Review for Religious and people liked her. She had talent in this abstruse area, and she knew this because her directees said so. Most of her clients were nuns, participants in a lifestyle whose subtle conflicts she knew as her own, having been a nun now for forty years. Relationships: community, friends, principals, superiors. Even, occasionally, a romantic entanglement. And, of course, the relationship with God. Connie never told them what to do. She listened. She asked ques-tions. She recalled for the searcher his or her own best qualities. (Yes, even the occasional priest or layman found his way to her.) Generosity. Loyalty. Courage. Connie never mi~de these things up. Yes, that was the talent. Seemingly from thin air, she would recall a point the directee had made two months before, or ask precisely the right question. "What must you do to grow in this sit-uation?" The question was perhaps trite, but the answers never were. Stammering or articulate, passionate or cool, the directee usually responded with a perfectly credible plan of action, one whose truthfulness went to the heart of the matter. She had learned to expect the creativity that her directees brought with them. Still, Connie did not consider herself creative. She thought of herself as a modest person, and attributed the results to God's grace. When she looked in the mirror, she saw a face that had always been plain, and was now old. Of course, Connie had not once seen her own brown eyes transformed with the glow of the full attention she gave to the directees. They simply thanked her. She expected nothing more. At the sound of the doorbell, Connie took hold of the chair arms and, giving herself a boost, stood and steadied herself before crossing the short distance to the front door. She was pleasantly nervous for this encounter with her client, and she hurried as much as she could, knowing how uncomfortable it was to wait at her door. The Bronx brownstone faced southeast toward the Sound and Long Island, and through the winter a stiffwind blew almost steadily. She opened the door to see a petite woman framed against the dark corridor of the street, hopping around on the stoop to cope with the cold. The sky behind her was clear, but dark. The city lights obliterated all but the highest-hung stars. "Marilyn, my dear, come in quickly before the wind knocks you down." "It almost did. I parked a block away, and--" "Did you meet much traffic?" Connie took Marilyn's coat and shivered at the cold that rolled off of it. November-December 2000 Moore ¯ A Spiritual Direction "Som'e, as usual. The Cross Bronx is always crowded." "Oh, that's a terrible road. I always feel glad when I turn off. A cup of tea before we start?" "I would love it, if it's no trouble. It sounds so good." "No trouble at all. Go in and make yourse.lf comfortable. I'll be right back." She indicated the room she had just prepared, and waited to be sure her guest was seated before disappearing into the inner quarters to make tea. She returned with a tray and two steaming cups. They were silent as they fixed the tea to their lik-ing. Part of Connie's skill was to suppress small talk as the pre-lude to spiritual direction. Chatter cluttered the spirit, she believed. She had once lived as a hermit for three months, and the disci-pline served her well. After a suitable interval she moved to her cus-tomary opener. "So, tell me, what brings you to spiritual direction?" "Ah, yes. Well, I have the intuition, this notion. It haunts me and I feel almost, I don't know, maybe, embarrassed to share it. Or even ashamed--though maybe that is too strong a word. I've tried to discuss it, get a hold, but I." Connie listened as the other woman stuttered, and felt a tug of compassion. She leaned ever so slightly toward her, her eyes widening to lend support to the recitation. A sexual problem per-haps. Everything supposedly out in the open these days, but the unique turns of the human heart, and the struggle to articulate them! She waited. ". this notion, and others don't want to hear, or maybe can't hear. Almost a conviction actually." "A conviction that ." Connie was poised, waiting for the other to look up. "I don't want to offend you, as well. But I suppose it's foolish to come and beat around the bush. You see--" "'I assure you, my dear, I won't be offended. I'm eager to hear what you have to say." "A conviction that it's over. Over, over, over." Connie frowned, noted the slightest wave of impatience with the conversation's turn. "You'll have to tell me what 'it' is, I think." "This." She spread her hands as if her meaning should be obvi-ous, indicating the candle, the lamp, and Connie herself with thrusts of her chin. "Convents. Middle-aged women living in polite little groups, good-hearted, but accommodated. Comfortable. Convents, parlors, single beds, obsessive neatness, vanilla candles. Over." Review for Religious "Leave my candle out of it, at least," Connie said, more emphatically than she had intended. She was offended, but she did not realize it quite yet. "O.K. Your candle may be spared." Marilyn grinned. "But as for the other elements, well, the writing is on the wall." "Nebuchadnezzar? A kingdom about to fall?" Connie tried to get her bearings. The other's hesitancy had disappeared, her voice got stronger by the sentence, and Connie began to think that her earlier, tentative approach might have been a ploy. "Yes. That's exactly right, Connie. The humble kingdom we built for ourselves that did so much good. Children we taught, sick we nursed. It was a world in itself, a kingdom if you will. We had a place in a religiosity that was shared by Catholics every-where. In that Catholic world, we had a mystique of holiness, otherness. We were a cheap labor pool. Now others can do what we did, without living a special way of life." She took deep breath while Connie waited with alarm. "I believe our lifestyle is ending." Buy time. That was Connie's second idea, after the first one, something like, who do you think you are? Who are you, sup-posedly asking me for help, boldly upending a tradition? One that needs no defense. "I must keep eye contact," she thought. "Marilyn, too, is a committed religious, sincere, middle-aged, a seeker like myself." She was unused to such a strong emotion that was not compassion. She focused with effort. "Fall back on tech-nique," she urged herself. When she finally spoke, her voice was light. "Well, that's radical, for sure. Possibly a bit reductive. I'll need some time to take in the idea. But, in any case, you know that spir-itual direction does not provide answers. Why don't you tell me about your prayer. What's happening there?" "Connie, don't you see? That is what's happening. I pray, but I feel afraid. This sense of winding down . . . it, it assaults me. This is the result of my reading the signs of the times. And, very selfishly, I wonder what will happen to us. I'd actually like some-body to refute me." "'Prayer is the balance of mind and heart. Perhaps you think too much." November-December 2000 Moore ¯ A Spiritual Direction "Prayer is the balance of mind and heart. Perhaps you think too much." "Oh, maybe. It's just when I have an insight I always think it's correct. I'm not pious, either." Marilyn's voice had softened. Connie saw that she had heard her words as a correction, as in fact they had been. She had men-tioned fear, a key word in Connie's work, the rope binding the spirit, an adversary of growth. Usually Connie would have asked about it, but this evening it suddenly seemed like too much trou-ble. She was impatient, her back began to ache. She sought for a middle ground. "Or perhaps I think too little. You're a challenge to me, and I'm not sure if I can be as objective as I like. Can you"--she searched for the way back to Marilyn's point--"can you stay with the questions?" She got a little stronger. "Ride the questions." Marilyn thrust out her chin, as if shg regarded the question as an object in the room. There was a pulse of silence. "Yeah. That's a good idea." She smiled and looked at Connie with a glint of humor. "Good luck. I'll pray with you." There was a notable pause, and Connie sighed before turn-ing to topics of lesser import. Her back pain was easing, and she felt relieved that the conversation had returned to a manageable place. She was no coward. She had borne others' tears and rage at God. But a messy squabble with herself as partner was not at all congenial. She had put the balance back. She would pray with and for Marilyn. Both were careful to refrain from gossip in the spiritual-direc-tion setting; the set of those who chose such support was small, and many knew each other. Still, there were allowable facts--some-one's new job, an elderly sister's passing. And, after the intense discussion of the inner life, it was consoling to take in the mellow light and the full attention, each from the other. When they had finished the tea, and the candle wax threatened to spill on the table top, Marilyn moved to go. Connie helped her with her coat, saw her out into the cold air. The street was quieter now and a single star, maybe a planet, winked above the streetlights. She closed the door and went back to her direction room to turn off the light and blow out the candle. The wax had leaked onto the table into a viscous pool. "Ride the question," she repeated softly aloud to herself. She had been pleased to hit upon a phrase Revie~v for Religious that seemed to help her directee, but, as she turned it over in her mind now, looking at the empty room, it sounded trite, facile. The dialogue with Marilyn echoed in her mind, and a sensation rip-pled quickly, like the hint of an unpleasant duty she could not quite remember. She stepped away from the room with unusual haste and headed for the community recreation room and her favorite TV program. When Connie got to the community room, Sarah was watch-ing a public TV program--something about endangered species-- with the intensity of a graduate student. While she made eye contact with Connie, she held up a forefinger to postpone conversation until the program seg-ment ended. Connie sank into the chair and waited. She did not mind. It was more inter-esting to observe Sarah than to watch the parade of facts on the screen. She could easily see in the woman the ardent girl she had taught thirty years before, and, in her unsettled state of mind, that girl seemed to inhabit the room again. Sarah's field was biology, and she brought her expertise along with boundless energy to a nonprofit agency that monitored the environ-ment. Connie studied her with detached affec-tion. What was it that made Sarah so interesting? The combination of ambition and idealism, thought Connie. She was the perfect nun for our time. Connie mused about the effect of her own ministry. She had joined Sarah and the others in the brownstone house the year she finished her term as novice director. It had been her initiative to work free-lance in spiritual direction, and the community con-firmed' her choice. Her clients found her by word of mouth. She spent her day much as she had with the novices, in a disciplined but unhurried rhythm of prayer, study, and client appointments. It was Sarah who persuaded Connie to get a paying job two years ago. Some of the sisters in her own house had argued against it, but Sarah persisted. She pointed out to Connie that she com-plained about being the one to answer telephone solicitations and wait for plumbers. Sarah, the realist, reminded the community that their income base was shrinking, since the elderly sisters far outnumbered the younger wage-earners. Connie began to mind She could see in the woman the ardent girl she had taught thirty years before. November-December 2000 Moore ¯ A Spiritual Direction not having even a modest paycheck to present for the running of the house, and the quota for the retired sisters' care. The only thing she did not tell Sarah and the others was that she was tired of not having tales to "tell at supper about the outside world they inhabited each day. What could she say about spiritual direction? In that field there were no general issues, no little anecdotes, to report, only secrets of the heart whose value was discovered as the directee conferred it. So Connie took a job as the secretary in a little Catholic school in the Bronx. She bolstered the idealistic young man who was prin-cipal and lent an ear to the parents who rushed through with for-gotten lunches and umbrellas. She now had tales for the dinner table with the community, and savored even more the evenings of direction. She did not allow herself to miss the easy pace she had once enjoyed. She was often tired. She worried intermittently about losing weight, especially when Sarah inaugurated a new restric-tion in the community diet. She gave up insisting that they buy whole milk: it was not worth the commentary on cholesterol. But these were small .annoyances, predictable, familiar. If the occa-sional ache or pain pressed itself too deeply into her conscious-ness, her mind might leap to the future for a moment. But the pain subsided, or was integrated into what she chose to put up with. It was against her principles to measure herself by a worldly standard. She gazed at the TV for a bit, savoring the comfort of her (avorite chair until the program finished and Sarah pressed the mute button. "How was your day?" Connie asked. "Really productive," Sarah answered brightly. "I spent the morning editing that junior high 'natural city' curriculum. Jake did a great job with the project and I told him so. Then I had a meeting with the Friends of the Harbor committee. Giuliani's guy stopped in. Nice person actually, said he would continue to press our concerns with the mayor. He sounded sincere, but we'll keep the pressure on anyway. Peter was pleased." "Peter?" "Grossman, the earth sciences professor from Bronx Community College, that one who chairs--" "Oh yes, I remember him." Connie made it a point to keep up with the cast of cha[acters that peopled Sarah's offbeat job. "Did Jake's wife have the baby yet?" Review for Religious "Three days ago! I thought I'd told you. Mother and daugh-ter are doing fine." Sarah described the particulars of the birth in detail, then trained eager eyes on Connie. "How was your day?" Connie's mind returned to her session, where a seasoned nun had suggested that religious life would become a thing of the past. It was an abstract idea, after all. The common room she shared now with Sarah was perfectly real and stable. The house had been paid for. "Connie, your day?" Sarah's voice called her from her reverie. "Anything wrong?" "Wrong? Oh no." She hesitated. "Do you think about the future, Sarah? I mean our community. Do you think there will be nuns living in this house in twenty years? Youngish nuns, enthu-siastic like yourself, women who believe in prayer, the vows? Some of my directees"--she tried to be deliberately vague--"a few think our way of living is a thing of the past." Sarah frowned. "It could be, you know. Let's face it. No one has joined the community at all in the past five years, and those of us in it aren't getting any younger. It could be. But, hey, God our Mother will bring to birth something new. Birth, growth, decay, matter recycle into new growth. It's a universal process. Why should we escape it?" She reached for the TV wand."Do you want to watch anything else?" "You've thought about this?" "Oh, it crosses my mind now and again. Shall I turn this off?." Sarah waved the remote again. "Sure." Connie could see that Sarah was preparing to leave the community room, and a wave of desolation passed over her. She longed to call out, "Please don't go, yet," but she knew perfectly well such a request would startle Sarah. "She'd probably think I'm having some kind of attack," Connie thought. "What reason could I give for the need of her presence?" Nothing came to her. Sarah was at the door now, turning back, her gaze objective and ldnd. "You O.K., Connie?" "I'm just fine," Connie answered quickly. "Sufficient for the day is the trouble thereof." Sarah was satisfied. "Sleep well, then." "You too." Connie was alone now in the familiar room, and hothing could threaten her. Soon her strange moment of panic would pass, and she would move to her usual routine, fold back the newspaper, November-December 2000 Moore ¯ A Spiritual Direction enjoy the silence. She had an honorable job. She loved Sarah, and the others with whom she lived and shared an uncomplicated love of friendship. She scanned the headlines, then tossed them aside to read the Arts page, a book review, but she struggled to concen-trate. "Loneliness has no hold over me," she thought. Loneliness and solitude were the same companion in different dress, the bite of one and the consolation of the other alternating throughout her days. But the mood of release she sought at the end of the day still eluded her. She focused on the gratitude she must render for the events of the day, and recalled a grandmother who had come to the school to deliver a forgotten lunch. In her mind's eye she could see the weary black face transformed with smiles when the child hove into view. But, when the memory dimmed, a keen discomfort reasserted itself. She pushed through her rote evening prayer, "Now Lord you may dismiss your servant in peace, for my eyes have seen your sal-vation. A light of revelation to the Gentiles and a glory for your people Israel." Simeon, welcoming his life's end, having seen the object of his heart's desire. "He was lucky," she thought. The prayer did not seem to help at all. She turned off the light in the common room and made her way out by the light of the street lamp filtering through the blinds. She turned toward the kitchen. "A nice cup of tea," she thought. "It will clear my mind." She made the tea. She measured out her usual two spoonfuls of sugar, tasted it, then furtively added a third. She sipped it slowly and regarded the clock, whose subtle whine could be heard in the silence. "I tell my directees to face their fears. And so must I," Connie concluded. "What was it, then, old age?" But she dismissed this quickly. Maybe prettier, fitter women, yes, even nuns might struggle with this, but she had never known herself that way. She had long ago accommodated herself to aches and wrinkles. Nor was it fear of death. Not yet. Her mother, her aunts, stout women all, had lived into their nineties. "I probably have a few decades in me," she mused. What had Marilyn said? "It's over." That was the phrase that had ripped her, as if a web of equilibrium she hardly knew existed was torn, and its sundering had discovered a category of feeling she could not recognize. "Now, Lord, you may dismiss your servant in peace, because my eyes have seen your salvation." Simeon's words came back Review for Religious again, with the picture of the bearded sage, smiling and content, holding an infant whom he knew certainly to be the savior. Who did he think he was? "I'm jealous of him," she thought. And, since the habit of honesty was well established, Connie began to name the struggle. The child Simeon held had just been named Jesus, newly circumcised, accompanied by proud parents. She was jealous of Simeon's proximity, his luck to be in the right place at the right time. She was envious of the consolation of touch, the embrace that illuminated him, at once revealing the true iden-tity of the child. But most of all she was jealous of his certainty. As a young idealistic woman, and through all the vicissitudes of the years, she had fallen back on the certainty that she was doing God's will. And, just as the meeting with a newborn child had transformed Simeon from a bumbling old man into a prophet, so she had thought her lifestyle would transform her. She looked around the kitchen slowly, scrutinizing the cabi-nets, the fridge. Stalling. The fear she felt was not provoked by the encounter with Marilyn, but rather unmasked by it. Fear, raw fear, as when a young child is lost in a crowded arena. Connie placed both hands on the teacup and concentrated on the warmth that spread to her palms. She recalled, with effort, that she was an adult. But, slowly, understanding came to her. What was threatened was certainty and specialness. The fear in her belly suggested that she had bartered for those goods with the austerity of her lifestyle and her vows. Yet she herself had taught the basic truth of spiri-tual direction so many times: All that is not love must be rooted out. She could not blame anyone or anything external for her new situation. She sat thus at the kitchentable for a long while, and the tea, untouched, grew cold. By and by she simply admitted that an inner battle was just beginning; she might as well go to bed. Fear would come and go, and grief, too, must attend the process. She lay in bed, listening to the faint sounds of traffic, making an effort to yield to sleep in order to be ready for the next day. But, as she was poised on the mysterious shelf before consciousness falls away, a phrase floated up from the well of memory, a saying she would work with for months to come, "Though a bird be tied to earth by only a thread, still he cannot fly." November-December 2000 a witness response DENNIS j. BILLY Contemplative Religious Witness: A Redemptoristine Monastery At the end of each academic year, I leave my work at the Alphonsian Academy in Rome and spend the summer months as an author in residence at Mount St. Alphonsus, the Redemptorist retreat center in Esopus, New York. During my time there, one of the responsibilities I share with the other members of my community is to celebrate Eucharist at the nearby Redemptoristine monastery of Our Mother of Perpetual Help. This small community of contemplative nuns devotes itself to being what their 18th-century Neapolitan foundress, Maria Celeste Crostarosa (1696- 1755), called a "living memory" of the Holy Savior. My close contact with the sisters there has helped me appreciate more deeply the contemplative dimension of my own vocation. It has also helped me see the intimate relationship between the Redemptorist and Redemptoristine callings, two very different lifestyles-- one apostolic, the other contemplative--deeply devoted to a common charism of proclaiming "plentiful redemption" in Christ. Dennis J. Billy CSSR, a frequent contributor to this review, may be addressed at Accademia Alfonsiana; C.P. 2458; 00100 Roma; Italy. R~view for Religious Spousal Love As a community of women entirely dedicated to contemplation, the sisters at Perpetual Help Monastery maintain a spirit of separation but openness to the world around them. They follow the norms of papal enclosure as laid out in church law and interpreted by their Constitutions and Statutes, but do so with a keen sensitivity that their contemplative vocation places them at the very heart of the local church. In the spirit of Vatican Council II, they have also renewed their way of life to be more in keeping with the spirit and charism of their foundress. In doing so, they have attempted to adapt the contemplative life to the exigencies of North American culture while at the same time taking care to maintain the significant countercultural and eschatological witness that religious life in general and the contemplative life in particular seeks to convey. The result is a small but dedicated group of women religious whose lives are deeply immersed in the mystery of Christ and his body, the church. Verbi sponsa, the recent Vatican instruction on contemplative life and the norms of papal enclosure, describes cloistered nuns as becoming, with the Virgin Mary, "the 'living memory' of the church's spousal love" (§1). I could not read these words without thinking of the special meaning they would have for the Redemptoristines at Esopus and throughout the world. Mary's close.relationship to her Son places her in a position of humble service toward all who turn to her. "To Jesus through Mary" was the way St. Alphonsus de Liguori (1696- 1787) liked to express Mary's role in the economy of salvation. Everything she does is meant to lead us to a closer, more intimate relationship with her Son. Her loving and heartfelt fiat in Luke's Gospel reminds us that it could not be otherwise. Her response to the angel reveals a deep trust in God's trust in her. She became the Mother of God because of her spousal relationship with God, which was itself a gift from God to her and, through her, to all the world. When seen in this light, to be with Mary a "living memory of the church's spousal love" leads quite naturally (perhaps it would be better to say "supernaturally") to being a "living memory of the redeeming Christ." Each remembrance is a single dimension of a To be with Mary a "living memory of the church's spousal love". Ly-95---2 November-December 2000 Billy ¯ Contemplative Religious Witness much larger reality: you cannot have one without the other. Keenly aware of this connection, the Redemptoristines at Esopus proclaim their spousal love for their risen Lord at their daily Eucharist, where he eats with them, drinks with them, and caresses them with the gentle, calming breeze of his Spirit. A Eucharistic Community It is often said that something is not fully experienced until it is remembered. If this saying is true, then the Redemptoristines' desire to become a "living memory" of their Lord must foster a deeper experience of Jesus' presence in their hearts and in their midst. One need only consider the deep spirit of prayerfulness that fills their daily celebration of the Eucharist to see that this is so. These simple celebrations tap into the hidden life of contemplation going on in the deepest recesses of their hearts and reveal the height and depth and breadth of the paschal mystery. The daily Eucharist is the center of the sisters' lives. It immerses them in the mystery of God's love which their lives espouse and puts them in intimate contact with their risen Lord. The Eucharist reminds them of the "eucharistic quality" of the cloistered life itself (see Verbi sponsa, §3). Separation from the world enables the sisters to be present t6 the world on a much deeper level. It enables them to share not only in Jesus' life of kenotic self-offering, but also to join him in his eternal act of thanksgiving to the Father. This close connection between the Eucharist and the sisters' contemplative vocation touches the very heart of the redemptive mystery. It affirms Jesus' ongoing presence in their community and gives meaning to every dimension of their largely hidden life of prayer. The sisters' daily remembrance of Jesus is possible only because of Jesus' continual remembrance of them. They seek to be a living memorial to the living memorial he has left them in the Eucharist. They, more than anyone else I have met, take to heart Jesus' words "Do this in memory of me." In this light, life in the Redemptoristine cloister at Esopus takes on the threefold dimensions of banquet, sacrifice, and presence that characterize the mystery of every Eucharistic celebration. Being a "living memo~ry" of Jesus, in other words, means seeking to give nourishment to others (banquet) through a humble offering of self (sacrifice) in the name and in the company of Jesus, who is "Emmanuel, God wi~h us" (presence). The Review for Religious Eucharist, in other words, not only is the summit of their lives, but permeates everything they do. Without it, there is no way they could continue or even survive. From Death to Life I once had the occasion to experience this eucharistic quality of the sisters' lives in a profound and beautiful way. Sister Mary Regina, one of the sisters in the community, was nearing death after a long-drawn-out battle with cancer. This was happening at the very time I had been scheduled to lead the sisters in their annual ten-day retreat. After learning that Regina's death was drawing near, I fully expected the retreat to be canceled (or at least postponed), since the sisters' hearts were heavy with sorrow and their schedule was already overloaded by the "round the clock" attention Regina's condition demanded. I was ~urprised, therefore, to learn that the community wanted the retreat to go on, despite the added strain it would put on them. I was even more surprised (but also delighted) when, on the first day of the retreat, the prioress asked if it would be all right to celebrate Mass in the infirmary so that Regina could attend from her sickbed. That Eucharistturned out to be the last Regina would ever share in--at least on this side of death. The breaking of the bread took on special significance as we celebrated in the presence of one whose life was ebbing away. The nearness of death brought a special solemnity to our celebration. Regina's silence added depth to our words; her gaze, a quiet calm to our troubled, questioning hearts. The knowledge that she would not be with us much longer affected the way we prayed. Everyone in the room seemed to have one eye fixed on the Lord and the other one on her. And that was the way it should have been, the way the Lord himself wanted it. This was Regina's moment. With her community around her, she was free to be herself before her Lord. Firmly fixed on the host, her eyes told us in a quiet, nonverbal way that Jesus was with her in a way he had never been before. So it is, I believe, with all of us at or near the time of death. Each one of us must one day drink from the same cup. Now it was Regina's turn. Separation from the world enables the sisters to be present on a much deeper level. November-December 2000 Billy ¯ Contemplative Religious Witness Near the end of Mass, I looked around the room and experienced that sense of communion that can only come from hearts united by their common yearning for God. As my eyes moved from face to face, I could sense the pain that the community as a whole and each of its members was experiencing as a result of Regina's illness and imminent death. I could also sense the deep love that bound them to each other and, at this special moment, to Regina. In the midst of the sadness, my gratitude deepened and gave way to a deep sense of peace. The Lord was with us, and that was all that mattered. I closed my eyes and imagined myself in the upper room. The Heart of the Church Contemplatives, we are told, live at the very heart of the church. On this day I was grateful for this brief glimpse God had given me into the heart of a contemplative community. There the simple mysteries of life and death are recognized, pondered, and celebrated. There human existence is plumbed to its depths and experienced in all its wonder and heightened fragility. There the restlessness of the human heart forages in the darkness of divine mystery. There God is allowed to be God and is welcomed, however he chooses to come. Very few of us ai'e called to live as contemplatives in the heart of the church. Those who hear the call and respond to it often find that they have been driven to it by the relentless pursuit of a passionate divine Lover. Happiness would elude them anywhere else. Only there, in the cloister, can they give themselves exclusively to God with all their heart, mind, soul, and strength. Their hidden life behind their monastery walls is the visible reminder of what they have left behind--and journeyed into. So essential is it to the good of the whole that it recedes, almost by necessity, to the background of life's numerous surface activities. Like the heart itself, it is never seen, rarely heard, seemingly still, but always pumping. The heart, one might say, is an appropriate metaphor for monastic enclosure itself. Some of the most vital activity in the entire body takes place within the narrow, confining chambers of the heart. These otherwise empty cavities are formed by the inner contours of the heart's muscle fibers. The constant expansion and contraction of these tissues forces the blood through the chambers Review for Religious and creates enough pressure to make it flow throughout the rest of the body. In a similar way the empty spaces within the cloister are visibly shaped by the rules of monastic enclosure which, firm yet flexible, allow the life of the contemplative community to distinguish itself from the rest of Christ's body in order to perform for it a special function. Here the all-important apostolic dimension of the contemplative life comes to light. The contemplative community plumbs the depths of the Spirit so that the life of the Spirit may flow more freely to all the members of the body. Here the law of inverted magnitudes operates in full force. The contemplative community confines itself in time and space in order to open itself up to and move more deeply into the sacred. This simultaneous movement ("juxtaposition," if you will) of contraction and expansion is at the center of the contemplative experience. Although not everyone is called to live a life of monastic enclosure, all of us are called to foster a contemplative attihade toward life. For us to do so, this dynamic .movement of physical withdrawal and spiritual expansion must somehow come into play for each of us. Active and Contehaplative I began these reflections by stating that my contact with the Redemptoristine community at Esopus has given me a deeper appreciation of the contemplative dimension of my vocation as a Redemptorist, missionary. I also like to think that, in some way, the appreciation has been mutual, giving rise in them to a deeper sense of the apostolic dimension of their lives as contemplative religious. We share a single charism which, although expressed in drastically different lifestyles, brings to light the plentiful redemption wrought for us in the passion, death, and resurrection of Jesus Christ. Contemplative religious, we have seen, live in the very heart of the church. The Redemptoristines, to my mind, do much the same for the apostolic mission of the Redemptorist congregation. Both orders, after all, share common origins and embrace the same motto: Copiosa apud eum redemptio ("With him there is plentiful redemption"). To follow the Lord in his work for the poor and most abandoned (as Redemptorists try to do) is closely tied to being a "living memory" of the risen Lord (as the sisters try to be). Each order focuses on a different dimension of the one redemptive mystery and, for this very reason, is intimately related to the other. Noventber-December 2000 My experience at Esopus has taught me that contemplative religious can best contribute to the apostolic mission of the church by simply being themselves and living whatever Rule they follow with patience, humility, and deep compassion. In doing so, they reveal the depth of their humanity and remind us of the intimacy we are all called to share with the divine. The eucharistic quality of their lives enables them to celebrate the present moment-- whatever it may bring--by sharing the gifts of self-offering and sensitive personal presence. Their life of solitude places them at the very heart of the church's life and ongoing mission. Their enclosed life offers the world a countercultural and eschatological sign of what is still to come, yet somehow already mysteriously present in the deepest recesses of the human heart. Like the Redemptoristines at Esopus, contemplative religious are called to lose themselves in the mystery of the divine in order to find themselves in the face of the very next person they meet. They plumb the depths of human experience in order to move more deeply into the sacred and live in intimate spousal union with their divine Lover. All of them are living reminders of the passion, death, and resurrection of Jesus Christ. All are visible expressions of the church's living memory of what took place in the person of Jesus Christ and takes place today in his body, the church. Theirs is a message for all times, all places, and all circumstances. Those who hear it will recognize the need to foster in themselves a contemplative attitude toward life. Those who do not will miss a unique opportunity to peer beneath the surface of life and behold, as never before, the innermost treasures of the human heart. Review for Religious ANDRI~ MAUREEN SOETE A Vowed Response to the Postmodern World Tphosetm choadrearcnte wriostrilcds asryem bpetionmgs s, taunddie rde aalnitdie ps roofb oeudr bsyo -sccailelend-tists, sociologists, anthropologists, philosophers, and theologians. All seek to understand the reality, foresee the consequences, and arrive at some satisfactory description and response. Since I am not a theologian, scientist, philosopher, or any of the above, I do not claim to understand this reality, much less propose responses. What I offer is simply my own response as a woman religious, specifically a School Sister of Notre Dame. The Situation of Our Age Postmodern issues have been touching us and coming into our consciousness for some time now. Our world is rapidly chang-ing, and what we once thought were objective, unchangeable real-ities are in fact changing. The "way to be" and the "way to do" for the present generation seems so different from our way. What can all this mean to SSND sisters and associates at this time? This time of change may feel like a breakdown. The world has become so different that we may not like it and may question Andr,~ Maureen Soete SSND has ministered in Japan for thirteen years. This article is the address she gave to an assembly of Japanese and North American School Sisters of Notre Dame in Kyoto on 9 January 2000. Her address is 11 ol Kawarada-cho; Matsugasaki; Sakyo-ku; Kyoto 606, Japan. November-December 2000 Soete * A Vowed Response the direction in which it is heading. Envisioning ourselves living in this new age, we may have the feeling that we do not fit, for what we understood as reality is being challenged. This is not just the usual generation-gap experience that we have all probably experienced from one side or the other. This phenomenon has been observed by many since the first hints of it in the 1970s and is obviously a real cultural shift. The choices for different lifestyles, the questioning of what we considered permanent values, and the challenges to our thinking are in some ways unnerving. We may catch ourselves longing for the good old days--the secure structures, the way students "used to be," and the way convent life was. It almost tempts us to choose to respond by retreating--by going back. These times are being described by the word chaos. Some of the chaotic things that people observe and study are political, eco-nomic, and social oppression; poverty, starvation, and unemploy-ment; the oppression of women; the ecological crisis; nuclear threat; secularism, materialism, and the failure of churches to renew themselves and inspire belief. Chaos causes a great deal of anxiety, but it also provides us with the moment and the call to rediscover our real story and our deepest roots. How Our Foundress Would Respond As followers of Mother Theresa Gerhardinger, we can ask ourselves how she would manage in this age, how .she would respond if she were alive today. We know that our answer would have something to do with our charism. What is it that she passed on to us that is ageless? What is the changeless essence that will survive these times and even give us the hope we need to go on? When we think of Mother Theresa responding to her time and day we think of a strong woman of prayer, a woman of God, a woman in touch with the reality and needs of her day, a woman animated and energized by the conviction that women can change the world, a woman who knew that, if people can change, the world can cMnge too. But at the root of all these images of her was her sense of God's desire and call "that all be one." She longed for the oneness of all in God. She was a woman willing to strug-gle for unity on every level. She could see unity in diversity, for she believed in the rights of individuals and the respect due to each person. She learned the Review for Religious lessons essential for real unity--lessons of love, respect, appreci-ation, tolerance, and trust--first from her own parents and later from her mentors Bishop Wittmann and Father Job. These were her models, inspiring her to foster the same values among her sis-ters and her society. It was her commitment to unity and her drive "to make one" that gave her tireless energy for mission, and could give us the same tireless energy. The Postmodern Age The academic world has come to use the term "postmodern" in an attempt to name this period of the world's history because this is the period in which people are reacting to all that is false and untrue, all that has not worked in our familiar modern age. In some way the choice of the name "postmodern" is like calling the butterfly a "postcaterpillar." "Postcaterpillar" might be a suitable name during the period when we observe that the caterpillar is no more, that what was once the caterpillar now seems dead or half dead, changing unaccountably. But once we see the beautiful creature with bright wings emerge, flutter freely, and take flight, we find ourselves calling it a "butterfly." Similarly, because of the lack of clarity about the future, schol-ars describe the present reality by noting changes from the earlier condition.When all of the characteristics of this age become clear and show some coherence, it will be time to give the new period a name. The world may not reach that point in our lifetimes, but I hope that all of us want to be a part of the creation of the new name. We can do that by appropriately influencing, shaping, and creating some of the characteristics that will emerge. I suggest that a principal characteristic must be unity. That same oneness that was Christ's mission and Theresa Gerhardinger's mission must be our mission too. Failure of the Modern Age The modern age promised us that by science and technology, by dividing the whole, dissecting and labeling every part, and con-trasting one thing with another, it could understand and solve the problems of our world and probe the depths of reality. It promised that the world would be controlled and developed and perfected, and that human beings would reach great heights. But science November-December 2000 [--~2 ¯ Soete ¯ A Vowed Response Our prosperity and plenty come to us on the backs of the poor and oppressed. itself has had to admit that the mysteries of the world are far beyond such probing; that our scientific advances have actually destroyed much of our world and have led us to live in fear of some scientific developments; that actually, in spite of all of our sci-entific progress, we have missed opportunities to expand and develop our spiritual and human potential and have inst(ad created horrendous human misery. MI of the human misery in the world today is a sign that these former beliefs are not working. When I think of the oppression, poverty, ecological recklessness, uncontrolled materialism, and other problems of our day, I can understand why a new generation rejects our old answers. When I hear dogmatic pronouncements from our churches or from our governments about how things should be and see that those very pronouncements bring about more division than unity and hope alnong peoples, I can understand why some of my own young nieces and nephews reject them as incomplete, irrelevant, without meaning in their lives. It is probably true that there have always been famines, always children abused, always conflicts among religious groups, always people oppressed and exploited and murdered--but we have not always known about them with such immediate clarity. Now, thanks to advances in technology, we do. We are informed immediately about what is happening around the world. And we know now what the prophets and economists have been telling us for a long time, that our prosperity and plenty come to us on the backs of the poor and oppressed. And now the poor and oppressed know that too. We can see all of the "signs of the times" on our nightly news programs. It is up to us to read them carefully, interpret them honestly, and respond accordingly. If society is not organizing itself so as to be inclusive of all citizens, but chooses rather to be exclusive, then the developments in the world around us must sig-nal that we are going in the wrong direction. If our lack of respect for our environment cries out to heaven and to us in its misery, if our land is no longer fertile, our water is befouled, and our air is poisoned--if we really see and recognize this, we must know that we are going in the wrong direction. Review for Religious If our neglect of the poor and downtrodden causes our edu-cation and healthcare systems to fail, and if our competitive cul-tures make the lives of many people miserable, then all of that neglect and competition must be the wrong direction. If the signs tell me that life the way we have thus far organized it is not work-ing, that nothing succeeds, that my actions effect disaster for oth-ers, I am obviously moving in the wrong direction. After recognizing all of this, what do we do? We must make choices in response to these signs. We can choose to be "the tired ones" who give up to let someone else lead the renewal. We can choose to be "the selfish ones" who create only our own security and pleasure. Or we can choose to be "the hopeful ones" who will look for new possibilities for ourselves and for the world. I want us to be the ones who choose to be hopeful. I think we must con-tinue to believe that human beings hold the potential to create a world that works for all peoples. Our Vows as a Response I think that as vowed religious we might bring new dimen-sions to the thinking about solutions to world problems and could radically affect outcomes--not by seeing ourselves as an elite group distanced from our neighbors by some holy and private choices, by mysterious vows of poverty, celibacy, and obedience, but rather by remembering--and letting ourselves be reignited by--the zeal with which I think we all made our first vows. I mean the per-sonal hope that we would change the world for the better, that we ourselves would bring with us the presence of Christ, that by sharing our love, faith, and hope we would make Christ visible and bring all the world to oneness in God. What happened to that most wonderful zeal and enthusiasm? I think that we religious need to ponder deeply the meaning of our vows and the witness our lives can give, must give, in con-trast to various trends and news events. I think of instances of environmental pollution, of trials for war crimes, of the terroriz-ing of ethnic and religious groups, and of the mother of a young child who could kill another woman's little girl. We seek to be effective in demonstrating hope and bringing it into our world. In a world where millions (including helpless children) suf-fer from the lack of such essentials as food, clothing, shelter, medicine, and education; in a world where people use their wealth November-December 2000 Soete ¯ A Vowed Response to produce more wealth so that they can live in a style that uses up the goods of the earth; in a world where people want more and more and give less and less to the laborers who produce the goods; in a world full of people who throw away and waste without even a thought--in such a world I have promised, we have promised, to use only what we need and to share everything we have. Are we keeping that promise? Would anyone who looks at us, our lifestyles, or our closets notice our choiceto do with less and our willingness to share? Would they be edified, stand in awe of the way that we are keeping our promise? In a world where groups of human beings look upon other groups as lower and with great intolerance seek to get rid of them; in a world where "ethnic cleansing," ways of death, become a way of life for some; in a world where nationalism means that free-dom to be intolerant of the differences of other races or peoples-- in such a world I have promised, we have promised, to love inclusively and to take on Jesus' own reverence and concern for all people, excluding no one. Are we keeping that promise? Would anyone who looks at us, at our way of being with the people with whom we live, at our way of being with the people at our place of ministry, notice our love, tolerance, and respect? Would they be edified and stand in awe of the way we are keeping our promise? In a world where the strong and influential make decisions for the weak; in a world where whole groups of people are not consulted about matters that affect vital areas of their lives; in a world where people are murdered because they disagree--in such a world I have promised, we have promised, to search for God's will and the right direction through dialogue and conversation, con-sultation and collaboration with all concerned. Are we keeping that promise? Would anyone who watches how we lead or partic-ipate in groups of students or teachers or coworkers notice our collaborative style or the way we listen to every person? Wotild they be edified and stand in awe of the way we are keeping our promise? What Then? I have spoken about our vows, emphasizing them as three promises because the term "vows" can sometimes be spiritualized and focused only on our commitment to God. In thinking about them as promises, I had a sense of a great possibility. I began to see Review for Religious that what we promise is more like a radical way that all human beings need to choose if we are to create a world where all people can live with dignity. I Wonder what might happen if we shared these choices of ours more openly among ourselves and witnessed to them more radically with our associates and with our partners in ministry. I am not so sure of our next step. I am not so sure how this small core of friends and others like us might have a good impact on our society and our world. But I think that somehow we can--and I challenge ourselves and others to come alive with that potential. "Striving for Unity" is our charism. We are supposed to be masters of it by now. Why, in our Japan Region alone, if we add up all of our years of religious life, we have more than three thousand years of our SSND lifestyle! I hope that we and others may gather together everyone's good insights and with them create for ourselves an exciting and real-istic dream as we step forward with God into this third millennium. Many of us will probably not be around when the next era gets its name, but--just as we prefer the word "butterfly" to "postcaterpillar" when thinking of the little creature's potential--would we not want the concepts of oneness, tolerance, collaboration, acceptance, and respect to be part of the name given to the next era? Are there initiatives for us to take, or can we at least support and encourage the wonderful people around us who are already dedicating their lives to this conversion and transformation of the earth? Is this not what we want to use our energy and ingenuity for? Is this not a way that we could use our positions as educa-tors and as ministers? Is this not worth the offering of the rest of our lives? We have promised to use only what we need. Are we keeping that promise? November-Decen~ber 2000 LAWRENCE F. BARMANN Mary Ward: Centuries Her Scroll examples from the past Today, amid questions about effective evangelization in the 21st century, about leadership and ~uthority in the Catholic Church, and about women's fuller participa-tion in these efforts and echelons, there is much that can and should be learned from Mary Ward at long last. During her lifetime four hundred years ago, she experi-enced much suffering and failure, but her full contribu-tion to the church and the world seems now to be only beginning. For religious in the United States and else-where who may know little or nothing of this extraor-dinary woman, I hope this article may provide a brief but warm introduction. The recent book I will be draw-ing from and citing is an excellent place to make fur-ther acquaintance with her goodness and truth. I refer to Mary Ward: Pilgrim and Mystic by Margaret Mary Littlehales IBVM) Mary Ward was an English gentlewoman, well-con-nected by birth, and related to many of those who were executed for their part in the ill-conceived Gun Powder Plot of 1605. She was born in Yorkshire in 1585, three years before the defeat of the Spanish Armada and four- Lawrence E Barmann is a professor of American studies and theological studies at Saint Louis Univ, ersity. His address is Humanities Building; 3800 Lindell Boulevard; St. Louis, Missouri 63108. Review for Religious teen years after Pope Pius V's bull Regnans in excelsis made techni-cal traitors out of all English Catholics who claimed allegiance to the pope by inviting them to dethrone Queen Elizabeth. So mar-tyrdom for the faith, or at least willingly accepted hardship for the ability to practice it, became the very atmosphere in which Mary Ward grew to adulthood. Such an atmosphere is often inducive to quick spiritual maturity, and in Mary Ward's case it certainly was. By the time she was sixteen, Mary Ward had developed a strong prayer life and the conviction that God intended her for the religious state in some form. Her parents thought otherwise, and Edmund Neville, heir to the earldom of Westmoreland, became her suitor. After Mary had gently rejected him, Neville became a Jesuit; and at twenty-one she persuaded her father to allow her to go to the continent to try her vocation to religious life. In 1606 Mary arrived at SaintoOmer in the Spanish Netherlands (now northern France), where English Catholics escaping persecution in their homeland had been migrating for decades. Through the advice of misguided confessors, she entered a Poor Clare convent, only to realize within a year that this was not where God intended her to be. In 1609 she returned briefly to England, where she seems to have gained some light about God's choice for her. Upon returning to Saint-Omer with a small group of English women about her own age, she set about doing for women's education what the Jesuits were doing for boys among the emigr~s. She called her community the Institute of the Blessed Virgin Mary, and her specific intention was "to train English girls from Catholic families to be wives and mothers or religious, but all to be apostles for the faith in England." She was convinced that women were quite as capable of edu-cation as men, though she thought they did not need precisely the same courses. For Greek and Hebrew she substituted modern lan-guages, and for physical training, dancing. Moreover, she set about having her own followers trained to teach such things. In the patri-archal world and church of the 17th century, this was considered wildly innovative and thus suspect; and so the church authorities, who alone could approve her work as a religious institute, were to make Mary pay dearly for such innovation. Once, in 1617, after hearing a Jesuit priest comment on the work of her schools that, "when all is done, they are but women," Mary remarked calmly but with conviction: "There is no such dif- November-Decen~ber 2000 Barmann ¯ Mary Ward ference between men and women that women may not do great things . And I hope in time to come it will be seen that women will do much . What think you of this word 'but women'? but as if we were in all things inferior to some other creature which I suppose to be man." Mary Ward's convictions about this and much else were drawn not primarily from books and debates, but from her intense relationship with God and from his grace working through her wonderfully balanced and prophetic personality. As the schools grew and young women increasingly wished to join Mary Ward's community, she needed to settle on some rule of life. By 1611 already about forty women had cast their lots with hers. Both the local bishop and her confessor tried to force her to adopt either the Augustinian, Benedictine, Franciscan, or Carmelite rules. To these urgings she could only respond that "they seemed not that which God would have." These "English Ladies," as they were now commonly called by their supporters (or "Jesuitesses," by their detractors), could not have adopted any of those earlier rules for women and continue to do the work to which they were called; all four rules as they were applied to women in those days required canonical enclosure. Finally Mary Ward had her answer, and it was to lead to incredible suffering for the remainder of her life. To the papal nuncio in Cologne, Monsignor Albergati, she explained: About this time, in the year 1611, being alone in some extraordinary repose of mind, I heard distinctly not by sound of voice, but intellectually understood, these words: "Take the same of the Society"; so understood as that we were to take the same both in matter and manner, that only excepted which God by diversity of sex hath prohibited. These few words gave so great a light in that particular institute, comfort and strength, and changed so the whole soul as that it was impos-sible for me to doubt, but that they came from Him whose words are works. Mary Ward's conviction that God intended her to adopt the Jesuit Rule to her institute of religious women and to do her spe-cial work in the world rather than in a cloister was what 17th-cen-tury western Europe obviously needed if it were to remain at all Catholic. But it was a conviction far in advance of the convictions of most of the male authorities in post-Reformation Rome. Furthermore, the Jesuits had managed to incur the jealous wrath of the secular clergy in England, and these latter pursued Mary with calumnious accusations simply because she intended to estab-lish a female religious congregation based on Jesuit principles. Review for Religious These calumnies found a ready hearing in Rome. The Jesuits them-selves were ambivalent about her institute, sometimes being extremely helpful and sometimes joining the enemy. In 1622 Mary Ward finally met the Jesuit general, Mutius Vitelleschi, who was deeply and permanently impressed by her. Henceforth the Jesuit general would instruct his men to be supportive of Mary's work and gracious to her, short of such involvement as might lead to a sort of second order--something St. Ignatius Loyola had strictly for-bidden. Meanwhile Mary's institute had established schools not only in Saint-Omer, but in Liege and Rome, and would soon have houses in Naples, Perugia, Munich, Vienna, Pressburg, and elsewhere. Mary herself, always of delicate physical constitution, went back and forth across the Alps, mostly on foot, frequently in winter and in the midst of the Thirty Years War, in order to strengthen and encourage her followers; while at the same time she worked tirelessly to gain the necessary support of bishops, the Roman curia, and the pope, for the approval of her institute. The number of high-placed clerics who opposed her for reasons that had nothing to do with reli-gion, or even good sense, always outnumbered those who sup-ported her. The bishop of Vienna, for instance, wrote to Rome in 1628 to complain that the English Ladies had opened a school there without his peymission (though they had the emperor's per-mission and he had even given them a house and funds) and that the girls in Mary Ward's school had actually performed publicly in a comic school play! With the Catholic religion collapsing in central Europe, a bishop's jealousy of his rights against the only Catholic ruler of any weight in the region would ultimately prevent the Catholic education of young women in the empire. Of popes with whom Mary had to deal, Urban VIII, who would condemn Galileo at Mary Ward's conviction that God intended her to adopt the Jesuit Rule to her institute of religious women was what 17th-century western Europe obviously needed if it were to remain Catholic. November-December 2000 Barmann ¯ Mar~ Ward about the same time that he condemned Mary Ward, was the most duplicitous. She first had an audience with Urban in 1624, in which she pleaded for approval of her institute and in which Urban smiled and smiled and totally misled her about his intentions. Eventually he ordered the suppression of all of her houses and the dissolution of her institute, and this merely on the basis of English clerical calumnies and calumnies spawned by the hurt pride of ambitious continental clerics. Mary herself was eventually imprisoned as a heretic in a Poor Clare convent in Munich, by order of the Roman Inquisition. There she nearly died, though she so impressed the resident Poor Clares that they knew she was anything but a heretic. Meanwhile, her followers were being systematically driven from their houses and were mostly on the verge of starvation. Having at length been released from prison, Mary set out at the end of 1631 for Rome in order to clear her good name for the sake of what she hoped might be the future of her institute. Kneeling at Urban's feet she burst out, "Holy Father, I am not nor ever have been a heretic." At which the pope interrupted, "We believe it, we believe it; we need no other proof." He also allowed the institute to continue (under private vows) in Rome and under his protection. In 1637 Mary Ward set out again for England, though it would be May of 1639 before she actually got there. She sought a letter from Pope Urban to give to Queen Henrietta Maria to gain the queen's support for her institute. The letter Mary received speaks of her as "one much esteemed in Rome both for her well-known qualities and piety, which will without doubt cause Your Majesty to see and hear her." This was the same Rome which, only half a dozen years earlier, had imprisoned her as a heretic and decreed the destruction of her life's work. The queen did receive Mary gra-ciously, but within a year the country would be in the throes of political ttirmoil that would end in civil war and the execution of the king. Without completely abandoning her hope of establishing a school in London, Mary went north to Yorkshire in 1642, and there she died at Osbaldwick, a short distance from the city of York, on 20 January (old style) 1645. After her death Mary Ward's institute did in fact flourish, and finally, in 1977, after a wait of 366 years, the Institute of the Blessed Virgin Mary was able to realize Mary Ward's original insight and founder's charism by adopting the Jesuit Constitutions, and with the blessing of the Jesuit general, Pedro Arrupe. Margaret Mary Review for Religious Littlehales's study of Mary's Ward's life reveals many things. It reveals the costliness, but also the great happiness, of completely abandoning oneself to God. It also demonstrates that, within the external church structure, official authority can be quite wrong, but probably less so in proportion to the genuine humility of its wielders. Mary Ward's life demonstrates incontrovertibly that God's intended purposes are often achieved through the near annihilation of the human instruments of that achievement. Christians should not be surprised by this, for such was the case with God's own Son. Contemporary religious, both men and women, can find great encouragement and inspiration in the life of this saintly English woman. Dorothy Day did, and she even titled her own autobiog-raphy with a remark Mary Ward once made as she pondered what lay ahead of her as a young woman bent on seeking only God's will--"the long loneliness." Note 1 Margaret Mary Littlehales, Mary Ward, Pilgrim and Mystic, 1~8Y- 164~ (Tunbridge Wells, England: Burns and Oates, 1998). Pp. 272. £18.95. Patrimony my patrimony is a deity unknown whose name I cannot pronounce communicated to me in stuttering speech, in fits of temper and in weeping, in so many questions unleavened by answers in silence and in absence by those struck dumb and those afraid to speak Sefin Kinsella November-December 2000 STAN PARMISANO St. Catherine's Letters: Human Love, Gracious Authority One level of St. Catherine of Siena, perhaps her deepest, is revealed in her Dialogue.' But this great work, whether in the original or in proper translation, is strange fare for many mod-ern readers. Its subject matter--mystical union with the Trinity in and through Christ--is high and heavy and, I should think, attractive only to the relatively few seriously intent upon such union. Its language often includes words and phrases borrowed from the scholastic theology of the day, though Catherine's orig-inal genius keeps breaking through, giving new form to old mat-ter. The book is also rife with personification and allegory (Christ the Bridge, the Tree of Life, Vineyard of the Soul, and so forth)-- fun for the medieval reader, but dry and tedious for today's read-ership. Also, in the Dialogue Catherine is quite formal and impersonal. The lively, dynamic personality recorded in history is certainly there, but it has to be searched out, for it is hidden in the shadow of the great Truth she labors to expound. She herself is merely un'anirna in the mighty presence of her God. Her letters are a different matter.2 They are personal--writ-ten not by an anonymous "soul," but by the flesh-and-blood Catherine. Io Caterina rings throughout, addressed not to people in general, but to here-and-now individuals. The letters evoke wide and popular interest. They deal with Catherine's own life Stan Parmisano OP wrote about theology and faith in our September- October issue. His address remains Saint Albert's Priory; 5890 Birch Court; Oakland, California 94618. Revie'a, for Religiou, and visible experiences and with details about life around her, social and political as well as spiritual. Their language is not borrowed from or freighted with outmoded rhetorical devices, but is pleas-ingly spontaneous and informal, as alive today as in Catherine's own time. On the whole the letters are original. They are Catherine, in every vibrant word and phrase--simple, nuanced, various, alive with passion for the truth, and the truth in particu-lar situations. They are "unliterary," to be sure, for they were talked, not written, by our unlettered saint, but they are clear and coherent, direct and firm, though also tactful. Catherine sometimes digresses, loses the train of her thought, but she never really rambles on or gossips. She has little time for light conversation ("Let us run, let us run, for the time is short!"), and her central point is almost always clear and precise. Though each of her letters is unique, many of them fall into a common pattern. They begin with Jesus, and with Catherine as the slave of the servants of God--never, for Catherine, a mere pious formula, but always freshly genuine. Then she often seems to lose herself in the contemplation and exposition of one of the mysteries of faith, which, however, turns out to be pertinent to the subject of the letter. Soon she comes to the question at issue, and, if in the initial paragraphs she was high and spiritual, peacefully contemplative, now she is very much the active apostle dealing practically and in detail with earthy mat-ters. She ends with statements of love and concern for her corre-spondent, placing all in the hands of God: "Bathe you in the blood of Christ crucified. Sweet Jesus, Jesus Love." The letters reveal the breadth as well as depth of Catherine's concerns, and her marvelous ability to adapt, with no compromise of ideal, to various situations and personalities. To a little niece she writes in gentle, childlike simplicity about the wise and foolish virgins in the Gospel and the lamps they bear: "Do you know what this means, my daughter? By the lamp is meant our heart, because a heart ought to be like a lamp. You see that a lamp is wide above and narrow below, and so the heart is made to signify that we ought always to keep it wide above through holy thoughts and holy imaginations and continual prayer; always holding in mem-ory the blessing of the Blood by which we are bought . I said . simple, nuanced, various, alive with passion for the truth, and the truth in particular situations. November-December 2000 Parmisano ¯ St. Catherine's Letters that a lamp is narrow below, and so is our heart: to signify that the heart ought to be narrow toward these earthly things--that is, it must not desire or love them extravagantly, nor hunger for more than God wills to give us" (letter no. 23). To Alessa, as to other of her women disciples, she sends prac-tical advice about the religious life, which is to be lived "both with and without moderation . For love toward God should be with-out measure, and that for creatures should be measured by that for God, and not by measure of one's own consolations, whether spiritual or temporal." And how manage this? "Make two homes for yourself, my daughter: one actual home in your cell, that you go not running about into many places, unless for necessity, or for obe-dience to the prioress, or for charity's sake; and another spiritual home, which you are to carry with you always." This last, she con-tinues, is "the cell of true self-knowledge," embracing both the knowledge of God and the knowledge of self, "two cells in one. ¯ and when abiding in the one you must abide in the other, for oth-erwise the soul would fall into either confusion or presumption. For, if you rested in the knowledge of yourself, confusion of mind would fall upon you; and, if you dwelt in the knowledge of God alone, you would fall into presumption" (no. 49). Still within the uncompromising truth and love of Jesus, but with some relevant adaptation, she writes in a much different vein to Sir John Hawkwood, the English soldier of fortune who was the scourge of the Italian city-states. She begs him to leave "the service and pay of the devil., and take the pay and the cross of Christ crucified." He is a soldier; let him remain such, but let him now become Christ's knight: "I beg you, then, gently in Christ Jesus, that, since God and also our Holy Father have ordered a crusade against the infidels and [since] you take such pleasure in war and fighting, you should not make war against Christians any-more-- for that is wrong to God; but go against the infidels. For it is a great cruelty that we who are Christians, and members bound in the body of Holy Church, should persecute one another." And she concludes abruptly but quite aptly with a subtle undertone of warning against his soldiering altogether: "I beg you, dearest brother, to keep in memory the shortness of your time." Her final words are as usual: "Remain in the holy and sweet grace of God. Sweet Jesus, Jesus Love" (140). To that formidable woman of the world Queen Joanna of Naples, who first sided with Clement, then Urban, then with Review for Religious Clement again in their rival claims on the papacy, Catherine writes in a similar manner, but with deeper sorrow and fiercer passion: "Dearest Mother--mother, I say, insofar as I see you to be a faith-ful daughter of Holy Church--it seems to me that you have no mercy on yourself. Ah me! because I love you I grieve over the evil state of your soul and body. I would willingly lay down my life to prevent this cruelty. Many times I have written to you in compassion, showing you that what is shown you for the truth is a lie; and the rod of divine justice., is ready for you if you do not flee so great a wrong. It is a human thing to sin, but perseverance in sin is a thing of the devil . Be merciful, ah, be merciful to yourself]. I say no more to you. Remain in the holy sweet grace of God. Sweet Jesus, Jesus Love" (348). She writes differently to Gregory xI than at a later date she would write to Urban vI. Gregory was weak and vacillating, and so in her letters to hi~n she exhorts him to be "manly" and firm in his high office of supreme pontiff: "Be manly in my sight, and not timorous . I, Catherine. write you in his precious Blood, desiring to see you a manly man (uomo virile) without any servile fear." And, when Gregory hesitates in his resolve to return to Rome for fear of being poisoned there, Catherine reminds him that there are other, more terrible kinds of poison; and at any rate there's as much poison "on the tables of Avignon . as on those of Rome!" (229, 239). Urban, on the other hand, from the start of his pontificate was already betraying that spirit of anger and vindictiveness that would end in personal revenge, violence, and mt~rder. One had written to Catherine after the election of Urban: "It seems that our new Christ is a terrible man." In her first letter to him, Catherine appears to be aware of this and shapes her words accordingly: "Next I beg you, and constrain you by the love of Christ crucified, as to those sheep who have left the fold--I believe for my sins-- that, by love of that Blood of which you are made minister, you delay not to receive them in mercy, and with your benignity and holiness force their hardness; give them the good of bringing them back to the fold, and, if they do not ask it in true and perfect humility, let Your Holiness supply for their imperfection. Receive from a sick man what he can give you" (291). Religious life is to be lived "both with and without moderation." November-December 2000 Parmisano * "St. Catherine's Letters She writes to William Flete and other hermits at Laceto a gem of a letter begging them to leave for a time the peace and quiet of their forest retreat and come to Rome on pilgrimage in support of Urban. She desires them so to lose themselves as to seek "nor peace nor quiet elsewhere than in Christ crucified." If out of piety they are loath to leave their solitary life, they must know that there are woods and forests aplenty in and around Rome! (326). To Raymond of Capua, her Dominican soul brother and dearest friend, she writes in every which way: tenderly, pas-sionately, in joy, in anger; now as a scolding mother, now as his obedient daughter, now reproving him for cowardice and want of faith, now exposing her own weakness and want of love. And, often uncomfortably for Raymond, always she wants him together with herself to die a martyr: "I tell you, sweetest Father, that, whether we will or no, the time we are living in enjoins us to die, so do not live any longer." (333). Catherine's Human Love This last suggests one of two facets of Catherine's personality that may prove especially problematic for the modern reader of her letters, namely, the quality of her human love. The spontane-ity, passion, naturalness, and totality of her love for the Person of Christ is beyond question: she is quite literally consumed, body and soul, with love for Him, who is mad (pazzo), drunk (ebro) with love for her. But, when it comes to lesser*folk, her native inclina-tions seem to be oversupernaturalized, and her love may appear forced and lacking in the milk of human tenderness and warmth and understanding. This would explain the extreme discomfort she experiences when ordered by the Lord to leave her solitary life and give to others the same love that she gave to

Issue 46.1 of the Review for Religious, January/February 1987. ; R~.\'~l~w ~oR R~.~;iotJs ( ISSN 0034-639X), published every two months, is edited in collaboration wflh faculty members of St. Louis University's Department of Theological Studies. The editorial offices are located at 3601 Lindell Blvd., Room 428; St. Louis, MO 63108-3393. R~.:w~.w FOR R~,~;Iou.~ is owned by the Missouri Province Educational Institute of the Society of Jesus, St. Louis, MO © 1987 by R~-:vw:w ~.'OR R~-:~.~t;n)tJs. Composed, printed and manufactured in U.S.A. Second class postage paid at St. Louis, MO. Single copies: $2.50. Subscription: U.S.A. $11.00 a year; $20.00 for two years. Other countries: add $4.00 per year(surface mail). Airmail(Book Rate): $18.00 per 3'ear. For subscription orders or change of address, write: R~:\'~r:\v ~'t)a REl.~;IOtlS: P.O. Box 6070; Duluth, MN 55806. Daniel F.X. Meenan, S.J. Dolores Greeley, R.S.M. Iris Ann Ledden, S.SoN.D. Richard A. Hill, S.J. Jean Read Editor Associate Editor Review Editor Contributing Editor Assistant Editor Jan./ Feb., 1987 Volume 46 Number I Manuscripts, books for review and correspondence with the editor should be sent to Rl.:VlEW FOR R~:l,lc.mt;s: Room 428; 3601 Lindell Blvd., St. Louis, MO 63108-3393. Correspondence about the department "Canonical Counsel" should be addressed to Richard A. Hill, S.J.; J.S.T.B.; 1735 LeRoy Ave., Berkeley, CA 94709. Back issues and reprints should be ordered from REv~:w you R~:~,w.~ot~s: Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108-3393. "Out of print" issues and articles not published as reprints are available from University Microfilms International; 300 N. Zeeb Rd.; Ann Arbor, MI 48106. A major portion of each issue is also available on cassette recordings as a service for the visually impaired. Write to the Xavier Society for the Blind; 154 East 23rd Street; New York, NY 10010. Review for Religious Volume 46, 1987 Editorial Offices 3601 Lindell Boulevard, Room 428 Saint Louis, Missouri 63108-3393 Daniel F.X. Meenan, S.J. Dolores Greeley, R.S.M. Iris Ann Ledden, S.S.N.D. Richard A. Hill, S.J. Jean Read Editor Associate Editor Review Editor Contributing Editor Assistant Editor REVIEW FOR RELIGIOUS is published in January, March, May, July, September, and November on the twentieth of the month. It is indexed in the Catholic' Periodical and Literature Index and in Book Review Index. A microfilm edition of REVIEW FOR RELIGIOUS is available from University Microfilms International; Ann Arbor, Michigan 48106. Copyright © 1987 by REVIEW FOR RELIGIOUS. A major portion of each issue of REVIEW FOR RELIGIOUS is also regularly available on cassette recordings as a service for the visually impaired. Write to the Xavier Society for the Blind; 154 East.23rd Street; New York, NY 10010. Christ: the Heart and Soul of Vocation John R. Quinn On October 4, Feast of St. Francis of Assisi, Archbishop Quinn addressed the fol-lowing homily in the course of a Eucharist celebrated for religious of San Francisco. It provides a fitting celebration of the conclusion of his commission's work. Archbishop Quinn may be addressed at: Office of the Archbishop; 445 Church Street; San Francisco, California 94114-1799. One week from today I will arrive in Rome. A few days later I will present to the Holy Father the final report of the Pontifical Commission on religious life in the United States. One of the tasks assigned to the Pontifical Commission was to under-take a study of the reasons why young people do not enter religious life in greater numbers. It was a long and exacting study involving a large number of priests, religious and lay people. Clearly, it is excessive to believe that any one single cause can explain the phenomenon of the decline in vocations. Just as obvious is the fact that there are causes internal to the life of the Church as well as causes which touch all of human society. Yet there is one striking factor in the decline of vocations which emerged in our study and it seems to me very fitting to touch on it in the context of this Feast of St. Francis. One of the first things that comes to mind when we think of St. Francis is poverty. Poverty was to be one of the hallmarks of his sanctity. But what was the meaning of that poverty for Francis? Was it a protest against the excesses of the rich? A statement about social justice? A wit-ness of solidarity with the oppressed? There may have been some of these factors, of course. But the overwhelming and consuming reason for the poverty of 3 4/Review for Religious, Jan.-Feb., 1987 Francis was his love for Christ Jesus our Lord. His poverty was a power-ful witness that those things I used to consider gain I have now reappraised as loss in the light of Christ. I have come to rate all as loss in the light of the surpassing knowledge of my Lord Jesus Christ. For his sake, I have for-feited everything; I have accounted all else rubbish so that Christ may be my wealth and I may be in him . I wish to know Christ and the power flowing from his resurrection; likewise to know how to share in his sufferings by being formed into the pattern of his death" (Ph 3:7- 10). For Francis, poverty was his witness to the centrality and Lordship of Christ. In our study of the decline in vocations, we did not hear much about poverty. But we did learn that if we want to attract vocations, the reli-gious dimension of our lives must be unambiguous, and that religious must be more willing to share that dimension than they have been. It is not that American religious are not contemplative and spiritual men and women. They are, and our study shows that they are increas-ingly so. Yet Americans are somewhat inclined to regard religion as a private, interior affair not to be discussed. And this is the weakness. The rich treasure of our relationship with Christ and his meaning for us has to come out more. The story needs telling. But how can we tell the story of a relationship we do not have? And so the contemplative dimension of our lives is the foundation of every-thing else. It is the contemplative dimension that makes it possible for the religious to say to Christ what the lover said in Christopher Fry's play: "Everything I loved before has come to one meeting place in you. And you have gone out into everything I love." So deep was this reality in Francis that he spent whole nights repeat-ing the simple prayer,,,"My God and my all!" When we look at the per-vasive contemplative dimension of Francis' life, it is significant to recall that there are few saints who have had a more universal impact in all cul-tures, an impact that is strong and enduring even today. We need not fear that the contemplative dimension of our lives will reduce the effectiveness of our witness for justice or our service to the world. It will only enhance it. Think of the human service given by Francis himself, but think of the tremendous inspiration he has been for justice and peace through seven centuries. That inspiration cannot be sep-arated from his holiness, and his holiness is rooted in his union with Christ. The path of discipleship is perfectly articulated in a few brief words: Christ: The Heart and Soul "Those whom he foreknew he predestined to share the image of his Son" (Rm 8:29). Francis showed that one and only path of discipleship when he grew into the mystery of the Cross. Fittingly the Church brings to mind on his feast the words, "May I never boast of anything but the cross of our Lord Jesus Christ" (Ga 6:14). Without the Cross it is impossible to "share the image of his Son" who freely chose the Cross for himself as a witness of love and obedi-ence, as a witness of poverty and humility. Without the Cross there is no discipleship. But we should not forget that without the Cross there is no vision, no understanding. The Cross is the key to understanding the Church and human history. How can one learn the difficult grammar of the Cross without years of persevering and serious prayer? Thoreau, when asked why he was living in the wilderness, answered: "I do not want to come to my death and dis-cover that I have never lived." At death we will discover we have never lived the Christian life unless we have learned through the contemplative dimension to love and understand the mystery of the Cross. But what is this Cross for us? It is not wood. It is persons, places, circumstances, situations. Just as for the Lord, so for us, the Cross is what is absurd, ridiculous, frustrating, the unexplainable. The Cross is when we are powerless: no matter what we do, it makes no difference. The Cross is pain, it is loneliness, it is lack of support. It is confusion, uncertainty. But the Cross is also death -- it is letting go. It is surrendering every-thing into the Father's hands, and knowing that he will be glorified in us and in Christ Jesus. This mystery of the Cross we suffer both in the Church and in the world. We suffer before the tensions and divisions in the Church. We suffer before the massive and overwhelming injustices in the world. But in the midst of the Church and in the midst of that world, reli-gious are called to be the bearers of hope because they have lived and understood the Mystery of the Cross, and have personally discovered that the message of the Cross is complete absurdity to those who are headed for ruin, but to us who are experiencing salvation it is the power of God . Yes, Jews demand "signs" and Greeks look for "wisdom," but we preach Christ crucified. Christ the power of God and the wisdom of God (I Co 1:18; 22-25). It is the serious, prayerful contemplation of the Mystery of the Cross that yields the kind of love which is "patient; love [which] is kind., love [which] is never rude, [which] is not self-seeking, [which] is not prone to anger" (1 Co 13). It is this contemplative dimension which makes it Review for Religious, Jan.-Feb., 1987 possible to say that "there is no limit to love's forbearance, to its trust, its hope, its power to endure" (ibid). And so it is this contemplative dimension that imparts the vision of the Church described by Gregory the Great some thirteen centuries ago: Because the daybreak or dawn changes gradually from darkness into light, the Church. is fittingly called daybreak or dawn. While she is being led from the night of infidelity to the light of faith, she is opened gradually to the splendor of heavenly brightness, just as dawn yields to the day after darkness. The Song of Songs says aptly: "Who is she who moves forward like the advancing dawn?" Holy Church, inasmuch as she keeps searching for the rewards of eternal life, has been called the dawn . The dawn intimates that the night is over; it does not yet pro-claim the full light of day . While it dispels the darkness and wel-comes the light, it holds both of them, the one mixed with th6 other. Are not all of us who follow the truth in this life daybreak and dawn? While we dp some things which already belong to the light, we are not free from the remnants of darkness. And so to Christ Jesus, crucified in weakness but risen in power, be glory in us and in the Church now and forever. Amen. From Tablet to Heart: Internalizing New Constitutions I and I! Address: by Patricia Spillane, M.S.C. Price: $1.25 per copy, plus postage. Review for Religious Rm 428 3601 Lindell Blvd. St. Louis, Missouri 63108 "1 Have Called You Friends": The Priest Today John Paul H On July 5, 1986, Pope John Paul ordained ninety-two men to the priesthood in Medellin, Colombia. In the eucharistic celebration, the theme of which was "Fidelity to the Priestly Vocation," the Pope offered the following reflections. This article is based on the text which appeared in L'Osservatore Romano (18 August, 1986, pp. 4-5). Beloved brothers in the priesthood of Christ: "No longer do I call you servants., but I have called you friends, for all that I have heard from my Father I have made known to you" (Jn 15:15). During the celebration of the Last Supper Jesus addressed these words to the apostles as he instituted the sacrament of his body and blood and charged them: "Do this in memory of me" (Lk 22:19). These words are linked in a most particular way with the priestly voca-tion. Christ makes the apostles priests, entrusting into their hands the sacrament of his body and blood. That body which will be offered upon the cross, that blood which will be shed (now under the species of bread and wine), constitute the memorial of the sacrifice of the Cross of Christ. In the Upper Room, Jesus calls his apostles friends because he has given them his body and blood. From that moment on, sacramentally real-izing this sacrifice, they were to work in his name, representing him per-sonally, in persona Christi. In this consists the essential greatness of the ministerial priesthood -- in which, today, you, sons of the Church of Colombia, of the Church of Medellin, will be made participants through the Sacrament of Orders. It is a very important day in your lives and in the life of this Church which, on this occasion, I wish to greet cordially. 7 Review for Religious, Jan.-Feb., 1987 I affectionately greet the Christian people that has assembled this evening. The Christian nobility of your families -- nurseries for priestly and religious vocations -- and their deep adherence to the Church have been the characteristics of this beloved region of Colombia. The Priest's Vocation Is God's Initiative Today's liturgy indicates to us in a particularly profound way the truth about the priestly vocation. A vocation is first of all an initiative of God himself. God continuously calls individuals to the priesthood, just as in the past he called the prophets. How striking is the description of that call given by Jeremiah: "Before I formed you in the womb I knew you" (Jr 1:5). The "knowledge" of God signifies election, the call to partici-pate in the fulfillment of his salvific plan. In the light of the Mystery of the Incarnation, this choice is closely linked with Christ as Priest: "[God] chose us in him even before the foundation of the world" (Ep 1:4). "Before you were born I consecrated you" (Jr 1:5). Consecration to God is full and total dedication for one's whole life to a charge or mission, under the action of the Spirit of the Lord who anoints and sends (Is 61 : 1). Through Holy Orders the priest participates in the anointing and mission of Christ the Priest and Good Shepherd: "He has anointed me to preach good news to the poor"(Lk 4:18). For Eternity From this it follows that the mission of the priesthood carries the seal of eternity. You are consecrated forever. It is not a decision that is sub-ject to the fluctuations of time or the vicissitudes of life. It cannot be founded upon transient sentiments or feelings. It involves, as authentic love, permanence in fidelity. You are called to remain always with the Lord, tO perpetuate friendship with him day after day, in order to model yourselves after his heart. Only in the light of this love can the evangel-ical requirements that the priestly ministry involves be understood and lived. You must put your youth fully and without reserve at the service of Christ in order to become instrumenis of salvation without frontiers. "Be not afraid of them" (Jr 1:8), we are told in the first reading from the prophet Jeremiah. There is no room for doubt and discouragement. "For I am with you" (Jr 1:8), the prophet repeats to us. Human weak-ness is not an obstacle when we know how to recognize it and place it faithfully and confidently in the hands of God. The Risen Christ empha-sizes this presence: "It is I" (Mt 28:20). Thus is it possible to carry out the mission of the Lord: "to all to whom I send you, you shall go" (Jr 1:7). I Have Called You Friends "Behold I have put my words in your mouth" (Jr 1:9). These are "words of eternal life" (Jn 6:68) which sustain the generosity of the one sent and assure the fruit of the apostolate, even if through the Mystery of the Cross. Is it legitimate to fear the word and the call of God? No! One may fear human weakness, but God's call -- never. In fact, it always indicates a marvelous path: it calls one to a particular participation in the "great things of God." It is thus wise to listen attentively to the words of the Apostle in the letter to the Ephesians: "I, therefore, a prisoner for the Lord, beg you to lead a life worthy of the calling to which you have been called, with all lowliness and meekness, with patience" (Ep 4:1-2). Biblical Poverty Beloved sons, consider as well that the journey towards priestly holi-ness and the apostolate is one of biblical poverty. When we recognize our weakness, it is then that we are strong (see 2 Co 12:10). This attitude of humility, which is authenticity and truth, will lead you to recognize with joy that the priestly vocation is a gift of Christ's heart and a choice that reaches the depths of one's heart and mind. In the priestly vocation one experiences the contrast between the power and holiness of the Master who calls and the fragility and littleness of those who have been chosen. You have surely experienced within your-selves a sense of awe before the sublimity and the greatness of the mission that is being entrusted to you; but feel also the security and joy of knowing that it is Jesus who calls, that he will always be with you and give you the strength and joy to be faithful in his service. And he never abandons his disciples. Priesthood: A Gift for the Church The priestly vocation is a gift for the Church. In the Church there are diverse gifts, as the Apostle teaches us: "Grace was given to each of us according to the measure of Christ's gift" (Ep 4:7). All of these different gifts constitute an essential and unrepeatable "part" of "Christ's gift." In reality, all graces and charisms serve jointly "for building up the body of Christ" (Ep 4:12). Among these gifts, the ministerial priesthood takes on a particular importance. We participate in a special way in Christ's priesthood. Even if "from his fullness have we all received, grace upon grace" (Jn l:16), each participates in "Christ's gift" (Ep 4:7) according to particular graces and charisms, always at the service of the ecclesial community, which is the Review for Religious, Jan.-Feb., 1987 communion of all the faithful. It is necessary to recognize, love and live the diversity and particularity of the gifts, precisely in order to build up the "one Body" of Christ that is the Church, animated by "one Spirit" (Ep 4:4). To the extent that you joyously love your priesthood, you will feel called to appreciate, respect, awaken and cultivate the other charisms of the ecclesial community in order to build up the Body of Christ unto perfection and fullness (see Ep 4:i2). The priestly identity is thus a joyous reality which we experience when we love the gift received in order to serve and improve others, with the commitment to "lay down our lives" like the Good Shepherd (see Jn 10:15). Give Yourselves in Love for Christ, for the Church If the priestly vocation is such a great gift for the Church, this means that you no longer belong to yourselves, but have become the property of Christ, who lives in this Church and awaits you in the many fields of the apostolate. You belong to Christ andto the Church, his "spotless Bride," whom "Christ loved . . . and gave himself up for" (Ep 5:25). This is what is asked of you: that you love. Love of Christ and love of the priesthood would not be possible with-out deep love for the Church, which, notwithstanding the limitations proper to her pilgrim state, does not cease to be the Body of Christ, his Spouse, and the People of God. Serve the flock as priest "not by constraint but willingly, not for shameful gain but eagerly., being examples to the flock" (1 Pt 5:2-3). May the community be able to see in you heralds of the Gospel, ded-icated to this mission of which the world has such urgent need -- a full time dedication, without invading other fields and secular occupations that do not concern you. May you be found in the place assigned to you by the bishop, whose collaborators you will be, in loyal unity, as solic-itous pastors, who in everything reflect their sacramental condition: in the soul's depths, in pastoral activity and in external behavior. To follow Christ also means to fee! truly Church, with filial love, ready for responsible collaboration and with a prompt and generous adher-ence to her discipline and norms, loyally cooperating with your bishop. Only through remaining with Christ, living with him, letting your lives be formed by him, will it be possible to proclaim him with decisiveness, frankness and ardor, communicating the experience that one lives in the mystery of and in communion with the Church, "the universal sacrament of salvation" (Ad Gentes, 1). I Have Called You Friends / 11 Abide in My Love In this way, beloved brothers and sisters, we today experience in a special way -- all of us here present -- the Father's love of which Christ speaks to the apostles on the eve of his death: "As the Father has loved me, so have I loved you" (Jn 15:9). In Christ, the Father's love becomes for us an inexhaustible source of life and light. "The priesthood is the love of the Heart of Jesus,'" said the holy Cure d'Ars, the second centenary of whose birth we celebrate this year, the year of your ordina-tion. Truly, "greater love has no man than this, that a man lay down his life for his friends" (Jn 15:13). It is Christ himself who lays down his life for us. And this "laying down of his life," this sacrifice, remains in the Church and, through the Church, remains in humanity from one gen-eration to the next. It remains through the word of the Gospel and in the Eucharist, the sacrament of the death and resurrection of Christ. It remains, therefore, through the ministry of priests. And through this ministry it renews itself and makes itself present in all ages. From the height of the Cross and from the heart of his salvific sacri-fice, Christ continues to say to us: "Abide in my love" (Jn 15:9). The Lord today tells each of you in a very special way, dear priestly candidates: "If you keep my commandments, you will abide in my love" (Jn 15:10). Yes! "Just as I have kept my Father's commandments and abide in his .love" (ibid). In these words the divine bond or relationship transposed to the dimension of human existence is truly manifested. We know well the commandments that constitute the solidity of this permanent bond in the love of Christ. We know very well the principles of priestly life, the requirements of priestly discipline that constitute the firmness of this response. It is truly a matter of sacrificing oneself in following Christ, and this excludes any form of self-establishment, and demands the greatest possi-ble readiness, as is required of him who has nowhere to lay his head (see Lk 9:57-62). It is a commitment that embraces all one's existence, as the Messiah, the Son of God, demands, who with his word calms the tem-pest, heals the sick, evangelizes the poor, drives out demons, reconciles humanity so as to regenerate it to life. He demands full submission to the will of his Father, who may lead you, like Peter, where you do not wish to go (see Jn 21:18). But he always leads the way, lovingly carrying the same cross that he places upon our shoulders and lightens. In fact, the Lord says: "My yoke is easy and my burden is light" (Mt I 1:30). A life faithful to these requirements, a life lived with this love, simulta-neously opens before us the prospect of divine joy. "These things I have 12/ Review for Religious, Jan.-Feb., 1987 spoken to you, that my joy may be in you, and that your joy may be full" (Jn 15:11). "This is true paschal joy" (Presbyterorum Ordinis, 11), characteristic of the priestly identity and the prelude to the flowering of priestly vocations. This is the meaning of the priestly vocation and of the service~of, or priestly ministry to, the People of God. "You Did Not Choose Me, But I Chos~ You" "You did not choose me, but I chose you" (Jn 15:16), says the Lord. These words we have all had branded on our hearts, you and I! They are Jesus' words in the familiar and intimate context of the Last Supper, when the Lord lovingly opens his heart to his disciples. It shows the gratuitous nature of his choice of those whom he constitutes his ministers, those to whom he entrusts a mission of particular importance. It is God who initiates the dialogue in salvation history, interwoven with the mar-velous reality of his love. It is he who takes the initiative with the trans-forming power of his Word that re-creates everything. "He first loved us" (Jn 4:9). For this reason the Lord adds: "I chose you and appointed you that you should go and bear fruit and that your fruit should abide" (Jn 15:16). Just as the fruit of the first sowing of the Gospel in this land and on this continent has abided in an admirable way, so will your fruit abide today, in these last years of the second Christian millennium, as the fifth centen-nial of the beginning of evangelization in Latin America approaches. Why does this fruit of Christian life abide? Perhaps because those who sowed it knew, at the same time, how to pray, to ask in Christ's name: "So that whatever you ask the Father in my name, he may give it to you" (Jn 15:16). And he will give it to us as well. Fraternal love will be the guarantee of our union with Christ and the efficacious sign of evangelization: "This I command you, to love one another" (Jn 15:17). The efficacy of the Gospel produces fruit that our eyes often do not see. The Lord's grace waits secretly in men's hearts. Today we are living off the seed which generations of generous missionaries planted in the fer-tile Colombian soil and God's grace has caused to sprout and bear fruit. Beyond Frontiers On this day which is so important for the Church, let us look to the future with confidence. The Church thanks you for the work that you are doing, beloved brother bishops and religious superiors, in the realm of vocations, with the cooperation of solicitous and suitable experts in forma-tion, attentive to the norms of the Church and the integral spiritual, academic and pastoral formation of candidates to the priesthood and reli- 1 Have Called You Friends gious life. I thank and bless you for the enormous amount of work which has been carried out in the vocations apostolate. The increase here must bring about the generous opening of hearts with a missionary spirit and a sense of co-responsibility, so that necessary help can be given to the other sister Churches which today suffer a shortage of priests. Looking to Mary, Mother of the Church and loving Mother of priests, in this extremely solemn moment, each of us will feel invited to imitate her motherly love: "In her life the Virgin has been a model of that motherly love with which all who join in the Church's apostolic mission for the regeneration of mankind should be agnimated" (Lumen Gentioum, 65). "The form of this world is passing away" (1 Co 7:31). The genera-tions of all peoples and nations pass away. But the words of the Lord do not pass away. Jesus' words pronounced at the Last Supper will now be made a reality through the Sacrament of Orders that we are about to confer upon the candidates here present. The entire Church of Colombia assembled around her bishops, the universal Church assembled around the Successor of Peter, raises its confident prayer to the Father for these deacons who today, in the city of Medellin, will receive the order of the priesthood. On Mirrors Mirrors can tell me only what I know, That with the rub of time all thing~ grow old. Nothing they hold to stir the still conviction, This must be -- Must wisely be. Wherefore, my summer over, In my skies the first sharp hint of snow, I turn all mirrors to the wall. Let come what may, This is a season now of no surprising -- Nearer the promised Springtime past surmising When God who gave me life Will claim it. Sister Cecilia Ward, S.C. Sacred Heart Convent 6225 Walnut Street Pittsburgh, Pennsylvania 15206 Mythology, Revitalization and the Refounding of Religious Life Gerald A. Arbuckle, S.M. Father Arbuckle, well known to our readers, will be directing a workshop on the sub-ject of the refounding of religious orders this summer under the auspices of REVIEW FOR RE~Jr~OUS. Just completing a sabbatical year of study and formative prayer expe-rience, he returns to the East Asian Pastoral Institute (P.O. Box1815; Manila 2800; Philippines), where he may be addressed. A myth is a story or tradition which claims to enshrine a fundamental truth or inner meaning about the world and human life. Contrary to popu-lar belief, myths are not childish stories nor mere prescientific explana-tions of the world nor are myths to be equated with falsities or fantasies. Myths are deeply serious insights about reality. Without myths we are unable to determine what things really are, what to do with them, or how to be in relation to them. We come to this conclusion in more recent times because of the writ-ings of people like Raimundo Panikkar,' Karl Jaspers and Paul Ricoeur,2 but particularly because of the careful research of cultural anthropologists into the role of myths in traditional religions. Scripture and theological studies have benefited from this rediscovery of the role of myth in society.3 Myth is recognized as essentially the way we talk .about our religious encounter with God and with the spiritual world. "Unlike historical or abstract truth," writes Avery Dulles, "mys-tery cannot be described or positively defined. It can only be evoked."' The use of symbols and mythical language is crucial for the evoking of mystery. The role of myths in the revitalization of a religious congregation is also acknowledged. For example, in a recent significant reflection on the 14 Mythology, Revitalization and Refounding Religious Life future of religious life it is said that "Central to the project of revitalization is the need to deepen the mythic roots of one's own life and those of one's community. ''~ But the nature of myths and their precise function in revitalization is poorly researched. This article is an introduc-tory attempt to respond to this paucity of research into the function of myths within religious-life revitalization. I will aim -- to clarify the nature and types of myths and the ways in which they are interpreted especially by cultural anthropologists; -- to reflect on the role of myths for religious-life revitalization and refounding. Myths, Truth and History Anthropologically a myth is a type of narrative which seeks to express in an imaginative or symbolic form a belief about the human person or culture, the world or deity, which cannot adequately be expressed in ordi-nary language. Myths reveal the "meaning and significance of spiritual reality, and how it interpenetrates and affects the familiar physical world. ,,6 Myths are concerned about the meaning of human existence at the deepest possible level, about the problems of evil, the source of crea-tion or how chaos became cosmos, the origins of different cultures. By mythically defining and structuring the world, the human person is able to grasp to some degree or other the regions beyond human control which deeply influence well-being and destiny. Like sacred icons, myths are the "medium of revelation rather than of man's self-expression . They are accepted., as handed down from the gods themselves.''7 Sometimes individuals, e.g., Old Testament prophets, are seen as the agents of the revelations of the gods in the estab-lishment or revitalization of myths. But the myths remain as the revela-tions of mysteries rather than clever illustrations or didactic entertainments on the part of mere human persons. Like all symbols, myths can evoke deep emotional responses and a sense of mystery in those who accept them, simply because they develop out of the very depths of human experience of birth, life, death. No matter how hard we seek to deepen our grasp of the meaning of myths, they still remain somewhat ambiguous and mysterious because they attempt to articulate what cannot be fully articulated. Myths can maintain their influence even though people do not con-sciously accept them. Take the first myth of Genesis, the creation story. Most Western peoples, whether they adhere to the Jewish/Christian faith 16/Review for Religious, Jan.-Feb., 1987 or not, accept the myth's conclusions that people are sacred and have inalienable rights. Myths articulate attitudes toward reality. These atti-tudes can maintain a powerful influence on behavior over a long period.8 Myths, then, are about reality. They are efforts to explain what usu-ally is beyond empirical observation and to some degree or other outside human experience. They speak of reality and experience other than the physical world. This is an important point that needs to be understood if confusion is to be avoided. Myth and empirical truth do not contradict one another. Myths, remember, reveal truths that cannot be grasped through empirical observation. Likewise myth and history do not contradict each other. Each relates to facts from its own standpoint; history observes facts from the "outer physical side, myth from the inner spiritual side. ,9 It can happen that the symbols used to express an inner meaning or truth about life are histor-ically untrue. For example, in the Genesis story we are t01d the vital truth that God created the world. The symbols used, e.g., the number of days for creation, are not all necessarily historically true. But the myth in this case is not out to tell about an event with total historical accuracy. That is not its purpose. Sometimes a myth is totally false historically, even though it is described as though it were an historical event, e.g., the story of Job, Noah's ark. Recall the key insight: myths are out to reveal truths that'mere human observation itself cannot grasp. All kinds of symbols are used to express these truths. Myths sometimes include actual historical events but in order to give them special significance. For example, in Disneyland, Los Angeles, Abraham Lincoln is brilliantly re-presented in the Main Street Opera House, delivering a speech on liberty~ An actual historical event is portrayed. But the props used are not historical, e.g., the dramatic use of lights, the nobility of the furnishings. But these props are rightly used to convey an atmosphere of reverence for one who is "above the normal human person." Lincoln is now seen to embody key virtues of the nation's founding myth, e.g., respect for liberty, democracy and human dignity. The myth gives an inner meaning to an actual historical event. Lincoln saved the nation because he embodied the virtues on which the nation is built. Interpretation of Myths Commentators generally interpret myths in one of three different ways: functionally, symbolically or structurally. Sometimes authors blend aspects of two or all three ways of interpreting myths. This blending is in-valuable. Myths are too rich to allow only one method of interpretation. Mythology, Revitalization and Refounding Religious Life / 17 According to the functional way of interpretation, myths justify exist-ing social institutions or ways of doing things,'° People feel a deep need for an authority that transcends rational argument to justify what is happen-ing. The rise of democracy was justified in part by the myth of the "social contract." In Nazi Germany programs of vicious race-hatred were justified in part by a revival of the ancient German mythology of race superiority.'~ Symbolic interpretations assume that mythology is a poetic way of com-municating; the meanings of myths are to be found beneath the surfaces of stories. Carl Jung, Sigmund Freud and their followers support this form of interpretation. Jung believes that "the primitive mentality does not invent myths, it experiences them.''~2 There is a "collective uncon-scious," the psychic background which is common to all people, though at the same time supra-personal. There are archetypes, "forms or images of a collective nature," which are active in every mind, remnants of "his-torical mental states" which have been transmitted by traditions, migrations and heredity. These archetypes are identical with the themes of myths. Jung concludes that myths are not charters to legitimate cul-tural institutions, but psychological realities or expressions of the archetypes or primordial images of the collective unconscious. They rep-resent inherited forms present in every human person. Myths give a "local habitation and a name" to these general forms and give them "real-ity" by revealing them to the consciousness. Anthropologists, however, criticize Jung for treating myth as an irreducible mental property.'3 His explanation of myth "denies to culture any formative role in its symbol-ism.'"' For Freud and his followers myth is a type of daydream. It uses the symbolism of dreams articulating unconscious desires and conflicts. But the likening of myth to a daydream does not explain why people build myths in preference to just any daydream and why the sharing of myths is a significant social and cultural fact.'S As w~th Jung, Freudians fail to acknowledge the cultural influences in the evolution of myths. The source of myth for them is far too much dependent on the individual.~6 Many contemporary anthropologists approach the analysis of myths from a symbolic point of view. They claim however that the meanings of symbols are strongly influenced by cultural, rather than individual, experiences. The structural interpretation of myths is a rather recent development. A myth is broken into its different parts, its incidents and motifs, and the interpreter reflects on the ways in which they are interrelated. The aim is to uncover the underlying structure of a myth like a cross-section of the Review for Religious, Jan.-Feb., 1987 geological strata beneath a landscape. The significance is not sought in the narrative but rather in the arrangement of the underlying strata. One structural pattern common in myths is the interplay of opposites and their resolution. For example the present state of things is the opposite of what was "in the beginning.'''7 In the Genesis story of the fall, Adam and Eve (and their descendants) must work hard to survive. Not so in the begin-ning. In a later myth the opposition will be resolved: "The wolf shall be ¯ a guest of the lamb .The baby shall play by the cobra's den"(Is 1 1: 6,8). A leading structuralist, anthropologist Claude Levi-Strauss, sees in myths "the emergence of a logic operating by means of binary oppositions and coinciding with the first manifestations of symbolism."'8 One of the prime functions of myth is to reconcile apparent contradictions in cultural life. Anthropologist Victor Turner has a quasi-structuralist approach to myth. Myths are for him liminal phenomena; they are recounted fre-quently at a time or in a state that is "betwixt and between," that is, when people are confused or without their traditional cultural supports. Myths recount a period in which the uncertainties and tensions of being in a state of confusion do not exist.'9 For example, the psalmist in the midst of desolation turns to the mythical expression of the Lord's great-ness and concern for Israel. The recounting of this myth gives him con-solation: "I remember the deeds of the Lord; yes I remember your won-ders of old . You led your people like a flock under the care of Moses and Aaron" (Ps 77:12,21). I will return to this insight later. Types of Myths Creation and Regeneration Myths Here are several relevant types of myths: While all cultures have specific myths through which they respond to questions of identity or behavior, it is in their creation myths that the most basic answers are to be found. Not only are creation myths the most all-embracing of mythic proclamations, addressing themselves to the widest range of questions of meaning, but they are also the most pro-found. Take, for example, the New Zealand Maori myth of creation, a myth that is extraordinarily dramatic and rich in language. Being- Itself evolves "from the conception" through thought, spirit and matter to the great peak, the "blaze of day from the sky. ,20 Creation myths like this speak about first causes; in them people express their primary understanding of mankind, the world, time and space. Mythology, Revitalization and Refounding Religious Life By way of summary,2~ many old creation myths place an absolute real-ity as the very foundation of all life. This reality is both transcendent, i.e., true for all times and places, and immanent, i.e., true in the here and now. To be both transcendent and immanent, the reality is believed to be eternal. While this absolute reality, in whatever way it is defined, is behind all myths, it is most obviously so in strict creation myths. These myths are concerned about the relation of the known to the unknowable, e.g., in the Genesis myth the relation between the world and God. Often the original reality out of which the Absolute created the world is consid-ered divine chaos. It is a chaos out of which order and dis-order can develop. Rather than being "something" negative, chaos is vigorously positive inasmuch as order can emerge from it. Anthropologist Mircea Eliade believes that there is a creation dimen-sion behind every kind of myth. Myth, he says, "is always the recital of a creation; it tells how something was accomplished, began to be. It is for this reason that myth is bound up with ontology; it speaks of realities, ~ ,~22 of what really nappeneu. For him "reality" means "sacred reality." And the sacred reality belongs to sacred time, the time when creation took place. In profane time people carry on the ordinary business of daily living. It is sacred time. which gives meaning to life; sacred time breaks into people's lives through rituals in which people re-enact, re-live the holy or the original creation, their emergence out of chaos. In short they relive the founding myths of their cultures. The reliving of the founding myth is called a regeneration ritual. It is particularly relevant when a people's cultural identity seems to be falling into chaos or is threatened with chaos. People feel the need to relive their original founding, and thus win back their identity. Regeneration rituals are not commemorative. They are always founda-tional or re-creative in their demands on people. That is, people are expected to undergo a deep interior and exterior change or revitalization; they must experience a new creation out of chaos. They are to be passive and active in the presence of the revealing absolute.2~ To use Eliade's lan-guage, in regeneration rituals sacred time breaks into profane time. Sacred time is ritual time, the brief transcendence through festival. It con-sists of those rites in which people re-enact the holy, aboriginal events of their culture. The escape into sacred time intimates immortality, a rescue in any case from the meaningless. Charter Myths These myths legitimate actions in the present or in the future. For example, people who are influenced by the Genesis myth of creation feel 20/Review for Religious, Jan.-Feb., 1987 legitimated in their work of dominating nature.2' The American political system of checks and balances is legitimated in the Constitution myth. Identity Myths These myths, intimately related to creation myths, provide individuals and cultures with a sense of belonging. The Old Testament is filled with myths that give identity to the Israelites, e.g., the Exodus narrative. In identity myths there are often heroes, including historical figures, who symbolize this identity and whose lives indicate how this identity is to be achieved or restored, e.g., Old Testament prophets, Abraham Lincoln, J. E Kennedy. Eschatological Myths These are myths about the end of an age or the end of time. They speak about key issues of life, death and resurrection, future rewards and punishments, even an apocalyptic ihsight into a future age of peace and plenty.~ These myths often tell of a former age of peace and contentment that was lost but is to be restored if people act rightly. They are the driv-ing force behind the way people live their morality and institute revolu-tionary movements. Communism offers its golden age of the classless soci-ety, one to be shared by those who battle against oppressors. The col-lective champion, or culture hero, in this myth is the proletariat which struggles against and, eventually overcomes, the bourgeoisie. Dominant, Supportive and Directional Myths In the narrative story of a people, different myths may be intercon-nected into what is called a mythology. Generally, one myth will stand out over the others in the mythology. This is called a dominant myth. The other myths complement or support this dominant myth. Some myths, called directional myths, indicate how the foundational or creation myth is to be lived out. The written American Constitution, which established the political system, could be considered a directional myth. Myth Management New myths are created and old myths are maintained in existence, are constantly revised or die out because of a variety and flow of forces, changing needs and new perceptions. We call the creation, revision or disappearance of myths myth management. Myth management occurs through such processes as myth extension, substitution, drift and revitaliza-tion. We will briefly examine each of these processes. Mythology, Revitalization and Refounding Religious Life/91 Myth Extension When people ransack the past to find legitimation for the present, there is myth extension. For example, American politicians are apt to quote great politicians of the past, or other cultural heroes, in order to legitimate what they are saying about the present situation. In the process of extension the myth is applied to new needs. Sometimes revision or extension occurs if only the meaning of the specific myths, not the words themselves, is changed. The American foundational myth -- which includes the "revelation" that "all men are created equal," -- for exam-ple -- is still vigorous, even though we have come to include blacks and all women in an originally very restrictive assertion. Although the mean-ing of the myth is much extended, the "fact" of equality is still consid-ered to be unchallenged. Notice that the community itself is involved in one way or another in revising or extending the myth's meanings or emphases. Myth Substitution Myth substitution is a difficult and often painful process. Marxist Rus-sian leaders seek to manipulate their people, often under the threat of violence, by inventing new myths to legitimate their power and suprem-acy. 26 Sometimes a new myth becomes acceptable through a process of education, persuasion and example. Paul VI deliberately used ritual experi-ences to help people grasp Vatican II mythology. For example, in order to stress the servant role of the papacy he put aside the use of the regal tiara. For his funeral he willed that he be buried in a simple wooden casket. Myth Drift Drift occurs when myths change, degenerate or disappear without deliberate planning on the part of individuals or groups. Fairy tales and legends are sometimes secularized myths; they have lost their original sacredness because over time they have ceased to be important to people in answering key questions about life and its meaning. In our contemporary world there is a strong tendency to equate "literal-ness" with "truth." When this happens the power of myths is undermined. For example, if the metaphor referring to the ascension of Jesus to the Father is taken literally in spatial terms, then God is assumed to be resident in space, at a certain height in the atmosphere. Once this literal interpretation is brought into question, however, the danger is that the inner meaning of the myth is also called into question. But the reli-gious symbols of myth cannot be reduced to purely factual or intellectual 22/Review for Religious, Jan.-Feb., 1987 terms. Truth is bigger than what can be empirically analyzed.27 Sometimes the dominant myth is distorted because a secondary or directional myth assumes an exaggerated position. This has happened to the Genesis creation myth. Extreme capitalism with its emphasis on indi-vidualism displaces the original stress in the mytl~ on our responsibility to be co-creators with God in this world. Social consciousness thus is downplayed in what has become a distorted myth. Marxism, with its stress on the future communist golden age, is a secularization and vulgarization of the same creation myth; for, remove God and individual dignity is unprotected.28 One of the most powerful barriers to an understanding of myth, and it~ survival, is the fact that people may no longer share the kind of faith which had originally given rise to it. As T. Fawcett says, "The myths embody a religious outlook on the world. If this is not shared by one who seeks to interpret the myths, there is at least a strong possibility of misunderstanding. Myth Revitalization Myths can articulate "how chaos became cosmos.''3° When a people or culture is threatened with chaos or experiences chaos it feels the urge to rediscover the original creation myth, to relive it. Iri the reliving of the myth, it seeks once more to achieve identity and self-worth. Take the example of the American foundation myth. This myth exalted the potential of the human person to grow in strength and human perfection. During the late 1960s and 1970s the nation experienced cultural turmoil. Antiheroes abounded: people burned the sacred flag, presidents failed to live up to the American spirit of pride in the nation's prestige, the nation suffered a disastrous war in Vietnam and was humiliated in Iran. There was needed, said Time, "a reassertion of man as shaper of the world rather than the '70s model as victim or passive partner.''3~ The 1984 Olympics at Los Angeles gave many Americans the chance to relive their founding myth: "The belief was reborn that Americans can do, well, any-thing."~ 2 There were other events also: "It was a year of ceremonies . Some of the rites played a kind of sacramental role., conferring a heal-ing reassurance."~ And there were cultural heroes: the organizer of the Olympic Games, the participants themselves, thecountry's actor-president. Notice the key factors in revitalization: a feeling of chaos/confusion, the emergence of cultural heroes in touch with creation roots and the will-ingness of people to participate in the reliving or reappropriation of the founding myth. The myth can be updated, distorted or purified in the pro-cess. Stallone in Rambo and Rocky is, an updating of the American mythic Mythology, Revitalization and Refounding Religious Life hero; he is the modem cowboy, now dressed for contemporary deeds. In light of the Gospel, and indeed of the creation myth of America itself, this updated mythic hero is a moral distortion of what the hero should be because of the senseless use of violence .34 Notice, finally, that for revitalization to occur the myth should come alive in new symbols, e.g., in the American case, the "Games Extrava-ganza." If this does not happen, then the supposed revitalization is a regressive and fundamentalist movement, such as happened in the Iranian revolution. There is a failure to adjust to the realities of change. Summary: Key Anthropological Points in Myths Despite the divergent approaches to the study of myths, there are important points of agreement among anthropologists. Here are some of them: Myths Are Symbolic Revelations of Truths A symbol is any reality that by its very dynamism leads to another deeper reality through a sharing in the dynamism that the symbol itself offers. Symbols speak not just to the intellect, but more especially to the heart, to the feelings. Symbols arouse strong emotional responses. The one symbol can contain many meanings at the same time, even contrary meanings, e.g., the cross connotes both death and resurrection. ' Symbols do not just point to the things signified (as simple signs do), but they truly represent them. This is why symbols operate at the level of metaphor, not of simile. The metaphor articulates not merely a like-ness, but an identity. Such a metaphor insists on being taken seriously at a very deep level, that of personal commitment. So a myth, expressed in metaphorical symbolism, demands that people identify with its inner mes-sage and accept the consequences in action of this inner conversion.~5 Within each myth one metaphor will pred6minate over others. This metaphor is called the root metaphor, e.g., in the Way of the Cross, Christ is the root metaphor, while the persons of Mary and Veronica are complementary or supportive metaphors in the narrative.~ Creation Myths Speak of Chaos Creation myths are the most universal kind of myth. They tell us why humans suffer and die, how they establish and maintain social cohesion, how they relate to absolute reality. In many myths an original chaos is depicted, but a chaos that has potential for creativity. In the Judaeo- Christian tradition, the absolute reality is God. When people experience intense confusion, they are apt to experience themselves as reinserted into 24/Review for Religious, Jan.-Feb., 1987 that original chaos. The retelling of the myth can give them new energy, new hope. Myths, History and Doctrines Are to Be Distinguished A myth is not some kind of mixed-up history. It tells what occurred not in profane or ordinary time, but in the beginning, in sacred time, i.e., in the period of the gods or the creators of the world. It is an account of a primordial event that gives meaning to reality, telling why it came into existence and why it continues to exist. History deals With another type of reality altogether, i.e., the observable world. Historical analysis is invaluable in helping people dis-cover how local history has affected the interpretation of myths. History, however, cannot evaluate the authenticity of the inner meaning of a myth. Special evaluative principles, e.g., from theology or Church magisterium in relating to Christian mythology, are needed to authenticate a myth's meaning. The aim of a myth is to communicate a profound truth in the form of a story. Religious myth achieves a kind of revelatory character through this truth, by uncovering something of universal validity about the nature of life and reality. Neither are myths equivalent to doctrines, though they are both ways of interpreting religious experiences. Doctrines generally use philosoph-ical language to express meanings, whereas myths use highly symbolic language. Myths complement doctrines; they help provide insight into the more abstract content of doctrines.37 Mythical Archetypes and Ritual Assume Conversion Anthropologist Bronislaw Malinowski asserts that myth "is not merely a story told but a reality lived." It is "not an idle tale, but a hard-worked active force.''~ Eliade believes myth is a "sacred history" and hence "saturated with being . . . and power. ,,39 Both authors, experts in the study of myth, are speaking of the "eternal" relevance and dynamism of myths for those who accept them. What does this mean? In all cultures there are some forms of repeated symbolic behavior that are tied by explanatory verbalization to their basic ways of understand-ing human existence. The repeated symbolic behavior is called ritual. The explanatory verbalization is myth. The myth sets out what should be; it .is the archetypal directive to a group of people. In ritual, people "own" or interiorize that directive; ritual provides a way of participating in the myth experience. The key word is archetypal. The Absolute -- in whatever way it is defined -- is immanent as well as transcendent in every creation myth. That is,the Absolute is here as well as everywhere; it is now as well as always. Mythology, Revitalization and Refounding Religious Life The Absolute achieves transcendence and immanence through arche-types; they give shape and form to this or that. Archetypes are always valid, never change, because they are the Absolute and belong to sacred time. Archetypes break into profane time through ritual, giving people the chance to experience sacred time. Jesus, the archetype, rises from the tomb and transcends his relativity at all times. But he is with us now as he was with those who saw him on the first Easter Day.'° This is a key insight especially into creation myths. The archetype is not a prototype. The latter connotes the first of a line; the prototype may or may not con-tinue to influence subsequent events. But the archetype has universal application; it is timeless, it guarantees authenticity, it is the re-presentation of the Absolute of the myth in the here and now. Adam has relevance to us, not just because he is considered the first man, i.e., prototype, but because he represents the essential man, i.e., an archetype. His original sin is therefore ours. It is inherent in the human condition. We inherit the sin to the degree that we inherit our humanity. This is what is meant when we say that a myth is an active force or is saturated with power. For that power or active force to have an effect, people must acknowl-edge its existence; they must own it. For this to occur there needs to be a conversion to the reality of the myth. It is to accept the reality and force of sacred time within our lives. We allow the transcendent Absolute to become immanent, i.e., to take over our lives through the myth. II My task now is to illustrate how this analysis of myth can help us to grasp in more depth what is meant when we, as religious, are called "to deepen the mythic roots of one's own life and those of one's com-munity." The "Creation Myth" of Religious Life We believe as Christians that the Absolute in the Genesis creation myth is God himself, and that Jesus is the Absolute in the redemption myth of the Gospel. We come to these insights through the power and the presence of the Holy Spirit: "The Spirit we have received is not the world's spirit but God's Spirit, helping us to recognize the gifts he has given us" (l Co 2:12). The life, suffering, death and resurrection of Jesus constitute the Re-creation Myth; through Jesus we have a more pro- 42 found understanding of God and his designs for us. The Christian "locks in" on the Re-creation Myth by accepting the 26/Review for Religious, Jan.-Feb., 1987 same mission that the Father gave the Son, the mission to go out and bring the Good News to all. The call by the Father to mission with the Son constitutes the creation myth of religious life. While all Christian people are committed to evangelical perfection and mission with the Son, religious for their part publicly commit them-selves in faith to be unconditional in their response to the Father's call, in their love of him and of members of their own communities, his Church, and the world he wants to be saved. They openly commit them-selves not to this or that particular demand of the Lord at this or that par-ticular time and place but to be totally available, as other Christs, for the Father's work. They strive to take seriously always the command of the Lord: "Be converted and believe in the Good News"(Mk 1:15). This requires of religious an enduring identification with Christ, an act of love, that should govern all their actions. This describes the identification myth of religious. Religious are drawn by the power of the eschatological myth also, that is, the myth of the 'promise of "new heavens and a new earth where., the justice of God will reside"(2 Pt 3:13). They seek to reveal this new world of justice and love now, that through their example others maydiscover the saving power of the Lord, his mercy and compassion.'3 The commitment through the vows logically flows from the ear-nestness of t:eligious to be available to the Lord and to his Church. Vows place the person at the service of mission; they give religious more free-dom to be totally at the service of the Lord's mission. J. Tillard notes that the vows form a supportive myth. When they are seen as the dominant myth in religious life, religious tend to become inward-looking and hesitant in serving the needs of an ever changing world: One becomes a religious for the sake of the Gospel, not strictly for the . sake of the three classical vows. Although the vows represent elements that are specific to the religious life and therefore indispensable to who-ever feels called to that life by the Holy Spirit, they are not the primary elements in the concrete life of grace of the religious." This was recognized in practice by the Church for centuries; the custom of the now traditional three religious vows comes only from the 45 turn of the twelfth century. As religious commit themselves to be in the forefront of revealing the mythical mYstery of the Lord's redemptive love for the world, the Church rightly expects of them a creative dynamism in searching out new and better ways of preaching this message. Religious, then, are to be special-ists in pastoral innovation, in giving ritual flesh to the myths that motivate them. This charismatic character of religious life ,as being open to the Mythology, Revitalization and Refounding Religious Life / "2"1 Spirit in mission we can refer to as its directional myth. It indicates the how of living out religious life. Theologian Johannes Metz says that religious are to be a kind of shock therapy instituted by the Holy Spirit for the Church as a whole. Against the dangerous accommodations and questionable com-promises that the Church as a large-scale institution can always incline to, they press for the uncompromising nature of the Gospel and of the imitation of Christ. In this sense they are the institutionalized form of a dangerous memory within the Church.'6 Once religious cease to be a dangerous memory within the Church, or once they stop being creatively responsive to the needs of the Church, they cease to be identified with the distinguishing mythology of religious life. Ultimately identification with Christ the Redemptive Myth comes through faith, nourished in prayer. The day-to-day struggle of the reli-gious to be uncompromising in mission will at times fill him or her with "fear and distress" such as Jesus experienced in the garden before his passion, for "the spirit is willing but nature is weak"(Mk 14:34,38). Their fervent prayer is: "My Father, if it is possible, let this cup pass me by. Still, let it be as you would have it,,not as I"(Mt 26:39). Zeal with-out prayer cannot survive. In prayer we discover the precipitous depths of our own poverty on the one hand, and the saving presence of Jesus the Myth on the other. With him we speak confidently for strength to the Father. The Mythology of Religious Congregations Individual religious congregations exist in the Church because found-ing persons are deeply shocked to see the gap e~isting between the Gospel and the world. They see people who do not know of the mercy and healing power of Christ. They~see even people who have heard of Christ compromise with worldly values. These founding persons recog-nize how the gap between the Gospel and the woi'ld Can be bridged through particular apostolic strategies. So they act. Inspired by the Holy Spirit, they invite others to join them in living out their new vision. Thus the seeds are sown for a new religious congrega-tion to emerge. Each congregation, then, has its own distinctive mythology--its crea-tion, identity, .directional myths. The myth-maker is the founding person in cooperation with the Holy Spirit. The root metaphor or symbol in the dominant myth will be the particular aspect of the redemptive myth of Review for Religious, Jan.-Feb., 1987 Christ that is seen to be especially applicable at a particular time and place in the Church's life, e.g., the poverty of Christ, Christ as evangelizer. A religious congregation, when it is true to its mythology, is a medium of God's revealing and redeeming presence in the world. The fervor of the original congregational creation myth, as history shows, is very rarely sustained.'7 Our analysis of myth management helps us to understand how this winding down of enthusiasm occurs. Through a process of "myth drift" religious congregations can, even without realiz-ing it, accommodate their apostolic work and way of living too much to ambient secular values and customs. They neglect the uncompromising nature of the original myth. In the Middle Ages the Benedictines in Europe went into decline. "No one [any longer] looked to them for new ideas or new forms of spir-itual life," comments historian Richard Southern. "Rather they looked to them for stability, pageantry, involvement in the aristocratic life of the upper classes."4~ Gone was the inner commitment to the founding myth of creative obedience through a vigorous spirit of self-abnegation. They became lost in maintenance and forgot mission! Historian David Knowles, reflecting on the decline of the quality of the lives of monks, religious and clergy in the early Tudor period in England, comments: "Monks and clergy alike were children of their age and country; it was this that made the Dissolution [of the monasteries under Henry VIII], and indeed many of the religious changes of the reign, not only possible but relatively easy of accomplishment. ,,9 They had become accommodated so comfortably to the worldly values of the time that they were indistinguishable from the people they claimed to serve. Through the neglect of their founding mythology, religious had drifted to a point of spiritual and innovative enfeeblement. Their extinc-tion was then inevitable, even if Henry VIII had not himself acted with such speed. Sometimes a secondary or directional myth can be substituted for the creation and/or identity myths as a result of unchecked drift on the part of the religious congregation. For example, a congregation established for the pastoral needs of the poor through education services found itself eventually running schools only for the well-to-do. Members of the congre-gation "justified" this movement away from the poor on the grounds that the institute was founded "for education through schools." The mythology of the congregation was being misread. Concern for the poor belonged to the creation and identity myths; the establishment of schools pertained only to a directional myth. The congregation had definitely moved away from its mythical roots. Raymond Hostie believes that a myth substitution through the imposi- Mythology, Revitalization and Refounding Religious Life tion of a semimonastic model of religious life affected many congrega-tions of both men ahd women founded in the two centuries prior to Vatican II. In its defense against the effects of the Reformation and an emerging secularism, the Church turned in on itself. Its "narcissistic pre-occupation," as Avery Dulles phrases it,~° discouraged experimentation. Congregations certainly grew numerically and spread geographically. But the creative insights of founding persons, which should have led to rad-ically new forms of religious-life witness and pastoral action, were unable to be realized. It is not surprising, therefore, that the models of religious life in non-European lands even now remain Western.~' In the period fol-lowing upon Vatican II, religious life inculturation is a slow and very hes-itant process. Case Study of a Mythology: The Marists In this case study I will first describe the mythology system of a particular religious congregation; then I will summarize what has hap-pened to this mythology after the congregation was formally approved. Aspects of the above analysis will be highlighted in the case study. Mythology of the Society of Mary The Society of Mary (Marist Fathers and Brothers) was founded by Father John C. Colin in Lyons, France, and formally approved in 1836. Its aim is to carry on Mary's work in the world. "She is," he writes, "the refuge, the defense, the support, the advocate . the recourse of the militant Church." The creation (and dominant) myth reveals Mary as sup-porting the apostles at Pentecost or at the beginning of the Church, but with an added dimension. That support is to be continued now in and through Marists and other people committed to her seryice. She is recorded as saying: "I upheld the Church at its birth; I shall do so again at the end of time." Mary herself, through the Holy Spirit, decides to found a congregation which is to take her name. Her human instrument in this founding, according to Fr. Colin, is Fr. Colin himself. She remains the first and perpetual superior of the congregation, which is itself committed to be her presence within the Church "at the end of time." The root metaphor is Mary herself, Mother of Mercy. And it is from this metaphor that Marists receive their identity. Marists are to "be Mary" to the world; they are to think, judge and act as Mary does. So they are to be instruments of the Divine Mercy. There are several directional myths indicating how Marists are to be Mary as the support of the Church. As instruments of Divine Mercy, 30/Review for Religious, Jan.-Feb., 1987 Marists are to stress qualities of forgiveness, tenderness, compassion. A second direction myth is summarized in the phrase "hidden and unknowns" In the early Church Mary acted quietly, aiming all the time to inspire people to grow in Christ. So also Marists are to encourage people to develop their own gifts in the Lord. Hence, Marists must be prepared to withdraw from involvement as those they serve discover their own potential for self-growth. A powerful symbol of this action-principle, "hidden and unknown," is Nazareth. No one can act in a hidden, self-effacing way, unless he or she has the humility, the detach-ment that comes from deep union with Christ in prayer. Nazareth sym-bolizes these key virtues. Only through these virtues will a Marist avoid selfishness and the desire for power that are obstacles which would obstruct Mary's work in the Church. To be Pentecost people, Marists must be firmly rooted in the contemplative virtues of Nazareth. A further directional myth is devotion to learning. Marists are to be concerned for any kind of learning that would make them better instru-ments of the Divine Mercy. There is also a vigorous eschatological myth within the Marist mythology. "The Society of Mary," declares its founder, "must begin a new Church over again." By this he means not an arrogant claim to reform, but rather a challenge to "re-create the faith of the first believ-ers." As the early believers were of one mind and one heart, so there will be the same kind of communion in the fullness of Christ's kingdom. By living in one mind and in one heart, Marists will help transform the Church, aiding it to be now what the world will be in the perfection of the kingdom to come. This eschatological myth affected the founder's vision of how Marists are to relate to lay people and to worldly symbols of power. Colin had the vision of a family, a family of Mary, in which there would also be lay people who commit themselves to be Mary to the world in which they live. Because he stressed the notion of Mary's family, Colin reacted to the evils of clericalism and attachment to worldly distinctions. On the practical level, therefore, Marist brothers and priests are to live together without distinction, showing to a world in which distinctions and unequal differences of lifestyles are commonplace that such behavior patterns are foreign to the kingdom that is to come. The particular object of Marist apostolic concern is those who are the most abandoned, the "little people" of this world, those with whom no one else is involved. The concern for the "little people" belongs to th.e identity myth ofthe congregation. Anthropologist Levi-Strauss speaks of "binary oppositions" within Mythology, Revitalization and Refounding Religious Life myths. Such oppositions exist in Marist mythology. And they are dialectical in quality or tension: Pentecost versus Nazareth, identification with the local Church versus commitment to the more universalist reli-gious life, with its freedom and identity. Take the latter tension. Colin says that bishops must consider Marists "as if they were their own men." On the other hand he insists in word and action on areas of independence from bishops. How are the two to be reconciled? As in all myths, no detailed instructions are given on how such tensions are to be reconciled in practice. It is assumed that their res-olution is possible only through people identifying thoroughly with the mythology. Marists in a spirit of faith will discover how the tensions are to be worked out in reality, thus revealing that people can live together with one heart and one mind. In summary, Colin founded a congregation committed, through its stress on Pentecost, to a service within the Church that is pastorally cre-ative, mobile and flexible, depending on the priority of need. He strongly detested any apostolate that would prevent the congregation from acting according to these qualities. Hence only in very exceptional conditions did he allow Marists to staff parishes. He feared that parishes would pre-vent Marists from being available for works of greater need. Colin believed that the nineteenth century had ushered in the age of Mary. He felt chaos on all sides, both in the civil and in the ecclesiastical spheres. Mary established her congregation to be one instrument of mercy to people caught in this chaos. To respond adequately to this challenge, Marists must possess the creativity of Pentecost and the hidden, contemplative virtues of Nazareth. Implementation of Marist Mythology: Myth Management Did Colin's dream of Pentecostal creativity take place in the congrega-tion he founded.'? For a variety of reasons, the actual interiorization and living out of Marist mythology (as revealed through Colin) up to Vatican II have been very hesitant indeed. Certainly, as with many other congrega-tions founded in France in the nineteenth century, the institute expanded numerically and geographically at great speed. Marists, with extraordi-nary courage and faith, left for remote and dangerous mission fields. The congregation has loyally served local Churches wherever it has been estab-lished. But, as with many other congregations over the last two hundred years, the institute has rarely shown any above-average pastoral creativ-ity, mobility or flexibility--at least if we take the founder's Pentecost met-aphor as the measure of analysies. Powerful internal and external factors militated against the type of pastoral and religious-life creativity that 32/Review for Religious, Jan.-Feb., 1987 could have been expected to have emerged out of the founding charism. Internally, myth management through substitution and drift par-ticularly dulled the impact of the founding charism. The founder's suc-cessor as superior general had not adequately interiorized the founding mythology. He had a far less exalted vision of what the congregation should be. Hence he proceeded to impose his own mythology on the young congregation. He believed the congregation should be nothing more than a pious association of dedicated people. The founder later had his own vision concretized into approved constitutions. But in practice the institute rarely lived the rich insights of the creation ,and dominant myths. What was a directional myth -- the Nazareth symbol -- became instead the dominant myth. instead of the Nazareth myth ("hidden and unknown") remaining as an action-principle, that is, indicating how Marists are to act apostolically, it became an end in itself. Now Marists were to do nothing apostolically that would in any way attract attention to themselves. This was a tragic distortion. It legitimated mediocrity and dullness. It reinforced the already existing nineteenth-century image of religious life, namely, that it be semimonastic in structure, inward-looking and a vigorous supporter of the status quo. The distortion also effectively killed another key directional myth, namely, the concern that the founder had for learning as an essential means for the living out of the creation myth. Few people were encour-aged to research and publish their findings for fear that they would draw attention to the congregation and to themselves. Inevitably the distortion influenced the initial formation programs of the institute, so that it thus became perpetuated from generation to generation. The overall failure of the congregation to grasp the founder's insights is evident in a review of the general and provincial chapter decrees or legislation from the 1870s to Vatican II. For example, the 1873 general chapter of the Marists established the aims of the provincial chapters: to promote religious discipline according to the Rule and to inquire into the financial administration of houses. No mention was made of the need to. foster new forms of religious-life witness or pastoral action. The 1893 pro-vincial chapter of one of the provinces directed that "Religious [includ-ing pastors] were° prohibited from going out after the evening meal for unnecessary visits." The assumption was that a Marist house is a quasi, monastery; people should respect this, and anyone in need pastorally should be discouraged from approaching Marists "after the evening meal," unless in exceptional circumstances. An examination of provincial visitation reports reflects the same con- Mythology, Revitalization and Refounding Religious Life cern for the maintenance of religious discipline and respect for the Rule, but again no interest in the evaluation of pastoral effectiveness or creativ-ity. For example, just prior to the Japanese invasion of Ne~v Guinea in World War II, a provincial reported on the state of Marists in a particu-larly difficult section of that country: "The fathers, in spite of their pov-erty, must wear socks when saying Mass and be dressed decently, as respectable clergymen ought to be when appearing in public." Nothing was said about the enormous pastoral and cultural challenges which con-fronted the men.5' Externally the congregation was affected deeply by the semimonastic view of religious life referred to above. This model provided very little opportunity for the type of creativity envisaged by the original Marist mythology. It was assumed theologically that the world should adapt to the unchanging Church, not vice versa. The curricula of seminaries of this time allowed for little or no room for positive social-science subjects, e.g., sociology, anthropology. These subjects were not seen to be neces: sary for the apostolate. The above analysis is given not to provide reasons to ridicule the past, but to illustrate the historical way in which this particular congrega-tion, along with many others at that time, found difficulties in interiorizing the founder's vision. The analysis also helps to put into per-spective the adaptive efforts of the congregation since Vatican II. In the 1950s, there began within the congregation an historical in-depth analysis of its mythology. Thus the institute was well prepared to take up the challenge of Vatican II that religious should reflect on their founding charisms. The richness of the original insights of the founder were already being exposed. Through the advances in Scripture and the-ology studies, the congregation was able to deepen yet further its grasp of the meanings of its myths. Thus, through a process of myth extension, it became possible for the congregation to embrace insights unknown at the time of the founder, e.g., insights into Mary as a s~ymbol within the Church, the role of the local Church, confirmation about the creative role of religious life. Marists were now exposed to a mythology that was denied many previ-ous generations. Little wonder that the comment is made today that the congregation, having rediscovered its original mythology, is set for refounding. Mythology, Revitalization and Refounding Religious Life Religious congregations today are experiencing chaos.5~ Twenty years after Vatican II, despite renewal chapters, surveys, renewal programs, 34/Review for Religious, Jan.-Feb., 1987 congregations remain confused. Recruitment is poor, entrants even nonex-istent in many instances. The average age of religious rises alarmingly. Unless the present trend is checked, extinction for many institutes seems inevitable. Yet, as history shows, this experience of chaos is a potentially cre-ative atmosphere for religious-life growth. New religious congregations have generally emerged not so much when the Church was flourishing, but rather when it was profoundly disoriented and uncertain of itself. The Church is disoriented and unsure of itself at this moment. Hence the urgency to look more .closely at the creative possibilities of the chaos we are experiencing. In the Book of Jeremiah we have an insight into the positive dimen-sion of chaos. Yahweh informs Jeremiah what he expects of him: "See, I place my words in your mouth!. To root up and to tear down, to destroy and to demolish, to build and to plant"(1:10). Before there can be life again among the Israelites, all their securities, their apparently eternally valid ways of acting, must be destroyed and pulled down. The people will feel lost and disoriented. They will look for the consoling help of Yahweh. Then they will realize that they have become too com-placent about life and their institutions: they must again become pilgrims. The message of the book remains highly relevant. We religious are a pilgrim people. There Jan be no permanent security, whether in ideology, apostolates, buildings, ritual ancestry, history, except what comes from our trust in God. While we relate to the past and our roots, we are to be open to the future in constantly changing ways. People tend to react to chaos in one of two possible ways: negatively or positively. When people deny that chaos exists they act negatively. Jesus often reminds the Pharisees and Scribes that they are denying the chaos and confusion within them. He condemns them for distorting the founding myth of the nation. Within their hearts there is but chaos and confusion, and they will not admit it: "You cleanse the outside of cup and dish, but within you are filled with rapaciousness and evil . You are like hidden tombs over which men walk unawares" (Lk 11:39,44). People can refuse to accept the challenge of chaos by attempting to escape into the past. They find comfort in a kind of historical romanticism or nostalgia. The past is idealized, and they hope for a restora-tion without change. Such people will not acknowledge the need for interior and exterior adaptation to a changing world. Nostalgia, however, gives only temporary consolation. Eventually reality must be faced if people are to survive. Positively, people can react to chaos when they acknowledge their Mythology, Revitalization and Refounding Religious Life total dependence on God and enter into a reconversion process. Reconverted, these people live with new and zealous lives of justice and love in Yahweh's service. Often in the Old Testament the longing for con-version grows out of a deep sense of sin, suffering, and frustration, result-ing from an experience of disorientation. All these agonies of soul are cou-pled with prayers for mercy, forgiveness, and for yet another chance to begin all over again: -"A clean heart create for me, O God, and a stead-fast spirit renew within me . I will teach transgressors your ways, and sinners will return to you."(Ps 51:12,15). In the midst of chaos the reconverted Israelites retell, and relive, the nation's 9reation myth, e.g., "Aloud to God I cry;o.on the day of my distress I seek the Lord . I remember the deeds of the Lord; yes, I remember your wonders of old. And I meditate on your works; your exploits I ponder."(Ps 75:2,3,12,13). Through his recital of the foundation myth the psalmist gains hope, but only on condition that he hir~self is in deep union with Yahweh through reconversion in faith. Faith's hope and reconversion are integral. The archetype of the creation myth is: God saves a humble and con-trite people who cry out for help. When the Israelite is humbly, contrite and cries from the depths for help, the myth is once more revitalized. So also in the New Testament. There are eight occasions in the gospels on which Jesus says "Your faith has saved you," or equivalent words, e.g., the blind man (Mk 10:52, Lk 18:42). In all eight examples there are three characteristics: first, there is a situation of critical need; second, this need is expressed in some action or statement that clearly costs much; third, there is a clear sign that the petitioner abandons himself or herself uncondi-tionally to the will of Jesus. In Gethsemane Jesus himself gives an exam-ple of this prayer pattern when he petitions the Father: expression of dire need, action and statement that costs so much, the expression of his total abandonment to the w¯ dl of the Father (Mk 14:32-42). As with the Israelites, as also with Je~sus, we religious are confronted with a dire need: the urgency to abandon our congregation and ourselves to the will of God. He has allowed our securities -- born of our t~:ust in fine buildings and institutions, and of a never ending supply of vocations -- to be destroyed. What is God asking of us now? What is our future? In times of chaos, positively oriented Israelites retold their mythology, especially their creation myth. The act of obedience to Yahweh became the ritualization of their mythology. As for those Israelites, so also for contemporary religious. In the retelling of our congregational mythology, there must be the carrying out of God's will 36/Review for Religious, Jan.-Feb., 1987 in the here-and-now. This is the ritual dimension of mythology. The transcendent power of God becomes immanent in this or that particular action. H~wever, for an authentic retelling of congregational myths, the individual religious need to be involved in three processes: 1. The interpretation of the congregational 'mythology.~ Congregational mythology must b~' purified of all distortions and inau-thentic substitutions that have occurred over time. Purification requires a critical, historical analysis. This should be done with due reference to theology and the relevant documents of the Church. For example, if pas-toral creativity has ceased to be a key directional myth in the congrega-tional, mythology, it is to be restored to its correct position. Or if the mythology does not permit of due consultation by superiors of religious, then a correction is required in line with Vatican II and the New Code. This latter eventuality would be an example of myth extension. Interpretation is a long and difficult task. Not all have the expertise to undertake it. However, all are to be critically acquainted with the results of interpretation through personal and community study/reflection. Expert historians should be available for questioning by the congregation. At some point an official group of the congregation may have to' decide on what should be an interpretation of difficult texts -- especially if it is a question of new constitutions. There are two dangers to be avoided at the interpretation stage. First, religious who are insensitive to the power and necessity of symbols, met-aphors and mythology, may want congregational literature, e.g., con-stitutions, presented "rationally, scientifically, literally." The argument of this entire article is that this cannot be done. An attempt to do so will only distort the founding person's message. Second, no matter how many conferences and learned discussions are held to interpret the founding charism or learn about it, this does not mean that congregational revitalization has occurred or will inevitably take place. Remember, the temptation to escape into historical romanticism or nostalgia through frequent references to the founding person's insights without at the same time being prepared to live out the challenge of his charism in contemporary life is very real indeed. Mere discussion can take on an almost magical note: "The more we discuss, the faster we will find our way out of chaos." Expert interpreters come to be viewed as gurus or congregational magicians: they will lead us to the right and ancient ways of doing .things. I suspect that all too many of us fall victim to this temptation. We fear the internal and exter-nal changes that will have' to be made if we take the role of mythology Mythology, Revitalization and Refounding Religious Life / 37 as the way out of confusion seriously. Remember, interpretation is only the first stage in congregational revitalization. Reconversion and discernment have yet to occur. 2. The discernment of the mythology's relevance.55 For discernment to take place there must be a reconversion by reli-gious on three levels: personally (and corporately) to Christ, to the mission of the Church and to the congregation's mythology (which assumes a revitalized theology of religious life). The call to reconversion (or, as it is sometimes called, "second con-version") is the call to transcend previous levels of faith and love, to move toward a mature faith which transforms the person from disciple to steward, one prepared to give oneself without reservation to the mission of the Lord.56 St. Paul explains it in this way: "It is not that I have reached it yet, or have already finished my course: but I am racing to grasp the prize if possible since I have been grasped by Christ . I give no thought to what lies behind but push on to what is ahead"(Ph 2:120. The call to reconversion will invariably bring with it the request by Christ to an ever more radical experience of him--in his suffering, his facing of chaos and a sense of abandonment, his complete commitment to the will of the Father, his death -- before there is the "resurrection" of inner clarity as to what the Father wishes. To live as steward for others means we must first die to self: "He died for all so that those who live might live no longer for themselves"(2 Co 5:15). The poorer we are in spirit, the more preparted we are to spot and abandon our prejudices and our yearning for power over others. Freed from such obstacles we are open to see the Lord in others and in the events around us. Without the cross there can be no reconversion. Historian David Knowles, in the last paragraph of his detailed analysis of the causes of the decline of monasticism in England in Tudor times, warns: "When once a religious or a religious order ceases to direct its sons to the abandonment of all that is not of God, and ceases to show them the rigors of the narrow way that leads to the imitation of Christ in his love, it sinks to the level of a purely human institution, and whatever its works may be they are the works of time and not of eternity.''57 The message is that of the Gospel. It is as valid today as it was in the English Tudor times. There is an ecclesial dimension to the reconversion of the religious. Religious congregations exist to serve the Church. And the Church exists to serve the world that .is today in revolutionary change. Any reconversion will involve a recommitment to the mission of the Church in this world. This means listening to what the needs of the world are; it Review for Religious, Jan.-Feb., 1987 also includes the commitment to be bold in pastoral initiatives in response to these needs. Finally, reconversion involves the radical recommitment to the con-gregational mythology. The individual religious, united with Christ and inspired by the Holy Spirit, experiences the same kind of outrage that the founding person felt when he or she was confronted by the enormity of the chaos separating the Gospel on the one hand and the world in its need on the other. The reappropriation of the founding charism is first and fore-most the reliving of this original shock. The founding person's spirit breaks into our lives the moment we experience that shock. Anthropologist Bronislaw Malinowski justly speaks of myth as "a nar-rative resurrection of a primeval reality."s8 The primeval reality is the shock, the archetype, that belongs to sacred time or the time of the begin-ning that is relived here and now. The converting religious resurrects and relives the sacred time of the beginning once more in all its radicalness. At that point the founding charism lives again. The mythology is alive and active. Like the founding person, some of the reconverting religious will see what strategies are needed to help bridge the chaos. The people who have such gifts of insight and action are in fact re-founding persons, congrega-tional prophets. They should not be viewed as "loners" or "individualists" who lack a sense of community. Despite the very real danger of rejection by other religious, they retain a deep love of the found-ing mythology. They yearn, as did the founding persons, to draw others with them into a radical faith-community of congregational rebuilders. There is a fire in these people, a Gospel radicality that disturbs the com-placent, the spiritually leth-argic, those who have compromised with worldly values. Not all reconverting religious are called to be significant refounding persons. Most of us are rather called to exercise our discernment in discovering those among us who are gifted to be such people. Once these individuals have been spotted, our task is to join with them in aiding the congregation to move out of chaos into a new integration of the Gospel and the needs of the world.5" 3. Effective commitment to action: myth ritualization Myth is action as well as words. The action is the ritual dimension of the myth. Sacred time, primeval reality, breaks into life here and now. For myth ritualization there is required courage, a boldness of initiative and drive. In brief, an ongoing process of reconversion is necessary. In ritual we grab hold of the inner dynamism of the myth in action that is adapted to changed circumstances of time and place. Mythology, Revitalization and Refounding Religious Life Of course, we need to be open to the fact that in our discernment we may discover it is actually God's will for our community, province or congregation to die. Gospel resignation in the face of even congregational death will be salvific, a badly needed witness to many contemporary cul-tures of how death must be faced. Most Western cultures do everything possible to avoid facing the reality of death-chaos. From a Christian point of view, active submission to the realities of one's own death-bound nature becomes an act of obedient surrender to the Father, a total com-mitment to the full power of faith, hope and love.~° As it is for each Christian, so it should be for a religious congregation that discerns it is God's will for it to die: "Father, into your hands I com-mend my spirit" (Lk 23:46). Summary Myth is always an effort to reveal or articulate, and so to make compre-hensible, some truth about the world and our life in it. This truth cannot be grasped or known fully in itself but is capable of being expressed in and through symbols. The myth should attempt to articulate transcendental reality, to give the meaning behind ever changing experi-ences that influence human life, "to pin down an Absolute in which the human mind can rest with some feeling of security."~' Myths become distorted or cease to exist for several reasons. In particular, myths die because they are no longer relevant or because people refuse the self-discipline required by the myth. Myths are liminal phenomena, that is, their retelling gives meaning and security to people in the midst of personal or cultural chaos. If people are prepared to adapt their myths to new circumstances, then they will break through chaos into new life, and their myths will become vital bnce more. Religious congregations have their own particular mythologies. Today congregations are in chaos. They are confused about what to do, how to revitalize, how to discover what God is asking of them. They may even be fearful of what God will ask, now that their once secure struc-tures have disappeared. For revitalization to occur there needs to be a retelling by religious of their congregational mythologies. This retelling, if it is to be something more than a hollow nostalgic or sentimental recital of past achievements, must emerge out of a process of myth interpretation/ reconversion/discernment. Reconversion is the wholehearted abandonment to the Father's will in imitation of Jesus who "emptied himself., obediently accepting even death on the cross"(Ph 2:7,8). It is the admission that oneself and one's 40/Review for Religious, Jan.-Feb., 1987 congregation have an absolute need of God who alone is the ultimate source of security and identity. When this abandonment takes place, then the experience of chaos or confusion within oneself and the congregation becomes creative. Through poverty of spirit, the religious finds a way to discover the presence of God, the Absolute, the ultimate figure revealing laimself in the congregational myth. Strengthened by this grace of reconversion, the religious and the congregation itself are prepared to discern God's will in their regard. Through discernment religious may discover that God wishes the congre-gation to die. The free acceptance of congregational death is a salvific action. Or discernment may reveal that the congregation should come alive through reliving the experience that gave birth to the original congregational charism, but adapted now to new needs and circum-stances. Reconversion, discernment and reappropriation of the founding experi-ence will not take place as long as religious are not prepared to face these questions: Do we deny the existence of chaos within and without? If we acknowledge chaos, am I and my congregation willing to acknowledge its positive potential? Are we prepared to face the self-abnegation and abandonment to God, with its naked faith darknesses, as the prerequisite for congregational resurrection? I suspect that many of us still deny the reality of chaos. If some of us do acknowledge the creative potential of chaos, then perhaps our answers to the two last questions are a half-hearted "yes." A pity. If only we could reply with a firm "yes," then we would be on the way to dis-covering the riches of our congregational mythology. The Church, and the world, would be richer for this discovery. In the beginning, when God created the heavens and the earth, the earth was a formless wasteland, and darkness covered the abyss . Then God said, "Let there be light. (Gn 1:1-3). NOTES ~ See Raimundo Panikkar, Myth, Faith and Hermeneutics: Cross-Cultural Studies (New York: Paulist Press, 1979). 2 See Paul Ricoeur, The Symbolism of Evil (Boston: Beacon Press, 1967), pp. 161ff, and Interpretation Theory: Discourse and the Surplus of Meaning (Fort Worth: Chris-tian University Press, 1976). Mythology, Revitalization and Refounding Religious Life ' See John L. McKenzie, Myths and Realities: Studies in Biblical Theology (London: Geoffrey Chapman, 1963), pp. 182-200. ' "Symbol, Myth and the Biblical Revelation" in Theological Studies. Vol. 27, No.l, 1966, p. 1. ~ Lawrence Cada, Raymond Fitz, et al., Shaping the Coming Age of Religious Life (New York: The Seabury Press, 1979), p. 6. 6 Morton T. Kelsey, Myth, History and Faith: The Demythologizing of Christianity (New York: Paulist Press, 1974), p. 5. 7 Thomas Fawcett, The Symbolic Language of Religion: An Introductory Study (London: SCM Press, 1970), p. 101. 8 See Barbara Sproul, Primal Myths: Creating the Worm (San Francisco: Harper and Row, 1979), p. I. 9 Morton T. Kelsey, op. cit., p. 4. Also see Elie Wiesel, "Myth and History," in (ed) Alan M. Olson, Myth, Symbol and Reality (Notre Dame: University of Notre Dame Press, 1980), pp. 20-30. ~o See Bronislaw Malinowski, Magic, Science and Religion, and Other Essays (Glencoe, Illinois: Free Press, 1948), pp. 100f. " See Donald A. MacKenzie, The Migration of Symbols and Their Relations to Beliefs and Customs (New York: AMS Press, 1970), p. 5. '2Psychological Reflections: An Anthology of Writings, (ed) Jolande Jacobi (New York: Harper, 1953), p. 314. t~ See C.S. Kirk, Myth: Its Meaning and Functions in Ancient and Other Cultures (Cambridge: Cambridge University Press, 1970), pp. 275-280; and Percy S. Cohen, "Theories of Myth" in Man: Journal of the Royal Anthropological Institute Vol.4 No.3, 1969, p. 340. " Victor Turner, "Myth and Symbol" in International Encyclopedia of Social Sci-ences (Assen: Van Gorcum, 1977), Vol. 10, p. 579. ~ See (ed) Richard Cavendish, Mythology: An Illustrated Encyclopedia (New York: Rizzoli 1980), pp. 10f. For Freudian view see O. Rank, The Myth of the Birth of the Hero (New York: Robert Brunner, 1952), passim. ~6 See P. S. Cohen, op. cit., p. 341. ~7 See Richard Cavendish, op. cit., p. i !. ,8 Totemism (Boston: Beacon Press, 1963), p. 104; also Myth and Meaning (New York: Schocken Books, 1979), passim. For critique see Edmund Leach, The Struc-tural Study of Myth and Totemism (London: Routledge and Kegan Paul, 1967), passim. ~ See Victor Turner, The Ritual Process: Structure and Anti-Structure (Ithaca: Cornell University Press, 1969), pp. 96f. 2o Quoted in A.W. Reed, Treasury of Maori Folklore (Wellington: A.H. and A.W. Reed, 1963), p. 19. 2~ For overview, see B.C. Sproul, op. cit., pp. 5ft. "2The Sacred and the Profane (New York: Harcourt, 1959), p. 95. 23 See Leonard J o Biallas, Myths, Gods, Heroes and Saviors (Mystic, CT: Twenty- Third Publications, 1986), p. 24. 2, See B. Malinowski, op. cit., pp. 100f. ~ See L.J. Biallas, op. cit., pp. 258-282. 26 See Christel Lane, The Rites of Rulers: Ritual in Industrial Society -- the Soviet Case (Cambridge: Cambridge University Press, 1981), passim. ~7 See T. Fawcett, op. cit., p. 98. 42/Review for Religious, Jan.-Feb., 1987 '" Ibid, p. 277. '" Ibid, p. 98. .,0 See Victor Turner, "Myth and Symbol," op. cit., p. 576. ~' 7 Jan. 1985, p. 26. '~" Ibid, p. 20. See insights also by Christopher E Mooney, Religion and the Ameri-can Dream: The Search for Freedom Under God (Philadelphia: Westminster Press, 1977), pp. 17-60. ~ lbid, p. 23. ~' See lan Craib, Modern Social Theory: From Parsons to Habermas (Brighton: Wheat-sheaf, 1984), pp. 115-119. According to The New York Times (14 July 1985) Rambo was invoked at least a dozen times in the discussion on the aid to Afghanistan. Also comments in The Economist (UK), I I Jan. 1986, p. 12. '~ See T. Fawcett, pp. 52-54. .,6 V. Turner uses the expression "root paradigm." See hnage and Pilgrimage in Chris-tian Culture: Anthropological Perspectives (New York: Columbia University Press, 1978), pp. 248f. 37 See L.J. Biallas, op. cit., p. 20. 3, Op. cit., pp. 100f. '~ Op. cit., p. 95. ~0 See B.S. Sproul, op. cit., pp. 27f. ~ Ibid. ,2 See Andrew M. Greeley, The Jesus Myth (New York: Doubleday, 1971), p. II and passim. ~ See Lumen Gentium, par. 44. ~" A Gospel Path: The Religious Life (Brussels: Lnmen Vitae 1975), p. 101. ,s Ibid, p. 94. ,6 Followers of Christ: The Religious Life and the Church (Exeter: Burns and Oates, 1978), p. 12. ,7 See Raymond Hostie, S.J., The Life and Death of Religious Orders': A Psycho- Sociological Approach (Washington, DC: Cara, 1983), pp. 252-272. ~ Western Society and the Church in the Middle Ages (Harmondsworth: Penguin, 1970) p. 237. '~ The Religious Orders in England, Vol.3, The Tudor Age (Cambridge: University Press, 1959), p. 198. so "Vatican II and the Church's Response" in Theology Digest Vol. 32, No. 4, 985. ~' See R. Hostie, op. cit., pp. 248,251,269-275. Also G.A. Arbuckle, "lncultura-tion and Evangelization: Realism or Romanticism?" in (ed) Darrell L. Whiteman, Missionaries, Anthropologists and Cultural Change (Williamsburg: Studies in Third World Societies,1985), pp. 176-186. s2 See G.A. Arbuckle, "The Evolution of a Mission Policy: A Case Study (Marist Fathers)," in Missiology, Vol. 14, No. 2, 1986, pp. 131-145. s.~ See G.A. Arbuckle, "Refounding Congregations from Within: Anthropological Reflections," in REview Fo~ R~.~.l~ous, Vol. 45, No. 4, pp. 538-553. ~' See Francis, E. George, O.M.I., "Founding 'Founderology'," in R~vmw For~ R~t6~oos, Vol. 36, No. I, 1977, pp. 40-48. ' ~s For discernment explanation see John C. Futrell, S.J., "lgnatian Discernment" in Studies in the Spirituality of Jesuits, St. Louis, April, 1970. Spirituality of Jesuits, St. Louis, May, 1982, passim. Mythology, Revitalization and Religious Life/43 ~ See Magic, Science and Religion, op. cit., p. 101. ~" See comments by R. Hostie, op. cit., pp. 257ff. See helpful insights by John W. Gardner, Self-Renewal: The Individual and the Innovative Society (N.Y.: W.W. Norton, 1981), pp. xi-xviii and passim. ~o Johannes B. Metz, Poverty of Spirit (N.Y.: Paulist, 1986), p. 46. 6~ R.A. MacKenzie, S.J., Faith and History in the Old Testament (Minneapolis: University of Minnesota Press, 1963), pp. 63f. Christ the Center of Our Vowed Life by Boniface Ramsey, O.P. Father Ramsey's three articles on the vows of religion'are available as a single reprint: i - The Center of Religious Poverty ii - Christocentric Celibacy iii - Cruciform Obedience Price: $1.75 per copy, plus postage. Address: Review for Religious Rm 428 3601 Lindell Blvd. St, Louis, Misso~Jri 63108 Images of a Novice Director Melannie Svoboda, S.N.D. Sister Melannie Svoboda became novice director after receiving her Masters in "For-mative Spirituality" from Duquesne University. She may be addressed at Notre Dame Educational Center; 13000 Auburn Road; Chardon, Ohio 44024. For the past four years I have been novice director for my religious com-munity. During these years I have often reflected on what my ministry means to me. I have also shared with other directors our ideas and feelings about our unique role in community. This article is an outgrowth of that personal and shared reflection. It attempts to explore the question, "How does it feel to be a novice director today?" In doing this, I have resorted to the use of images. Although there are many images I could have selected, I have chosen four that I feel convey something essential about the role of novice director. I hope these images provide encouragement for others involved in forma-tion work. I also hope the ideas presented here might help those not directly involved in formation to a better understanding of this ministry. The In-Between Door The first image that comes to my mind when I think of my ministry is "the in-between door." Let me explain. In our provincial house the novitiate is located on the third floor. On that same floor is another wing called St. Anne's where many of our elderly and retired sisters have their bedrooms. Between the novitiate and St. Anne's is a set of double doors. One day, after recreation with the novices, I passed through those doors on my way to another part of the building. As I did, I passed two elderly sisters who were on their way to their rooms. One was using a cane; the 44 Images of a Novice Director/45 other was holding on to the railing along the wail. The sharp contrast between the novices and these elderly sisters struck me. I suddenly thought: being a novice director is a lot like being a door between two very different wings of the same building. In other words, I realized that a novice director is very much an "in-between person." Age wise, many of us directors do stand "in between" the younger and older members of our communities. Ministry-wise, we stand "in between," too. As members of our community, we bring to our ministry years of lived experience as religious. We have a sense of our com-munity's history and traditions, its successes and apparent failures, its struggles and joys, and its hopes and expectations for the future. On the other hand, as directors we come to know the novices well. We learn of their personal histories, their past successes and failures, their struggles and joys, and their hopes and expectations for the future. Thus, we stand "in between." As directors, we are aware of our respon-sibility to communicate to the novices what religious life is in general and how our particular community gives expression to that life. But we also sense a corresponding responsibility, to a certain extent, to convey to the larger community who the new members are and what they are bringing to religious life. Such an "in-between position" can be both painful and exciting. It can be painful because it has its own built-in tension. As novice directors, we sometimes feel "caught in the middle" or even "torn apart." We find ourselves thinking or saying to our fellow religious: "If only you could see how much the novice is struggling with right now, how much goodwill there is in her, you would be far more patient and understand-ing." Similarly, we find ourselves saying to our novices: "If only you could appreciate more what we have gone through as a community and what we have experienced in the past, you would not be so quick to judge." But being "in between" is exciting, too. As novice directors, we have a unique perspective on religious life. Many times we may be asked to explain or defend what the novices may or may not be doing. Like-wise, we may be asked to explain or defend the traditions and attitudes of the professed community. We can welcome this "in-between-ness" since it affords us the challenge to reassess continuously our values and priorities or simply to articulate our beliefs anew. The Big "Meannie" Several years ago I was teaching film study to high school seniors. One day a film arrived addressed to me. But there was a typing error on 46/Review for Religious, Jan.-Feb., 1987 the label. The letter "!" had been left out of my name, so instead of saying Sister Melannie the label read Sister Meannie. I laughed at that mistake back then, but, since becoming novice director, I have sometimes felt that I had been changed from Sister Melannie to Sister Meannie. Another novice director echoed this same feeling when she said to me recently: "I used to be a nice person. But since becoming novice director, I feel I've become an ogre." There are a number of factors that contribute to this feeling. Within the past several years there has been a movement in many religious com-munities to involve the larger community more in the initial formation pro-cess. Professed members have a greater sense of their personal responsibil-ity for welcoming and encouraging new members. Such a trend is basically very good. Like all of us, the novices need affirmation in order to grow, and today we see the larger community more and more provid-ing this affirmation. But the novices need to be challenged, too. They need to come to a healthy awareness of their weaknesses and shortcomings. Although the professed community does help out in this area, nevertheless, the primary responsibility for doing this lies usually with the director. One director explained it this way: "Novices are so few these days that sometimes the sisters bend over backwards to make the novice feel accepted. They do nothing but praise the novice -- I'm the one who has to tell her the things she doesn't want to hear." A few examples might clarify this. Perhaps a novice is lively and witty -- two characteristics that, in themselves, seem attractive. The pro-fessed might continuously affirm these qualities in the novice. But I, as director, might begin to see that the novice's liveliness reflects a deep need to be the center of attention. Her wit might reveal a lack of sensitiv-ity to the feelings of others. As director, I have to lead her to this aware-ness. That is hard to do. No one likes to bear bad news. No one enjoys confronting others on this level. But what makes it possible for us is to see such a confrontation within the context of love. Often I find myself asking the question; "Do I love her enough to be honest with her?" The Island In her Gift from the Sea, Anne Morrow Lindbergh writes (p. 40): '"No man is an island,' said John Donne. I feel we are all islands -- in a common sea." I agree with Lindbergh that we are all islands. But we novice directors can experience our "islandness" in very sharp and often painful ways. There are several factors that can contribute to the novice director's Images of a Novice Director/47' feelings of isolation. First, there's the simple fact that there are not too many novice directors to begin with. With the decline in the number of novices, there is a corresponding decrease in the number of directors. As a result, we directors have few "colleagues." This situation can lead to the feeling that no one really understands our unique stresses and frustra-tions. This sense of isolation can be intensified by the decisions we are called upon to make. Perhaps the most difficult decision in our ministry is the decision that a novice does not belong in religious life. Making such a decision, especially when there are so few novices to begin with, can increase a director's sense of aloneness or even rejection by the larger community. Fortunately there are steps we can take to ease our "islandness." In my diocese of Cleveland, for example, we formation directors meet regu-larly not only to plan our inter-novitiate program, but also to share ideas and experiences informally. There are regional and national organizations we can plug into as well as periodicals (such as this one) to which we can subscribe. Support groups are very popular today. Those of us involved in formation need such a support group in order for us to minister effectively and happily. The Gardener When I became novice director, I simultaneously began to grow some African violets. Perhaps something deep inside of me sensed a connection between ministering to novices and caring for plants -- I wasn't sure. But I received a few clippings from my mother and, within a relatively short time, I had a number of healthy looking violets. Now I know for sure: caring for these African violets is very similar to being a novice director. If there's one thing a good gardener knows, it's this: the gardener does not cause the plants to grow and flourish; he or she can only assist in their development. A good gardener is more observer than doer, more admirer than cause. The same is true for novice directors. Over and over again we have to remind ourselves that God is the formation director. We are mere assistants. This attitude of dependence and trust in God is not only fundamental for our ministry, it is refreshingly freeing. As directors, we can worry too much. We can become too impatient with a novice's apparent slow devel-opment. We may find ourselves saying: "She should be farther along by now," or "Prayer should mean more to him at this stage." Sometimes we can be tempted to intervene too much, to say too much, to control too much. Like a bad gardener, we may handle too much, water too much, Review for Religious, Jan.-Feb., 1987 and fertilize tOO much, thus causing more harm than good. But our experience in formation soon leads us to trust more in God -- in his way, in his time -- than in our own expertise. One of the great-est joys as novice director is being privy to tremendous growth in our directees -- growth thht sometimes occurs not according to the "law," but even seemingly contrary to the "law." This truth was brought home to me recently by one of my "baby" African violets. When I started this plant from a cutting, I knew I would have to wait many months, perhaps even a year, before I could expect to see any blossoms. But this particu-lar African violet surprised me. After only several weeks, although its leaves were extremely tiny, this plant produced not one, but two giant purple blossoms. The plant, by all rules, was far too young and immature to produce such splendid flowers, yet, there they were, beautiful to behold. That "infant" African violet is a reminder to me that, as novice director, I have to be ready for surprises in my ministry. The in-between door, the big "meannie," an island, a gardener. These are four images that come to my mind when I reflect on my ministry as novice director. When we use images to try to explain the essentially unexplainable, we are in good company, for Jesus himself resorted to images time and time again: "The kingdom of heaven is like a mustard seed., is like a buried treasure., is like yeast., is like a drag-net thrown into the lake." I hope these few images I have used, though incomplete and imperfect, might help draw us more deeply into the mys-tery of our formation ministry. Prayer for Peace Give me to see, O Lord, By Faith's clear vision, Troth that to other sight at best is dim. Grant me to know, O Lord, By Love's deep wisdom, Peace in the Cross, Christ in the Sign of Him. Sister Cecilia Ward, S.C. Sacred Heart Convent-- 6225 Walnut Street Pittsburgh, Pennsylvania 15206 Surrender: The Key to Wholeness William A. Barry, S.J. This is Father Barry's third article on the theme of "a peculiar sort of resistance to God." He continues to work in the formation of novices and may be addressed at Saint Andrew House; 300 Newbury Street; Boston, Massachusetts 02115. In two recent articles' I have discussed a peculiar sort of resistance to God, a resistance that seems to be the avoidance of good experiences. Recently in a prayer group discussion I received some more light on this puzzling phenomenon which I would like to share with the readers of this review, z Have you ever wondered about people like Bartimaeus, the blind beggar who receives his sight (Mk 10:46-51)? Did it ever occur to you that they might not want to be healed? Well it has occurred to me because there have been times when I have not wanted inner healing -- the heal-ing of resentment at a personal loss, for example. As a result I have thought that people like Bartimaeus have a rather remarkable kind of courage and hope in the future to want to be healed. Let us reflect on what it must have meant for Bartimaeus as he pon-dered the question Jesus put to him, "What do you want me to do for you?" If he allows himself to want his sight, two possibilities open up. His hopes could be dashed if it proves impossible for Jesus to fulfill his desires. Often enough, I believe, we limit our desires precisely so that we will not be too disappointed. On the other hand, he could actually receive his sight. But what then? After all, he now has an identity that revolves around being a blind beggar. Who will he be if he is no longer blind? He knows how to cope with who he now is; he makes a living and he gets attention and perhaps even pity from others. How will he live as a sighted person? Suppose that a great deal of his vital energy is fueled 49 50/Review for Religious, Jan.-Feb., 1987 by resentment of the trick life has played on him. What will it be like not to have that resentment? His friends will have to learn new ways of deal-ing with him as well. Indeed, they may not be willing or able to make the transition to relating to a man who is no longer handicapped. All of this may seem quite fanciful. Yet any counselor or spiritual director can testify that there is in us some power that is inherently con-servative, that wants the status quo to be preserved no matter how painful that status quo is. I may be between a rock and a hard place, but it is my rock and my hard place, and I know how to cope with the situation. Leaving it is very difficult, no matter how painful it also is to stay. Can we make sense of this difficulty that works against even desiring a change to something better? I have already pointed to one source of the difficulty. My identity can be wrapped up in my present status, whether that status is "blind beggar," "jil.ted lover," "bereaved husband," "unloved child," "unappreciated coworker," or whatever. To give up the identity may seem like giving up one's only self. Moreover, as already indicated, I have built up around this identity ways of coping with life, and even of earning a living. To change means to face an unknown, and perhaps worse future. There is, perhaps, a more subtle source of resistance as well. Freudian analysts speak of the covert gratification neurotic symptoms bring to the one who has them. There can be covert sexual and/or aggressive gratification, for example, in a wife's agoraphobia (fear of open spaces) because her husband has to stay at home more with her -- and also has to do the shopping. Suicidal people have been known to get gratification from the thought of making others guilty, miserable, even sick by their deaths. It may be that all of the status quos which we find so hard to give up provide some covert gratification. For example, Bartimaeus might well wonder whether anyone will pay attention to him if he is no longer blind. Again, to want to be healed of the resentment caused by a friend's hurtful remarks may mean that I will have to give up the covert hope that my friend is feeling pangs of remorse. We come close to the central insight I received at the prayer group. To want to be healed, to be changed, to become more whole means to surrender to life and to the future. The surrender involves two distinct, but interrelated movements, I believe. On the one hand, it means accept-ing my past as precisely what it is, my past. On the other hand, it means surrendering myself to the mystery of the future, ultimately to the Mys-tery we call God. We will look at each of these movements in turn. Bartimaeus must have accepted his past. He is a blind man, a blind Surrender: the Key to Wholeness beggar. He does not seem to wallow in resentment at what life has done to him; if he did, he would not have been able to ask so forcibly for his sight. To come to this point of acceptance he may have had to go through all the stages of grief described so well by Kubler-Ross.3 He may have denied his blindness, raged at it, at life, and at God, bargained with God, and become depressed. But now he has accepted that he is blind. And yet it is accepted as somehow past, as not controlling his freedom now, his freedom to desire a change. "Master, let me receive my sight." It is important to grasp the full impact of what it means for Bartimaeus, or anyone of us, to accept the past. It does not mean a stoic impassivity toward life. It does not mean a rosy optimism either. Life has dealt Bartimaeus a cruel blow, as it has dealt cruel blows to many people. Children have been subjected to abusive, unloving and unskilled parenting and have been psychically and spiritually scarred as a result. Loved ones have tragically and permanently been parted, and the surviv-ors are wounded deeply. To accept the past does not mean to condone everyone and everything. But it does mean to forgive in some deep way. SCren Kierkegaard makes a powerful statement while commenting on the biblical story of Tobias and Sarah. Recall that Sarah has become a mockery to her own maid because seven men had died on their marriage night to her. Now Tobias has asked to marry her. Many see Tobias as the hero. "No," says Kierkegaard: It is Sarah that is the heroine . For what love of God it requires to be willing to let oneself be healed when from the beginning one has been thus bungled without one's fault, from the beginning one has been an abortive specimen of humanity! What ethical maturity was required for assuming the responsibility of allowing the loved one to do such a daring deed! What humility before the face of another person! What faith in God to believe that the next instant she would not hate the hus-band to whom she owed everything!4 To accept the past as my past brings a freedom from it. But freedom does not mean that I am no longer the person that past has made me. Bartimaeus is who he is because he has been a blind beggar. So too, Sarah is who she is because of her.history of marriages. Another example is supplied by a response of a young man who was born a hemophiliac; at any moment of his life he could bleed to death from a simple cut. He was asked whether he wished that he had not had the illness. "How can I -- or anyone -- wish that the most important thing that ever happened to me had not happened? It is like saying that I wish I had been born on another planet, so different would I probably be. Put it this way: I would not have it any other way." 5 52/Review for Religious, Jan.-Feb., 1987 And yet with this acceptance there also comes a freedom from the past. Bartimaeus is free of the imprisoning identity: "blind beggaL" Even if he does not receive his sight, he is free to become blind Bartimaeus the poet, or blind Bartimaeus the husband of Mary, or blind Bartimaeus the follower of Jesus. Just as the young hemophiliac can, by accepting his past, become a doctor, a teacher, a husband who also hap-pens to be hemophiliac. To accept the past as my past means to accept a future limited by my past, but nonetheless a future. Erik Erikson calls his final developmental stage the crisis between ego integrity and despair. Ego integrity or wisdom is described in this way: "It is the acceptance of one's one and only life cycle as something that had to be and that, by necessity, permitted of no substitutions: it thus means a new, a different love of one's parents."6 Such wisdom, Erikson maintains, leads, to freedom from the inordinate fear of death. And this may be the crux of th