Suchergebnisse

AjN \Z r t SK*-*—*— DECEMBER, 1900 Qettysbtiir Mercury CONTENTS The End of the Nineteenth Cen-tury, 205 Pennsylvania College at the Close of the Nineteenth Cen-tury, 206 The Belles 208 The Mysterious Picture, . . 211 Father Hawkin's Observations, 215 King- of Reformers, . . .217 An Old Camera, . . .220 Editor's Desk 222 Elements of Inspiration in the Earliest Greek Poets, . . 224 Words add Things, . 228 A Financier, . 233 Book Review 236 Among Our Contemporaries . 236 FAVOR THOSE WHO FAVOR US. For Fine. Printing go to Tk J° Co Wile Prifltiig ftwe CARLISLE ST. GETTYSBURG, PA. C. B. Kitzmiller Leadership Dealer in Hats, Caps, Boots and Douglas Shoes GETTYSBURG, PA. R. M. Elliott Dealer in Hats, Caps, Shoes and. Gents' Furnishing Goods Corner Center Square and Carlisle Street GETTYSBURG, PA. IN THE CLOTHING and MEN'S fURNISHING Business It is strictly here—everybody knows it. Testimony'! The stock itself. The pen suffi-ciently nimble to tell all the good points of our ::::::: FALL AND WINTER. SUITS AND OVERCOATS has not been found. We will keep you dressed right up-to-date if you buy your Clothing and Furnishings here. : : : EDGARS. MARTIN, F^CIGARS AND SMOKERS' ARTICLES Chambersburg St., Gettysburg ST McPherson Block. No. li BALTIMORE STREET THE GETTYSBURG MERCURY, The Literary Journal of Pennsylvania College. Entered at the Postoffice at Gettysburg as second-class matter. VOL. IX. GETTYSBURG. PA., DECEMBER, 1900. No. 7. THE END OF THE NINETEENTH CENTURY. "Old Time's great clock, that never stops, Nor runs too fast nor slow, Hung up amid the worlds of space Where wheeling planets glow; Its dial-plate the orbit vast Where whirls our old earth free— Has pushed its pointers round again And marked a century." «^2> 'T'HE century ends. The startling records of to-day are being ■^ stamped upon the last lap of the scroll. Marvelous have been the achievements of the last ten decades. Strange are the inscriptions on the escutcheons of the nations of the world. May the American not cease to hallow the ground where rest the ashes of the sages, patriots and warriors! Remembered be the deeds of the fathers ; long live their admonition ! Soft be the breeze that sways the trees on the famous fields of battle! Forgotten the strife that stained our soil with blood! Firm be the future grasp of Labor's callous hand—recognized, in every sphere, the noble and the true! Appreciated be the heritage of the fathers ! Bared be every arm in defense of our common, sacred trust! Solid be the phalanx in freedom's holy cause! 206 THE GETTYSBURG MERCURY PENNSYLVANIA COLLEGE AT THE CLOSE OP THE NINETEENTH CENTURY. E. S. BREIDENBAUGH, SC. D. T N this last issue of the MERCURY for the nineteenth century it *■ is proper to consider Pennsylvania College in connection with the present condition of higher education in our country. While not attempting a complete survey, a few glimpses of the field will be a source of congratulation and encouragement in our work, and may be an incentive to further effort for advancing the interests of our college. During the last third of the century there has been a large in-crease in the number of college students, proportionally a larger increase than the increase in population. There are no available statistics to show whether the number of Lutheran young people in institutions of learning has grown in proportion to the growth of our church membership, there are sufficient facts to show that there has been a very decided increase in the number of our young peo-ple who are having the advantages of the higher education. This increase in number of college students is due in part, if not wholly, to the growing conviction that a higher education is advantageous to men in every field of activity. While formerly the college graduates rarely entered any other profession than the ministry, law or medicine, we now find a minority of all the college graduates entering these professions. In our own college we find in recent years an increasing number of our graduates entering on business or technical pursuits. This change in the life work of college men has accompanied and has been in part the cause of and in part the effect of changes in the college curriculum. There have been introduced into the curriculum many important subjects, which in the early part of the century were hardly thought of in connection with a college education. This large increase in number of subjects taught has necessitated the introduction of electives into the requirements for entrance to and graduation from college. The same conditions have lead to the opportunity being given to the student to substi-tute for Greek, L,atin and Mathematics, which formerly occupied nearly the whole of the college time, Modern Languages, Natural and Physical Sciences, History, Politics, etc., thus giving the student the choice of subjects in which he may specialize. At the same time the requirements for entrance and graduations have THE GETTYSBURG MERCURY 207 been notably increased. In all departments of study there have been changes in method of work which increase the labors of the teachers and require more and better study on the part of the pupils. Pennsylvania College has enlarged her courses of study —has adopted to a fair degree elective courses of study—and in every department has increased the requirements for graduation. These changes in subjects of study and methods of work have necessitated an increased teaching force and enlarged equipment. Our college has in recent years somewhat increased her teaching force and added laboratories of chemistry, biology and elementary mechanics. We have also greatly improved our accommodations for class work in new and convenient buildings. The duty of our college is not rivalry with our neighbors, nor is it at present to do university or technical work, but is to do the best possible for our constituency in providing a sound college training such as is demanded by the present times, to this end we need, and we need greatly, additional teaching force, increased facilities for laboratory work and larger library equipment. Our professors are required to teach too many subjects, and other subjects barely included or not included in our curriculum require attention which cannot be given them. While there has been no increase in the personal interest teachers have for their pupils, there has been a change in methods which requires more immediate individual work between teacher and pupil. This personal teaching in all subjects, while greatly benefiting the student, is a great drain on the vital power of the teacher. As the number of pupils increases the personal attention to individual pupils must lessen unless the teaching force is in-creased, thus enabling each teacher to have fewer subjects and a smaller number of pupils. Co-education has been adopted to a limited degree by Penn-sylvania College. If we desire to enlarge this work, which can easily be done, we must have suitable accommodations for the young women. There has been in our colleges a great change in the dormitory and other accommodations for students. What thirty or forty years ago was regarded as excellent is now deemed wholly inadequate by parents and pupils. In some places these provisions have grown to extravagant proportions, while Pennsylvania College 208 THE GETTYSBURG MERCURY has not developed to such a degree, we are in these respects fully abreast of the times. We find the college student yearly taking a greater interest in matters outside the college curriculum—this when properly guarded, is wise and of educational advantage. Our students have shown reasonable activity and had fair success in many of these enterprises, such as athletics, musical clubs, publications and debating clubs. With all these changes in college work—with the greater pressure of material things, with the ever increasing claims of study on the energy of the student and the accompanying greatly increased personal freedom and self-control of the individual student there has been an equally increased interest in religious subjects—this is shown in many ways, not the least being the activity of the College Y. M. C. A. and the accompanying Bible study. In this brief summary of the changing conditions of college work—and we believe they are changes for the better—we find that Pennsylvania College has been advancing in the same direction as the general educational world, and while there is always room for fuller growth, we feel encouraged with the past and are hope-ful for the future. These improving conditions are due to the diversified and united labors of trustees, presidents, professors,students,numerous liberal friends and the general loyalty of the alumni of the college. It is in reliance on the continued energy and loyalty of all these friends that we are assuredly hopeful for the future of our college. THE BELLES. J. B. BAKER, '01. Hear the singing of the belles— Choir belles! What a world of vanity their rhapsody foretells ! How they wrinkle, wrinkle, wrinkle, All the muscles of their bite 1 While the gems that oversprinkle All their tresses, seem to twinkle With a hyaline delight; THE GETTYSBURG MERCURY 209 Keeping time, time, time, In a faintly falling: rime, To the nasal proclamation that so dissonantly wells From the belles, belles, belles, belles, Belles, belles, belles— From the singing and the ringing- of the belles. II Hear the flippant summer belles, Giddy belles! What a string- of soda bills their coquetry foretells ! Throug-h the balmy air of nig-ht How they draw us out of sight! From their starting, darting eyes All aglow, What a funny feeling hies To the bosom of the lover, while he spies Not the bow. Oh, from out those spheric cells, What a gush of repartee extravagantly wells ! How it swells ! How it dwells On the future ! how it tells Oh the philter that impels To the flushing and the blushing Of the belles, belles, belles, Of the belles, belles, belles, Belles, belles, belles— To the flushing and the blushing of the belles. Ill Hear the loud alarum belles— Infant belles ! What a train of muffled oaths their noisiness compels ! In the startled ear of night How they scream out their affright! Too much horrified to speak, They can only shriek, shriek, Out of tune, In a clamorous appealing to the mercy of the sire, In a mad expostulation with his warm erratic ire Leaping higher, higher, higher, With a desperate desire, And a resolute endeavor To resign the job forever That he undertook alas, too soon. Oh, the belles, belles, belles What a tale their horror tells Of the crier! 210 THE GETTYSBURG MERCURY How they squirm, and kick, and roar, What a horror they outpour On the palpitating bosom of the sire ! Nor the father fully knows, By the wiggling-. And the wriggling, How the sulphur ebbs and flows ; But the mother t'is who tells, In the jangling, And the wrangling, How the danger sinks and swells, By the sinking and the swelling in the squealing of the belles,- Of the belles— Of the belles, belles, belles, belles, Belles, belles, belles— In the squealing and the reeling of the belles. IV Hear the moaning of the belles— Ancient belles ! What a world of sympathy their monody compels ! Through the day and oft by night, How our tears spring into light, At the melancholy mumble of their tone ; For every sound that floats From the rust within their throats Is a groan. And the lovers—ah, the lovers— They who go and wed some others, Altar prone, And who strolling, strolling, strolling, By discarded belles alone, Feel a glory in so rolling On the human heart a stone— They are neither false nor true men— They are neither brute nor human— They are fiends, And their king the devil, tolls, And he rolls, rolls, rolls, Rolls A threnode from the belles ! And his scaly bosom swells With a threnode from the belles! And he dances and he yells ; Keeping time, time, time, In his Tartarean grime, To the threnode of the belles— Of the belles; Keeping time, time, time, THE GETTYSBURG MERCURY 211 In his Tartarean grime, To the throbbing- of the belles— Of the belles, belles, belles,— To the sobbing- of the belles ; Keeping time, time, time, As he knells, knells, knells, In his Tartarean grime, To the groaning of the belles— Of the belles, belles, belles,— To the moaning of the belles Of the belles, belles, belles, belles— Belles, belles, belles— To the moaning and the groaning- of the belles. THE MYSTERIOUS PICTURE. STANLEY C. FOWLER, '04. 44QPEAKING of mysteries reminds me of a very curious, yes, ^ startling experience I had when a struggling young artist in Paris," said Wilbur Cutting. " What was that? " we asked. " Go ahead, let her rip, said Coleman, the irrepressible, "we're all attention." Wilbur puffed at his favorite corn-cob pipe and we all drew our chairs nearer the grate fire which burned cheerily and lighted up our cozy club-room. Presently we heard Wilbur's voice from behind a cloud of tobacco smoke, saying: "I was searching for a new model to pose for my 'Abraham.' I had been told of an old, patriarchal Jew, living in one of the many by-ways in the Latin quarter. While walking down a dingy, narrow alley, my attention was attracted by a picture lying on a heap of canvasses, in an old curiosity shop. Drawn by an irresistible impulse I entered and purchased it from the shop-keeper, a queer, little, old Orient, who seemed eager to dispose of it. I took it under my arm and hurried back to my studio, in-tending to retouch it. I placed it on my easel and scrutinizing it closely, marked what a peculiar face it was. Pure oval, the fore-head low and square, eyebrows high-arched meeting over a long, Roman nose, the nostrils were contracted, the mouth, tight shut, was cruel and sinister. The eyes had been scratched through the pupils, completely destroying its expression ; the hair, long 212 THE GETTYSBURG MERCURY and black as a raven's wing, was painted as though blown by the wind and finally blended into the deep crimson background. The head had the appearance of flying through the air, for there was neither shoulders nor neck. I failed to recognize the style and searched in vain for the artist's name. "I was soon at work on the eyes, hoping to complete them before the arrival of Archie Armstrong, a young American, who, attracted by the gayeties of Bohemian life, had adopted them as his profession. He had a rich, indulgent, spinster aunt, living in Paris, who descended periodically upon his studio, which was across the hall from mine, and purchased all his masterpieces. To tell the truth, the only parts of them not painted by me were his signatures, which he persistently painted in the brightest colors and in the most conspicuous places. He was expecting a visit from his aunt that afternoon and was about to make a raid upon my studio and carry off all the paintings, finished or not. "As I painted the eyes, it seemed as though an invisible hand was guiding or directing my brush. They were soon finished and I stepped back to see my work. What an expression ! Simply hellish. The eyes seemed like living coals of fire. They burned and blazed and seemed to pierce one through and through. I felt a most peculiar tingling sensation. "I looked at lny hands. No longer were they covered with oil and paint stains, but were changed to long, slender white hands with tapering fingers. My velvet jacket and paint covered trous-ers were changed to an evening suit. Even the studio had changed to a drawing-room elegantly furnished. "Stepping over to one of the mirrors that adorned the wall, I looked in. I started back with a cry of surprise and alarm. The face that had stared at me from the canvass now gazed back at me from the mirror. Could it be possible? Was it I? I raised my hand to my face and when the glass reflected the action, I knew then that I had changed. "Presently I heard footsteps and turning, beheld a young man advancing towards me with outstretched hands to welcome me. I hastened to meet him and he led me into an inner room where a young woman was reclining gracefully on a high-backed, old-fashioned seat. She blushed prettily as we entered and he presented me to her—his wife. As I bowed low and kissed the tips of her dainty fingers, I had an uncontrollable desire to kill THE GETTYSBURG MERCURY 213 her, take possession of me. I cannot explain it. It seemed as though I must kill her or myself. "The young man took me to his "den" where we were soon drinking her health. I took up a jeweled dagger from a table and told him of some murders I had heard of done under hypnotic influence. He asked if I believed in hypnotism and I replied in the affirmative, saying, that I could hypnotize him if I so desired. He seemed startled but continuing to drink heavily was soon in a stupor. "Seizing the dagger I stole into the room where his wife was; I raised it aloft and struck with all my might, again and again. As I felt the blade sink into the soft flesh, I could not refrain from laughing exultingly. I knew that when he was aroused from his stupor he would believe himself guilty of the crime. I think I must have been changed into the devil, for I chuckled and gloated over the misery that would come to the young man. "I stole away still gloating over my crime. Suddenly my face grew warmer and warmer. It seemed that flames were creeping slowly over my head. I screamed aloud for agony and then I must have fainted. "When I regained consciousness, I found myself in my own bed with Archie leaning over me and the.morning sun pouring in the window. " 'What has happened ?' I asked. " 'Blamed if I know,'said Archie, rubbing his head. 'Icame yesterday afternoon and nearly banged my fists off, trying to make you let me in. I heard you sputtering and as time was valuable, I pushed the door in and found you staring at the queerest picture I ever saw. You turned around to me sputtering gibberish and I took you into your room. I thought you had been indulging too freely. In the night you stabbed your lay figure with your pallet knife. You'll have a nice job replacing that gown. You had it spoiled before I discovered you. You've been raving until you screamed just now,' said Archie, looking disgustedly at me. ' 'I looked at my easel. The picture was gone. "'Where's the picture?' I asked. Archie looked sheepish and said: 'Well, auntie would have it. There's the check on the table.' % % if. ■%. % "That afternoon as I was relating my experience to Archie, the 214 THE GETTYSBURG MERCURY door flew open with a bang and in stepped his aunt with head erect and fire in her eye. Without returning Archie's greeting, she opened hostilities thus: " 'What do you mean by selling me that picture, sir ! I don't believe you painted it at all! I think the devil did ! ' " 'Why, auntie, you surprise me. What's the trouble,' asked Archie. " 'Trouble! Humph! I should say so. Trouble! There's been nothing but trouble since I brought that thing to my house. Why, when I had Henry hang it in my saloon with the rest of your paintings, he acted like a lunatic. Tried to stab me ! He raved so all last night about that picture that I took it down this morning and threw it in the fire, and as I did so, it shrieked! My nerves have had such a fright that it'll be months before they'll get quieted again. How did you ever get it, tor I don't believe you painted it? ' she finally asked Archie. " 'Well, I'll confess I didn't paint it. My friend Wilbur bought it in an old shop and I thought since you liked it, you know, when—er—that is—I thought you would like it better if you thought that I painted it. I am sorry that I deceived you, but shan't do it again,' said Archie, looking very penitent. " 'You'd better not, for I am very shrewd. I thought you didn't paint it,' said his aunt, and turning to me said: " 'Mr. Wilbur, if you would turn your attention toward art, as my gifted nephew has, and paint a few pictures like his, it would be better than tramping around buying such things as that picture and calling them your own as I guess you were going to do. I hope this will be a lesson to you, Archie. Don't follow in your friend's footsteps again or attempt to deceive me again, for I am too shrewd for you !' and off she stamped, followed by Archie, whose face was purple with suppressed laughter. I was in deadly fear of the eruption and heaved a sigh of relief as they disappeared. "All those symptoms Archie's aunt attributed to his shame and mortification he felt at being caught trying to fool her. "I made inquiries afterwards at the shop about the picture. All that I could learn was that the shop-keeper had bought it at the auction of the art treasures of a young man who had killed his wife and died crazy. It was said that he had imported the picture from the Orient, where it had been, probably, for many I THE GETTYSBURG MERCURY 215 years. It was the shop-keeper who had scratched out the eyes, for he said they haunted him. Whether or not I should have died mad, as did its former possessor, had it not been destroyed, I can't tell." e^pj FATHER HAWKINS' OBSERVATIONS. CHAS. W. WEISER, '01. Well, Lizer, I'se been up ter town, Ther college fur ter see, And talk about yer country Jakes— Ther same as you and me. Of bildins fine I saw a heft, That's fine as ever I've seen, And trees, and signs—"Keep off ther grass' I guess because its green. The Profs' got lots of larnin, And plenty fur ter spare ; But me thinks they need it all, Ter train thim fellers thare. So guess we'll send our Kier, Ter eddicated be, Fur he must have more larnin, Than ever you an me. I saw thim fellers go A stragglin long ther walk, Ther one he looked so strait ahead As any line of chalk. He looked not ter ther right er left, But just strait down his nose, And where that little nose did point, He always surly goes. Ther one did run his hands, Inter his pockets deep. With hangin head and crooked back, He ter the class did creep. His knees did knock each other gainst, And pigeoned were his toes. Well such er sight I niver seed Where ever I do goes. 216 THE GETTYSBURG MERCURY Another one went walkin long, A lookin at ther cloud ; His nose er pointin in ther air, His heels er stumpin loud. He wore er collar high er enough, Fer any six months calf ; And tie like my red handkichief, That made er feller laugh. And one he said "Wha don chu knaw" I took my "cut" ter day ; Another one he got er "zip," And wished he'd stayed away. They say they "horse," and "make a stab, An some times make a "break." But if I had them in my field, I'd make them take a rake. When yer do hear a college chap, Yer don't know what he says I guess its Latin—but don know, In all my born days. We send our men from off ther farm— They have some common sense ; Ther "city's" call them "greenies" But grapple for ther pence. But soon they larn to shporty dress, And know ther college slang, They come back with swellin heads, Too fine ter help er lang. They think they know a heft of stuff, And flaunt it in yer face, But 'fore ther thro' ther college course, They've set another pace. But don't cher know, I often see, Ther boys from off ther farm, Who think ther "dad" has got ther "mon," Make oft ther shports—yes marm. And tho I kin not spaik mam Like eddicated men I'm not so dull as ruff mam Tho' kin not hold ther pen. And so they musn't judge mam, 'Cause farmin is our lot, THE GETTYSBURG MERCURY 217 That we are slow and kin not tell Ef they're er man er not. They ortend fur ter be mam, More than thay really was, But live ter what ther trained fur, And not make sich a fuss. " KIING OP REFORMERS." GEO. W. NICELY, '01. Honorable mention Junior Oratorical. HPHE sixteenth century gave birth to the most remarkable man A the world has ever known. Welcome must have been the change in all Germany, created by the reformation. " From Germany proceeded the power which caused Rome, the once proud mistress of almost the whole world, to tremble, even when she was at the zenith of her potency. And from Germany also proceeded the power which shook the triple crown of the most artful religious and temporal usurper at modern Rome, and brought her to the very brink of inevitable ruin; it was in Ger-many where the morning dawn of a pure worship of the Supreme Being, and of a wise liberty of conscience was destined to arise." In order to realize, to some extent, the magnitude and im-portance of Luther's services to mankind in promoting the cause of freedom and progress, as well as in reformiug the church, it is necessary to recall the condition of the civilized world at the time he appeared and began his career on the stage of human affairs. In the beginning of the 15th century the church was almost universally corrupt, and popes and bishops and people were alike involved in the general demoralization. For a hundred years before the papal chair was occupied by princes, most of whom attained their elevation by intrigue and bribery, and some even by assassination. " It was an age of monasticism." Thousands of men and women in all countries had renounced the world and entered into monasteries and convents to lead lives of superior holiness, but these retreats from the world had changed from their original character and many of them were now places of in-dolence and sensuality. Guiler Von Kaiserburg declares that convent life had become a mere mockery. Infessura, a Roman 218 THE GETTYSBURG MERCURY historian, says: "Everyone in Rome knows, alas, that monas-teries have now become dens of corruption.'' Such was the general character of the clergy, from the pope down to the lowest priest; and such also was the condition of religious teachers. Ignorance, superstition and immorality prevailed generally among them. All who questioned the authority of this complex despotism, or denounced its usurpations, were soon silenced or crushed. John Huss and Jerome Prague suffered martydom at Constance for preaching the truths of the gospel a hundred years before Luther; Savoiiavola, at Florence, met a similar fate in 1498. Thousands of others were persecuted, imprisoned, assassinated, tortured to death; hunted down like the wild beasts, or burned to the stake, for worshiping God according to the dictates of their own con-science, for reading the scriptures or for exposing the wickedness and usurpations of the clergy. It was under this state of civil and ecclesiastical despotism, when corruption and profligacy were dominant in the church, and ignorance and superstition prevailed among the people, that Luther appeared and entered upon the great work of reform, for which God had prepared him. It is difficult, if not impossible, at the present day to appreciate the magnitude of that work. All sources of power and influence in church and state; all customs and habits of the people for generations; all existing institutions and the entire structure of society were against him, and had to be assailed, confronted, overthrown and reformed. The word of God was buried in the Latin vulgate version, which only the educated few could read, and copies were so dear and scarce that they were inaccessible to the common people, even if they had been able to read them. " It was one of the achievements of Luther, and a service of ines-timable value to the Germanic nation, that he translated the Bible and gave it to the people in their own tongue, so that all could read it and know that the doctrines he proclaimed were the living truths of the living God, before whom popes and kings and priests and all men were alike accountable." But Luther's work was not confined to reforming the church and furnishing the Bible to the people. It was not only the overthrow of usurped ecclesi-astical power and the restoration of religious toleration and free-dom in Europe. It was all this, but it was also more. There is not an interest or reform affecting human welfare in modern civilization—whether educational, social, industrial or THE GETTYSBURG MERCURY 219 political—upon which Luther did not shed the light of his great intellect and soul, enlightened by the word and spirit of God. He taught that it was the duty of the state to educate all the children of the people in order that they might become intelligent and useful citizens; and thus he was the pioneer advocate of uni-versal education four centuries ago. In quelling the outbreak of communism in Germany, known as the "peasant war," he de-clared it to be the duty of all to be subject to " the powers that be," and to acquire property, not by the plunder and robbery of others, but by industry, frugality and honesty. In an address to the princes and nobles of Germany, he taught the reciprocal duties of rulers to their subjects, and of subjects to their rulers, suggest-ing the fundamental principle announced in our Declaration of Independence, that governments, though " ordained of God, de-rive their just powers from the consent of the governed." " I will call this Luther a true, great man," says Carlyle. " Great in intellect, in courage, affection and integrity, one of our most lovable and precious men; great, not as a hewn obelisk, but as an Alpine mountain, so simple, spontaneous, honest, not set-ting up to be great at all; therefore quite another purpose than being great. A.h, yes, unsubduable granite, piercing far and wide into the heavens; yet, in the clefts of its fountains, green, beautiful valleys with flowers ! " "In my judgment," said Senator Wellington of Maryland, " Luther is the greatest man that hath yet lived." "Challenging the license To make gain of sin, Luther nails his protest; Listen to the din. "Striking with his hammer— How the panels shake— How the gateway trembles— How the timid quake! "Blows on blows resounding, Echoed from afar; How the world is shaken, How the churches jar. "We to-day are feeling Heart and conscience thrill, And throughout the ages Men will feel it still. 220 THE GETTYSBURG MERCURY "Till the death-stroke's given To all force and fraud; For the striking' hammer Is the word of God." AN OLD CAMERA. P. W. EYSTEB, '03. A BOUT twenty years ago there lived in Dowingtown, about •**■ thirty miles west from Philadelphia, a young man by the name of Warren, whose ambition it was to succeed. He started out in life by teaching school in his native town. So, during the school term he was busy, but during vacation he did all kinds of work about his home. His neighbor was a photographer, and business being dull, he sold his old camera to Mr. Warren at a small price. After young Warren's school had closed, he packed up his camera and left the town, visiting the small villages and towns, to take the pictures of buildings and family groups. Finally he came to a small vil-lage called Pleasant Hill. There was at the time a small show in the place, and as Warren was strolling over the show grounds, he saw an Italian organ-grinder, and a curly-headed boy about six years old on whose face were the features of an American parent-age. Just then the intoxicated assistant-manager of the show came out of a nearby hotel, and tossing to the organ grinder a dime, said, "Make the little rascal dance." The organ grinder, after a few kicks and cuffs, got the boy to dance. The photographer, Mr. Warren, was among the onlookers and took a picture of the Italian and the daucing boy. Warren went to his lodging place, and after developing the picture, put it with others in his traveling case, forgetting all about it. Not meeting with much success at Pleasant Hill, he went to Ardmore, a suburb of Phila-delphia. He took the pictures of the pretty houses and beautiful scenes to be seen in and about Ardmore. One morning as he was stopping before a large sandstone house, preparing to take a pic-ture of it, a handsome lady, on whose face were signs of inward grief, came walking across the lawn, and commenced to talk with the photographer. THE GETTYSBURG MERCURY 221 This was the house of Mr. Sheffield, a wealthy Philadelphia banker, who lived in Ardmore, and conducted his business in the city. About five years before, his little only son, then one year old, had wandered into the street and was kidnapped. Mr. Shef-field offered a large reward to any one who would make known the whereabouts of his child, but was not successful. Mrs. Shef-field, who admired children, was so grieved at the loss of her only child that she, at times, came near losing her reason. She would every morning, at the time the child was kidnapped, walk across the lawn as if looking for some one; and she Could frequently be heard repeating a low prayer, in which she asked but one favor from God—the return of her sou. This accounted for her pres-ence on the lawn at this time. Mr. Warren invited her to look over the pictures in his travel-ing case while he was fixing the camera. She examined them all till she came to the last, the picture of the organ-grinder and the curly-headed boy; and as she recognized the boy's picture, she exclaimed , "Oh, my boy, my dear little George," and fell over fainting. Just then Mr. Sheffield came; arid Mrs. Sheffield soon recovered sufficient to hand the picture to Mr. Sheffield, He took a long look at it, and judging from the tears that rolled down his cheeks, one could easily tell what his feelings were. Mr. Sheffield asked young Warren where and when he had last seen the organ-grinder and the little boy. Warren gave Mr. Sheffield the desired information, and in less than four hours the police in every town and village in eastern Pennsylvania were looking for an organ-grinder and a little boy, who answered the description of those on the picture. Both were soon found. The organ-grinder, who was the kidnapper, was dealt with according to law and the child was sent to the home of his loving mother. The boy grew up to take part in his father's business, and to-day the Philadelphia firm of Sheffield & Son is well known. The young photographer received from Mr. Sheffield the reward which gave him a good start in business. At present Mr. Warren lives in Baltimore as a retired mer-chant, and he often tells his friends about the old camera stored on the garret of his house. THE GETTYSBURG MERCURY. Entered at the Postoffice at Gettysburg as second-class matter. VOL. IX. GETTYSBURG, PA., DECEMBER, 1900. No. 7. Editor-in- Chief, S. A. VAN ORMEK, '01. Assistant Editors, W. H. HBTEICK, W. A. KOIILEH. Business Manager, H. C. HOFFMAN. Alumni Editor, REV. F. D. GARLAND. Assistant Business Manager, WILLIAM C. NEY. Advisory Board, PROF. J. A. HIMES, LIT. D. PROF. G. D. STAHLEY, M. D. PROF. J. W. RICHARD. D. D. Published monthly by the students of Pennsylvania (Gettysburg) College. Subscription price, One Dollar a year in advance; single copies Ten Cents. Notice to discontinue sending the MERCURY to any address'must be accompanied by all arrearages. Students, Professors, and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYBURG MERCURY, GETTYSBURG, PA. EDITORS' DESK. "VVTE hear with regret of the death of Business Manager Hoff- " man's father. Mr. Hoffman was summoned home some weeks ago on account of his father's illness, and accompanied him to a Philadelphia hospital, where an operation to save his life was performed in vain. The MERCURY extends sincere sym-pathy to the bereaved family. Since the close of the foot ball season there is a noticeable in-crease in interest in the work of the literary societies. Special programs were rendered in both societies last evening (Dec. 7)— THE GETTYSBURG MERCURY 223 in Philo, "An Evening with Kipling"; in Phrena, "A Mock Trial.'' Both halls were filled. It is to be hoped that enthusiasm in and the healthy rivalry between the two societies will continue increasing as time advances. A college man is expected not only to talk intelligently on the current topics of the day but also to meet his adversary in debate with clean-cut, forcible arguments. Men are needed who can think accurately and think on their feet. That Gettysburg men may be the better able to meet these de-mands, a course in Argumentation has been provided for. It is in charge of Professor Klinger, whose enthusiasm and magnetism will prove a source of inspiration to the members of the class, which, added to a knowledge of the principles of Argumentation and practice in the application of these principles, will amply pay for the time and energy expended. As this is the last issue of THE MERCURY for the year and for the century, we wish to bespeak a continuance of the kindly feeling and hearty support of the journal on the part of the stu-dents, alumni and friends of the college. We wish all a pleas-ant vacation, and hope that all may return with renewed ambition and high ideals. When we shall have been transported by the machinery of the world into a new century, may we behold a "New Era" that con-tains bright visions for the coming years ! *3^ab Do not look for wrong- and evil, You will find them if you do; As you measure to your neighbor, He will measure back to you. Look for gladness, look for gladness, You will meet them all the while; If you bring a smiling visage To the glass, you meet a smile. —Alice Cary. 224 THE GETTYSBURG MERCURY ELEMENTS Of INSPIRATION IN TME EARLIEST CREEK POETS. C. M. A. STINE, '01. "VVTHAT do we mean when we speak of a book as inspired ? " What is the signification of the word inspiration? These two questions present themselves at the very outset of the subject. The word inspiration means, literally, a breathing into, that is, it is the breathing of God's spirit into the mind of man. When we speak of a book as inspired we mean that it makes the divine will known to man, or contains some great principle or truth in regard to the life of man. It is in this sense of the word that we use the terms inspired and inspiration. In considering the elements of inspiration in the earliest Greek poets we naturally inquire what these elements are in order that we may know what to look for. Let us consider the subject from three standpoints: first, the revelations of God and of the hereafter which they gave to their readers ; second, any prophecies which they contain ; third, their influence upon Greek morals and civilization. Homer and Hesiod are the earliest Greek poets of whose works we have any definite knowledge. The great epics of Homer and the "Theogouy" and the "Works and Days" of Hesiod may fairly be considered as representative of this earliest known period of Greek poetry. Hesiod, in his "Theogouy," as the name indicates, endeavored to harmonize and systematize the numerous myths in regard to the gods b}' arranging the gods themselves in the order of exact genealogy. Homer portrays the gods as grand in the strength of their passions and in their power, yet they leave the impression of being scarcely more than human beings endowed with great power and with immortality. In the Iliad they take sides against one another. Zeus at first is not favorable to the Greeks, and they realize that without the favor of Zeus it is useless to fight. They therefore prosecute the war by wiles and by spies till Zeus has been propitiated. The power of Zeus is recognized, but there are none of the attributes portrayed as pertaining to him which belong to the true God. In his portrayal of the character of Athena, Homer gives the loftiest conception of the Deity. Athena is mind personified. She is without the lower attributes and the petty jealousies which attach to the. other gods. Athena, "the flashing eyed," is essentially the goddess of the keeu-witted THE GETTYSBURG MERCURY 225 Greeks. It is necessary that the Greek be constantly on the lookout not to offend the Deities, and if by some mischance a god or goddess is offended, it is necessary that the offended deity be placated at any cost. The various divinities have their favorites over whom they watch and whose actions they direct. In the first book of the Iliad Athena is represented as restraining Achilles by his yellow hair when he is about to draw his sword against Agamemnon : ***** jiffy g> •AOrjvrj ******* * * * l-avOTfi $k ho/ir/i HX* TTTjXziwya, (II. I. 193-201.) Again, in the Odyssey, she assists Teleuiachus to set out from Ithaca in search of his father, and watches over the wandering Odysseus. But how far is all this from the love of the Christian Jehovah ! There is a power spoken of against which it is useless to strug-gle or to appeal to the gods. The decrees of the fates are unalter-able. Even the gods themselves are subject to them. As com-pared with the Christian idea of God as the supreme power there is a wide difference to be noted here. Homer gives a high con-ception of God, when it is remembered that he was a pagan, but the Zeus of Homer and of Hesiod is far indeed from the God of the Christian. From the foregoing we see, first, that there is no clear revela-tion of the attributes of God; second, that there is no idea of Provi-dence; when a guiding hand is revealed it is still within the limitations of stern fate. As to revelations of the future life, the hereafter as painted by Homer is gloomy and forbidding. Instead of regarding the soul as the real ego, and the body merely as a fetter from which the soul is freed at death, the soul is regarded by him merely as a "shade," the shadow of the physical body. This life is all, and there awaited the Greek after death a joyless exist-ence in a gloomy twilight at best, and perhaps even the tortures of Tartarus. He makes the shade of the great Achilles in Hades to say: "I would be A laborer on earth, and serve for hire Some nian of mean estate, who makes scant cheer, Rather than reig-n o'er all who have gone down To death." Od. XI. 489-90, (Bryant's Trans.) 226 THE GETTYSBURG MERCURY Such a conception of the hereafter must certainly be regarded as unfavorable to the attainment of the highest and noblest life. As to the revelations of God and of the hereafter as contained in these poems we may say that God never reveals half of himself, or in contradictory lights, nor can an idea of the hereafter be for a moment entertained as the correct one if it is hostile to the attainment of the noblest life and the fulfillment of man's highest ideals. Second, as to the element of prophecy as contained in these poems. Prophecy, strictly defined, is "a prediction under divine influence or direction." We ask then, what predictions are there in the works of these poets and what indications do these predic-tions give of having been made under divine influence or direction ? These poems contain not a single instance of this kind of prophecy. It is true that Homer represents predictions as uttered and later on as fulfilled, but there is no prophecy made by either Hesiod or Homer in regard to the future. The predictions of oiacles are mentioned, and later on we see the fulfillment of these predictions worked out as the action of the poem moves on, but in no case is a prophecy in regard to future ages uttered. We come next to the influence which the works of these poets had on the morals and civilization of the Greek people. It is from this third standpoint that we are most likely to speak of these poems as inspired. The"Theogony" of Hesiod moulded the vast number of myths which we find to have existed in that early period into an orderly, polytheistic theology and was accepted as authority by the Greeks. Any book which brings the idea of God nearer to a people and gives more definite form to that idea, whatever form it may be, will have an influence for good upon the morals of that people. In this way such a book as the "Theogony" must have influenced Greek morals. Hesiod's "Works and Days," however, came nearer home to the hearts of the common people. This poem is a sort of a farm-er's calendar, and in addition to the enumeration of the various lucky days for sowing, etc., it contains a collection of precepts, ethical, economical and political. While the style is homely and unimaginative there is a lofty and solemn feeling throughout, found-ed on the "idea that the gods have ordained justice among men, have made labor the only road to prosperity, and have so ordered THE GETTYSBURG MERCURY 227 the year that every work has its appointed season, the sign of which may be discerned." A poem of this character certainly had a beneficent effect upon the minds of the people. It is before the immortal Homer that we must pause in wonder and almost in awe. The influence of the Iliad and the Odyssey upon the Greek mind can hardly be over-estimated. Tbe char-acters which stand forth in his poems, with their matchless symmetry and trueness to life, even to this day, twenty-five hundred years after the writing of the poems, play a part in the formation of the ideals of all who read them, and cannot but enoble the reader. Nausicaa, the loveliest of Homer's female creations, is a character which, in her innocence and her queenly maidenhood, has scarcely ever been equaled. Penelope is the ideal of a con-stant wife, faithful and unswerving in her affections through the most trying experiences. Hector is an ideal of a loyal, unselfish patriot. While no less brave than the fiery Achilles, he is yet more human than that mighty warrior, who has been rendered by the gods practically invulnerable. The appeal of the white-haired Priam for the body of his son will never fail to touch human hearts. With characters such as these ever before them in the lofty poetry of Homer, Greek minds could not fail to be purified and ennobled. Their influence upon the general culture of the age must have been very great, and they are therefore treated as one of the great factors in Greek civilization by many historians. To sum up, we find that while these early poems failed to give the highest conceptions of God, contain nothing of the idea of the fatherhood of God and the brotherhood of man, and were entirely lacking in the element of prophecy, they, nevertheless, were of the greatest value in the education of the Greek people and the advancement of civilization. In this third aspect, at least, they do not fall short of that lofty ideal which we expect an inspired work to fulfill. While we are not warranted in conclud-ing that they were inspired, yet so long as either Hesiod or Homer are read, the homely truth of the former and the superb genius of the latter must command our highest admiration. 228 THE GETTYSBURG MERCURY WORDS AND THINGS. D. C. BUBNITK, '01. I ANGUAGE is God's gift to man. The lower animals pos- *~* sess memory, will and intellect, and in a few cases even the ability to repeat words; but to man alone has the Creator given the power of expressing his thoughts in words. This dis-criminate use of words is the most prominent mark of difference between man and beast. The value of language is realized when we try to imagine man without it. How limited would be his knowledge and how nar-row his range of thought, for he would be unable to receive from his fellows one single idea with which to compare his own thoughts, and thus arrive at new conclusions. Nor would reason have any value without words to communicate to others its re-sults. What would be the extent of scientific knowledge today had Copernicus, Newton, Franklin and all the host of discoverers been unable to preserve their results in words? "Thoughts without words are nothing." * Words are valueless without a knowledge of the relations they bear to the things for which they are the symbols. But an ex-tensive knowledge of their significance is inestimable, for upon this foundation rests all learning—that alone which can procure true appreciation of life and its blessings. Acquaintance with the real meanings of words is necessary to scholarship. One must be able at a glance to discern that which lies back of a word, the thing for which a word stands. He must have appropriate terms with which he can readily give accurate expression to his own thoughts. "A word fitly spoken," says Solomon, "is like apples of gold in pictures of silver." T_et us attempt to substitute one word for another in a passage of Milton, and we destroy the effect of the whole. It was Webster's accurate selection of words that placed him in history. How do we acquire this ability to join the right word with the right thing ? This faculty, like most other endowments, develops with age. The infant hears a word and learns by mere observa-tion what thing it represents. He wishes to denote an object or express a thought, and his elders supply him with the necessary words. And this process of obtaining the meanings of words may be pursued in this same manner all through life. No con- *Max Muller. THE GETTYSBURG MERCURY 229 scious effort in this direction need be made in order to prosper, but to pass into the sphere of education one must apply himself to the work of definition; he must faithfully consult his dic-tionary. The student's vocabulary is also increased, as in the case of the infant, by being supplied with the ideas before he is given the corresponding terms. That is, a definition may precede the word it explains. This is the modern inductive method of teaching, especially in the natural sciences. By it we are lead first to form a conception and then given the appropriate word. By repeated use every word whose meaning is understood be-comes a complete possession. But not only mere definition and repetition suffice to procure for us in all cases true appreciation of the meanings of words. The things for which some words stand must be experienced before their real significance lies open before us. Who knows what the word "sorrow" really means but him who has had trouble ? The mild tempered person can-not realize fully what lies back of the word "anger." The true meaning of "ocean" is inconceivable to him who has never be-held its beauty. Words are living beings to one who has expe-rienced the things they represent. One of the greatest obstacles to retard our progress is the lack of this absolute requirement for advancement—total command of the words in common use. We wonder why this is. Of course some of us lack original capacity to understand words, and some of us have not had sufficient opportunities to obtain a good vocabulary. But most of us have this capacity and have had the best of chances, and yet we are deficient. The failure to understand and use words in their true import can generally be traced to the habitual disinclination to do that which requires .special effort; in short, we have been lazy. It is surprising how few of us are willing to attribute some of our fail-ings to that cause. Many of our present shortcomings are owing to wilful neglect in the past. In the case in hand we have failed to perform the fundamental process. We have procrastinated, deferring the definition of unfamiliar words till "the next time." We have done this again and again, and now when we attempt higher pursuits, we find our error. An exceedingly large proportion of persons are in this condi-tion. And it is to be deplored that a very large part of those in 230 THE GETTYSBURG MERCURY this plight do not seem at all anxious to remedy their condition. How shiftless and inaccurate is their use of words. How feeble their attempts to argue, or even to hold intelligent conversation. The artisan must have materials with which to work. He who would make his thoughts known must have suitable words. But these persons are satisfied with their poor attempts, both to ex-press their thoughts and to understand the thoughts of others. "The world," says Paschal, "is satisfied with words; few care to dive beneath the surface." How true this is. We see it everywhere. Where it is possible the student uses his memory. Words, empty words, are all he tries to obtain; and, sad to say, he gets what he is after. He fails to see beyond the narrow present into the broad future. He strives for present reputation and marks, and he gets them; and that is all. He soon loses words, and he has never received their corresponding ideas, and all that is left is a record "on the books," which in these days of the survival of the fittest, counts for naught. But then there is that large class of persons who do thoroughly realize the necessity of greater command of language, who do want to make up for past neglect. How can we accomplish this ? "There is no royal road to learning." The rudiments of any study must be mastered before there can be advancement. We must now do what we have before neglected. We must use our dictionaries and weigh the significance of each word before we attempt to use it. To attain the highest use of language we must not pass by a single word without thoroughly understanding the thing it stands for. Extreme care must be exercised in the selec-tion of words with which to express our thoughts. Constant watchfulness is the price of success. This work of improvement is an arduous task, the performance of which persistence alone can accomplish, but the end fully repays the effort. Who that has reached this goal would trade his accomplish-ment for all that man could offer? With this possession one dwells upon a higher plane than that of his less intelligent fellow. By it he is brought a step nearer to the Being with whose help he obtains it. No other acquirement can produce such pleasure as this knowledge of the relations of words to things. THE GETTYSBURG MERCURY 231 THE REFINING FIRE IN NATURE. J. R. STONER, '01. A T that period of the year when the process of oxidation is **• going on more rapidly than at any other, preparing nature for a state in which she may resume anew the forms of activity and life,—look out over the landscape ! The autumnal equinox has ushered in another season to succeed the vanished summer, and the robe of verdure is changed into the beautiful golden garb of autumn. The forest and the grove reflect a hue of amber and gold as they lie in the distance, bathed in the rich sunlight against the blue background of the sky. It is but the flame of this burning process in nature now fanned into a great conflagration consum-ing all that has flourished in the past year that is no longer of value in the economy of nature, except it be decomposed into its elements and taken up in the formation of other substances. But all is not consumed. The golden grain and the fruit of the tree; that which at one time appeared but as an obstructed growth of leaves, now contains within its narrow shell the capability of un-folding in another life. By its persistence in complying with the law that turns all hindrances to good effects, while it could not assume the beauty and prominence of a leaf in the bright robe of the herb or the tree, but submitting to its allotted destiny, it grad-ually developed into the permanent kernel, able to survive in the test under which the leaf must perish. We see all around us the work of nature purging the earth of all that is useless at the end of a period of creative activity or growth, preparing for another period of vigor and work. By means of this oxidation or slow burning "all effete substances that have served their purpose in the old form are burnt up" and only that which has the promise of life and usefulness passes un-harmed through the ordeal. Without this conflagration by which the earth is swept in autumn, there could be no.new, fresh growth in nature. Through the amber flames of autumn comes the pure, fresh verdure of spring. Everywhere is this refining fire purg-ing the universe of all that is worthless, perpetually tending to bring it into a purer state. Even the rivulet, whose crystal waters have been made foul by the natural contamination of the soil over which it has flown, is made purer by being thrown into a state of agitation as it ripples down over the obstructions in its way. The grand column that dashes precipitately over the awful 232 THE GETTYSBURG MERCURY cataract and is separated into multitudinous particles of spray reaches the plane below in a purer state ; because the molecules have been bathed in the refining element of oxygen pervading the atmosphere. Thus we see that hindrances or adversity in nature are the means through which all great and phenomenal feats are brought about. And may not this principle be traced into the ethical life of man ? Surely all great heroes of the past, whose deeds are worthy of immortality, and whose careers merit the height of fame they have attained, have been disciplined by the stern school of adversity. They were men who met the hindrances with a de-termined will that would not flinch, when faced by difficulties, or cower in the presence of misfortune, their destinies were not moulded by circumstances ; but circumstances were controlled by their high destiny, the goal of their illustrious lives. And as a consequence the hindrances they met and surmounted prepared them to survive in the refining fire of trial, and instilled into their very sinews pure and noble principles of life. Thus estab-lished in character, they came from the ordeal all the more beauti-ful for having been submitted to the test. Arduous accomplishments that require an extraordinary amount of perseverence, patience, tact, and earnest toil should not be looked upon disparagingly. They are but the means, the testing fire, as it were, by which those who are fit to rise high in the walks of life, to take charge of responsible positions and to wield the sceptre of influence over the world in a manner to di-rect it in the channels of righteousness, are separated from those who are frivolous, trifling, insignificant idlers. And like the evergreen,—fitting emblem of the eternal that it is,—as it stands robed in its brilliant garb, unscathed by the withering effect of the autumn frost and the snows of winter, an object of life stand-ing out in sharp contrast with the seemingly lifeless world around it; so shall those, who have stood the test, be clothed in immor-tality though all things else may perish. CQgj 111 fares the land to hastening' ills a prey, Where wealth accumulates and men decay. —Goldsmith. THE GETTYSBURG MERCURY 233 A PINANCIER. FRANK 8. FITE, '01. \ HAD the rare privilege, some forty years ago, to make the ac- * quaintance and to be favored with the confidence of a finan-cier who had risen to eminence from the lowest social grade. As a beggar boy, his exceptional talent for begging had roused the enthusiasm of a set of elderly maidens, who were attracted by his peculiar cry of helplessness and his boast of honesty. They put him to school. He learned there the fundamental principles of arithmetic, and little else; but his aptitude for trade was devel-oped in a marvelous degree. All the spending money of the scholars was invariably found at the end of a vacation in Chaucey Alcott's pockets. Yet, no boy could say that he had been cheated. All the fellows felt that their bits of silver coin had mysteriously disappeared in their various business relations with Alcott; but still they reluctantly confessed that everything had been "fair and square." He was said to be "on the dead level," yet plucked them, it would seem, pitilessly; but he stood by his own contracts, as he compelled them to stand by theirs. No act of positive dishonesty was ever proved against this plausible, cautious and relentless trader. The boys declared that he was shrewd, cunning and hard, yet he was "so obliging!" They disliked him, and at the same time accepted his services. Could they have caught him in any act of rascality his life would have been made a misery, but he was so discreet in his early preparation for his future career that, at the age of ten, he already gave promise of the great merchant and banker he eventually became. On leaving school, young Alcott found that his possessions amounted to thirty dollars. Instead of rushing at once to the elderly maidens who had helped him he went to the city and offered himself as clerk in a wholesale fish house. The senior partner was attracted by his evident talent and felt his youth renewed in looking at the youngster; he gave him a position in his counting room at once with a salary of fifty dollars a year. The keen youth, seeing at a glance that his employers were pious misers, instantly became, to all appearances, a pious miser himself. But in the course of five or six years he astonished the firm by show-ing that he knew more about the wholesale fish business than they did, and had made some money by quiet speculation of his 234 THE GETTYSBURG MERCURY own. They oSered to double, treble, quadruple his salary, but nothing would satisfy Alcott but a partnership in their question-ablegaius. This they refused and Alcott promptly set up for himself on a small capital of money but a large capital of knowledge and intelligence, and soon cornered his former employers in a few heavy dealings and put them into bankruptcy in twenty-four months after he had left them, with the skillful use of their own methods. In the course of a few years he ventured cautiously but surely into other departments of commerce. He became a general merchant and at last assumed the dignity of ship owner and shipped his o-oods in his own vessels. He had two grand qualifications for business: his mind was quick and his heart was hard. In all financial panics he collected what was his due relentlessly, regard-less of the suffering it might bring upon nobler people than him-self; and paid all his own notes punctually as they fell due. To "fail'' was to him the worst of crimes. Almost everybody detested him, yet all knew that they could rely both on his word and his bond. Such a merchant, perhaps, should be judged by his own prin-ciples ; he had no sympathy with the great body of merchants of the country and laughed at all such sentimentality. "Get the better of 'em," was his motto. About this time he was a little wearied with commerce and bonds and stocks held for him the charm which merchandise had lost. He had obtained about two million dollars and amazed the moneyed world by a rush into Wall street, where he became a gigantic stock-jobber and banker. Here, as in school, the same shrewd, cunning characteristics were manifest, and slowly at first, but surely, his fortune increased and he obtained big commissions on the doubtful and worthless securities he sold; but just as his school-mates, those wbo relied on him could not assert that he had done anything to forfeit his reputation for honesty. It was at this point that I happened to have the honor of being one of his clerks, and in a short time his confidential one. I at once noticed his profanity. Everybody and everything interfering with his business designs brought forth a volley of oaths. There is probably no greater shock to the mind of an honest, well-intentioned country lad who is sent to confront the tempta- THE GETTYSBURG MERCURY 235 tions of a city, with a mother's prayers hovering over him, than when he finds his employer is a rascal disguised as an honest man. Shall he also become a rascal ? Shall he stoop to scoundrelisms which his inmost soul abhors ! His behavior under such circum-stances is a test of his character ; his father, mother and sister, if he is fortunate enough to have a sister, combine all their moral energies to help him. There is no reason why the boy should have more privileges thau the girl, but the fact that he has is too evident to admit of a doubt. The denial of sisters to advance their brothers is one of the tragedies of human life. The re-verse SHOULD be the case, but unfortunately is not. But to return to my theme. As soon as I found out Mr. Al-cott, I began to look upon him with a certain horror. He had the greatest confidence in my honesty and even allowed me to sign his name to checks, but when I suggested that my services were worth more than I received, and that fifteen hundred would but partly recompense my unceasing work in his journal and ledger, he used his favorite formula and cursed me and my ser-vices roundly. He really thought that my services were due his pre-eminent position, though he was aware that I might ruin him in a single day had I chosen to "skip" at the close of business hours with his stocks and bonds. It is curious that I never had the slightest temptation to use the vast powers with which Mr. Alcott endowed me, for I might easily have become a millionaire in some European country had I chosen, like my employer, to become a rogue. I witnessed, as do clerks every day, the process of plundering, without any desire to plunder the plunderer. His wife, a meek woman, whom he swiftly scared into the grave, left him a daughter. She appeared to me a foolish, gig-gling creature, with large black eyes, a pug nose, and a complex-ion which was red to the point of ignition. A younger clerk in the office, much to our amusement, with a salary of five hundred dollars a year, declared that he was madly in love with her and convinced her of his sincerity ; as it was ridiculous to suppose that the father would consent to such a match, the clerk and heiress eloped and were married. When Alcott heard of it, he blasphemed with a savage fluency that was Wonderful even in him. His son-in-law was a bright fellow, however, with some rich connections, and with their backing, soon appeared in Wall Street. He made money, backed as he was, and Mr. Alcott went deliberately to work to ruin him, but at first he didn't succeed, as the son-in-law, in an early "corner in Erie," took eight hundred thousand out of his father-in-law's pocket: but this only stimu-lated Mr. Alcott and he ventured his millions without stint in an attempt to "corner" his son-in-law. [Continued.] 236 THE GETTYSBURG MERCURY BOOK REVIEW. Quicksand, by Hervey White :—Small, Maynard, and Co., $1.50. QUICKSAND is the life history of a family with many more downs than ups. It is divided into three parts, in each of which a particular member of the family is the central figure, although all the members of the family enter into each divi-sion. The birth, boyhood, education, marriage, struggle for literary fame, and tragic death of Hubert form a conspicuous current in the narration. The varying dispositions of the members of the family, the appearance of the Indian, Maude, and the faithful hired man give an abundance of variety. The characters are depicted in striking detail, and the descriptions of the three homes (which the cover-ing of shame made necessary) are complete. The effect of a number of follies (crimes in some instances) are so clearly brought out as to emphasize the necessity of straight forward living. AMONG OUR CONTEMPORARIES, TT has not been the policy of THE MERCURY to devote much *■ space to an exchange article, but we feel it our duty to say something at intervals of those journals of other institutions, the reading of which gives us much pleasure and is profitable. The fact that an exchange article was crowded out of the November number explains why, in a few instances, reference is made to October numbers. The University of Virginia Magazi?ie is one of the most com-plete literary journals on our table, and the November number is an especially good one. It contains an article on "Keats—A Conscious Reformer of English Poetry," that is worthy of study. "The Quiet Indian's Ghost" in the November Touchstone is a well written story. The editor makes a strong appeal to the "men of Lafayette" in behalf of the literary journal of the insti-tution . The recent changes in the form and general get-up of the Pharetra make it the neatest and most attractive of our exchanges. The material is of a high grade, and the pen-sketches add ma-terially to its attractiveness. THE GETTYSBURG MERCURY 237 "The Living Relic of Barbarism" in the October Ursinus Col-lege Bulletin is decidedly above the average oration in beauty and in force. An increased number of pages of literary material should accompany the change of The Bulletin from a biweekly to a monthly. The November Midland contains in its literary department a poem by Longfellow and one from the Denver News, an article by an alumnus and one by a student. Will this encourage liter-ary work among the students at Midland f The Dickinson Literary Monthly has materially raised its standard and, in general, does not suffer in comparison with the best; but the November number contains a partisan article that is unworthy a place in a college journal. Those interested in the educational condition of Puerto Rico will find an interesting article by Dr. M. G. Brumbaugh in the Juniata Echo for October. The Echo is to be congratulated on being able to publish these articles. We regret that the Novem-ber number did not contain one. "The Spanish Arnaida," an outline with explanations, by Stanley Ecker in The Western University Couranl reflects credit upon the author and the journal. It is the result of effort and thought. The poetry of The Lesbian Herald is an important feature of the publication. A well written article on "The Sun's Eclipse," accompanied by a photograph of the total eclipse at Centreville, Va., May 28, 1900, appears in the last issue. ««*£> "Over and over again, No matter which way I turn, I always find in the book of life Some lesson that I must learn ; I must take my turn at the mill, I must grind out the golden grain, I must work at my task with a resolute will, Over and over again." PATRONIZE OUR ADVERTISERS. C. F?. SOLT MERCHANT TAILOR Masonic Bldg., GETTYSBURG Our collection of Woolens for the coming- Fall and Winter season cannot be surpassed for variety, attractive designs and general completeness. The latest styles of fashionable novelties in the most approved shades. Staples of exceptional merit, value and wearing durability. Also altering-, repairing-, dyeing and scouring at moderate prices. .FOR UP-TO-DATE. Clothing, Hats, Shoes, And Men's Furnishing- Goods, go to I. HALLEM'S MAMMOTH CLOTHING HOUSE, Chambersburg St., GETTYSBURG, PA. ESTABLISHED 1867 BY ALLEN WALTON. ALLEN K. WALTON, President and Treasurer. ROBT. J. WALTON Superintendent. Hummelstomn Bromn Stone Gompany Quarrymen and Manufacturers of Building Stone, Sawed Flagging and Tile Waltonville, Dauphin Co-, Pa. Contractors for all kinds of Telegraph and Express Address. Cut Stone Work. BROWNSTONE, PA. Parties visiting the Quarries will leave cars at Brownstone Station on the P. & R. R. R. For a nice sweet loaf of Bread call on J. RAWER Baker of Bread and Fancy Cakes, GETTYSBURG. PA. EIMER & AMEND, Manufacturers and Importers of Chemicals and Chemical Apparatus 205, 207, 209 and 211 Third Avenue, Corner 18th Street NEW YORK. Finest Bohemian and German Glassware, Royal Berlin and Meissen Porcelain, Pure Hammered Platinum, Balances and Weights. Xeiss Mi-croscopes and Bacteriological Apparatus; Chemical Pure Acids and Assay Goods. SCOTT PAPER COMPANY MAKERS OF FINE TOILET PAPER 7th and Greenwood Ave. PHILADELPHIA PATRONIZE OUR ADVERTISERS. The Century Double-Feed Fountain Pen. Fully Warranted J6 Kt. Gold Pen, Iridium Pointed. GEO. EVELER, Agent for Gettysburg College PRICE LIST. No. 1. Chased, long or short $2 00 No. 1. Gold Mounted 3 00 No. 3. Chased 3 00 No. 3. Gold Mounted 4 00 Spiral, Black or Mottled |2 SO Twist, " 2 SO Hexagxm, Black or Mottled 2 SO Pearl Holder, Gold Mounted S 00 THE CENTURY PEN CO., WHITEWATER, WIS. Askyour Stationer or our Agent to show them to you. Agood local agent wanted in every school ^Mirmm^fr^wmmwwMmmmmmmwmm^ Printingand Binding We Print This Book THE MT. HOLLY STATIONERY AND PRINTING CO. does all classes of Printing- and Binding-, and can furnish you any Book, Bill Head, Letter Head, Envelope, Card, Blank, or anything- pertain-ing to their business in just as good style and at less cost than you can obtain same elsewhere. They are located among the mountains but their work is metropolitan. You can be convinced of this if you g-ive them the opportunity. Mt. Holly Stationery and Printing Co. K SPRINGS, PA. 73iUMtimU4UMtMlJUiUJUiUiU4UJUJUJUiUM R H. S. BENNEP, .DEALER IN. Groceries, Notions, Queenswcire, Glassware, Etc., Tobacco and Ggars. 17 CHAMBERSBURG ST. WE RECOMMEND THESE BUSINESS MEN. Pitzer House, (Temperance) JNO. E. PITZER, Prop. Rates $1.00 to $1.25 per day. Battlefield a specialty. Dinner and ride to all pointsof interest.including the tb ree days" fight, $1.25. No. 127 Main Street. You will find a full line of Pure Drugs and Fine Sta-tionery at the People's Drug Store Prescriptions a Specialty. J. A. TAWNEY^_ Is ready to furnish Clubs and Boarding' Houses with Bread, Rolls, Etc At short notice and reasonable rates. ■Washington & Middle Sts., Gettysburg. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp Eagle Hotel. GETTYSBURG, PA. MUMPER & BENDER Furniture Cabinet Making, Picture Frames Beds, Springs, Mattresses, Etc. Baltimore St., GETTYSBURG, PA. .GO TO. fyotd (Gettysburg 3arber Sfyop. Centre Square. B. M. SEFTON W.F.CODORI, S£Sf)op (Successor to C. C. Sefton) Having thoroughly remodeled the place is now ready to accommodate the public Barber Supplies a Specialty. .Baltimore Street. (itrrT*l5£UR(i, PA. ESTABLISHED 1876 PENROSE MYERS, Watchmaker and Jeweler Gettysburg Souvenir Spoons, Col-lege Souvenir Spoons. NO. lO BALTIMORE ST., GETTYSBURG, PENNA. L. f\. MltW Manufacturers' Agent and Jobber of Hardware, Oils, Paints and Queensware. GETTYSBURG, PA. The Only Jobbing House in Adams County.

JUNE, J899 ooTlhe, Qettysbur ercury CONTENTS. Our College Home 117 The 1900 Spectrum 119 Tick-tack-to 120 A Hero's Reward 123 An Art Fad 125 Retrieved 128 Editor's Desk, 131 Hypnotism 131 " The Influence of Christianity on Roman Jurisprudence ". 134 The Conflict of the Ag-es 139 The Philomathaean Society 144 Monotony of Life 147 Athletics 149 YMMUM FAVOR THOSE WHO FAVOR US. wmomrn For Fine Printing GO TO The J. E. WIBLE .Printing Rouee Carlisle Street, GETTYSBURG, PA. C. B. Kitzmiller, Dealer in Hats, Caps, Boots and . Douglas Shoes GETTYSBURG, PA. J. H. Myers, Fashionable Tailor, Clothier and Gents' Furnisher. The best place in town to have your Cloth-ing made to order. All workmanship and Trimmings guaranteed. No charge for re-pairs and pressing for one year. Dyeing and Repairing a specialty. Ready-made Clothing the largest stock in town. Up-to-date styles. Bicycle Suits and Breeches Headquarters. 11 Baltimore St., Gettysburg, Pa. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp. Eagle Hotel. GETTYSBURG, A. Have you an assured livelihood? "Would you try for a government posi-tion, if you knew just how to apply, and the kinds of positions from which you can choose, and what to do to insure your getting on the list after you have applied! The Government of the United States is the best of employers. Fair compen-sation, regularity of payment, reason-ably Bure tenure, tasks not too difficult, | ana hours not too I ong, offer strong at-tractions to young persons of both sexes whohavenosettledinuome. Manyenter Government employ, spend their spare i hours in studying law or medicine, or finance, and save enough from their salaries to start in a professional or business career. We have just published a book from whichanj/candidate maylearnjustwhat is necesaary and what unnecessary in brushing up his studies for an examina-tion ; and what his chances are, all things considered, for making bis way into the Civil Service, and staying there. The title of this book is " How to Prepnre for a Civil Service Examination; With Recent Questions and An-swers." It contains all Information which any candidate would require to firepare for any competitive office under ' he Government, and includes a "Ten Weeks' Course of 8tudy,"ln the form of questions actually asked at recent ex-aminations, with the correct answers to i them. Besides the technical require- ' mentSjitalso covers all the elementary branches, like arithmetic, spelling, pen- , manship, geography, letter writing, civil government, etc., etc., so that one who masters this course of study would not only pass well an examination for a gov- , ernment position, but would be sure of I preferment over other applicants for a clerkship in a business house. CLOTH—$2.00 Postpaid—560 PAGES Anotherbookfree(Quickat Figures)if you mention this paper when ordering. HINDS A NOBLE, Publishers 4-5-13-14 Cooper Institute, N. Y. City Schoolbooks ofallpublishers at one store .THE. GETTYSBURG MERCURY Entered at the Postoffice at Gettysburg as second-class matter. Voi,. VIII. GETTYSBURG, PA., JUNE, 1899. No. 4 Editor-in- Chief. J. FRANK EEILMAN, '00. Alumni Editor. REV. F. D. GARLAND. Assistant Editors. LUTHER A. WEIGLE, '00. S. A. VAN ORMER, '01. Business Manager. Assistant Business Manager. JOHN K. HAMACHER, '00. CLARENCE MOORE, '02. Advisory Board. PROF. J. A. HIMES, L,IT. D. PROF. G. D. STAHLEY, M. D. PROF. J. W. RICHARD, D. D. Published monthly by the students of Pennsylvania (Gettysburg) College. Subscription price One Dollar a year in advance, single copies Fifteen Cents. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. OUR COLLEGE HOME. Oh bright for us the sunbeams rest On tower and town with rosier glow, On sentry Round Top's rugged crest And on the immortal Ridge below, Where marble Victory's fadeless bays The patriot soldier crown, And History graves for future days The deeds of his renown. CHORUS—Then ring we clear a loyal cheer, Wnere'er we rest or roam, For Gettysburg, for Gettysburg, Our famous College home,— Hurrah, hurrah, hurrah ! O fair for us the moonlight falls, To brighten with its silver flame At once the stately College halls wmm 118 THE GETTYSBURG MERCURY. And the memorials of fame That peer from every grove and grange, And in their silence tell That here heroic spirits range O'er meads of asphodel. CHORUS—Then ring we clear a loyal cheer, Where'er we rest or roam, For Gettysburg, for Gettysburg, Our honored College home,— Hurrah, hurrah, hurrah ! O soft for us the shadows play Among the Campus elms, and woo To merry converse and delay From tasks we busily pursue. Ah Youth and Friendship, how ye charm In Learning's calm abode,— True Graces, twining arm in arm On sweet Arcadian sod ! CHORUS—Then ring we clear a loyal cheer, Where'er we rest or roam, For Gettysburg, for Gettysburg, Our glorious College home,— Hurrah, hurrah, hurrah! At morn the duty-call of bells Rings clear and urgent, near and far, At eve a gentler music swells From gleeful viol or guitar. O jolly is the life we lead In study, song or games ! O fortunate the fate indeed That here inscribes our names ! CHORUS—Then ring- we clear a loyal cheer, . Where'er we rest or roam, For Gettysburg, for Gettysburg, Our dear old College home,— Hurrah, hurrah, hurrah ! Energy will do anything that can be done in this world; and no talents, no circumstances, no opportunities will make a two-legged animal a man without it. —Goethe. THE GETTYSBURG MERCURY. 119 THE J900 SPECTRUM. THE most recent claimant, in our midst, to literary and ar-tistic honors, is the class of 1900. Its Spectrum, just is-sued, challenges our admiration from start to finish, and we heartily accord to it equal rank with the best of our college annuals, thus far issued. The form of the book, and the general arrangement of its con-tents, show a pleasing appreciation of responsibility in the plac-ing of details to secure good effects. There has been an evident purpose on the part of the printers, publishers, managers, artists and editors, to produce a work which should be alike creditable to themselves, as well as to the college which this publication represents. The volume is fittingly dedicated to Prof. Klinger, who is justly characterized as "both teacher and fellow student." The various classes and associations are given due recogni-tion by verbal statement, cut, pencil and photograph. The latter are unusually good throughout and constitute an attractive fea-ture. The sketches, are, as a rule, very clearly executed, and are amusing without being either vulgar or rude. The "Literary Record of Gettysburg Alumni," is an import-ant feature and will add permanency to the value of this publication. It will be interesting and profitable for our alumni and friends to have a record of this sort for handy reference. The "Spanish War Record" is not less interesting and valu-able. It is something for us to be proud of, that when our coun-try needed men to prosecute a war in the interests of humanity, against a cruel oppressor, that twenty-eight men, from our grad-uate and undergraduate ranks, cheerfully enlisted and did honor-able service. The humorous thoughts and aspects of college life, receive literary embodiment in the concluding pages of the volume. These show a commendable degree of appreciation of humor, in both possible and impossible, but easily imagined situations. It is a pity that so much of this kind of literature, must necessarily go unappreciated, for it requires an acquaintance with the dramatis personae and the conditions under which described events happen, in order to extract all the flavor of humor which makes them en-joyable. ■MMtimp mum. 120 THE GETTYSBURG MERCURY. This volume is certainly deserving of hearty recognition, and it is hoped that many of our alumni and friends of the college, will show their appreciation of the arduous labors of the class by acquiring a copy. Reader,—it will add permanent value to your library. Send for a copy at once. —G. D. S. TICK-TACK-TO. THERE is scarcely a conversation indulged in with a greater relish, by persons of a maturer age, than that relating to bygone games and pastimes. The children love to linger by the hearth and will listen with rapt attention, as their father relates to them the strange and antiquated games of his boyhood days. There are, perhaps, few things that brighten the eyes of our sires more readily than mere mention of puerile games. They love to cast away the titles of Rev., Dr., or Mr. and think of the time " when you were Bill and I was Joe " and, if one is in their presence when they are exchanging reminiscences he may be both instructed and agreeably entertained. Nor is the relish for this peculiar sort of conversation peculiar to those who have already passed the meridian of life and can no more win for themselves the eclat of the beholding multitude, or the more modest commendation of a few admiring friends, or even the laudatory look of defeated opponents. It belongs also to us. What conversation can be introduced into our college boudoirs that will be more highly appreciated and rejuvenate happier reminiscences than that relating to the games we used to play. The occasional rehearsing of them forms a condiment whose pungency quickens our appetites for more solid and substantial forms of mental food. As such, however, they tend only to excite pleasure and enter-tain, and are evanescent in their effects. If, on the other hand, we view them in a more serious manner and forget them as prolific of. an almost boundless store of sport and hilarity, we may not only become instructed but learn, to our amazement perhaps, that we are playing the same old games to-day. THE GETTYSBURG MERCURY 121 To demonstrate this we might choose almost any one of the limited number of juvenile games as an example. Since they all bring forth some phase of life and all contain some suggestion for reflection. Blind-man's-buff for instance, teaches us how gro-tesquely we often grope after the fleeing prizes of life. Leap-frog portrays to us the use to which we are sometimes put by men of ulterior motives and the humility connected therewith, but there are some, however, whose peculiarities stand out in bolder relief than in others ; some whose lessons are more drastic than others, and in few is this more obvious than in the triplicate game of tick-tack-to. It is very simple and probably the most universally known game of childhood. As a palladium against the captiousness of the nursery its charm is talismanic. In point of economy there are few games that excel it: a pencil, a slate or a small slip of paper with two parallel lines drawn perpendicularly upon it and two similar ones crossing them horizontally constitute all that there is of a material outlay. A series of three marks occupying three successive spaces in any direction brings to a proper conclusion the course of the game and suggests to us now, what in childhood's happy hours were arcanums unraveled. One of them is contained in the nature of the game. Unlike many other of our juvenile pastimes tick-tack-to is not a game of luck nor chance but a game of skill and intelligence. Were it a game of luck we would be at a loss to derive any lessons from it and could certainly not compare it to life; since those who have attained to the highest success in life cherish little hope for the man who depends on luck. One of our beloved martyred Presidents, the lamented Jas. A. Garfield, once said, "Luck is an ignis fatuus. It leads to ruin but never to success." The idea that certain men are rich, or prosperous, or popular, because they were born under such circumstances under which it would be impossible for them to be otherwise, finds little credence among successful men. It is not the man who is born at a certain time, in a certain place and under certain environments who attains to success but he who works; he who is active; he who is alive to every oppor-tunity; he whose every mark is prompted by an intelligent judgment. 122 THE GETTYSBURG MERCURY. Another deduction that we can 333ke from the game and apply to life is the mode of procedure. "We used to play7 it under dif-ficulties. Our advance was retarded by opposition. This of course is a common condition to all games and would not distinguish this particular one from any other; but the unique-ness of it lies in the fact that the opposition is created by one op-ponent and only one. Thus in the game of life we proceed against hindrances and against hindrances of but one opponent. Who is that opponent? Who is he, or what is it, that barricades our onward march every time we take a stride toward success ? Who is he who with rude hand dashes a cross before our line of progress every time our success is partially and almost entirely accomplished ? Is he to be found in the personality of some one other than ourselves ? May we detect him among the multitudes that pass before us from day to day ? May we discover him among those with whom we are continually associated ? No, prospection will never reveal him, introspection may. We have but one opponent to contend with, and that oppo-nent is self, the lower self; the material as opposed to the spiritual self. We sometimes suppose that our embarrassments in life, are traceable to external circumstances, to some person or company of persons, or to some combination of circumstances. But they are only the marks used by ourselves against our-selves. They form the media through which our lower nature reacts upon the higher and thus continues the dualisdc game of life. St. Bernard appreciating this fact once said "Nothing can do me damage but myself," and if we wish to reject authority can we not by a little self-examination verify this statement within the scope of our own experience ? Does not the soul in becoming cognizant of the virtue of a certain act urge us to do it ? Does it not in the language of the game place its mark in one of the spaces ? What follows ? The body shrinks from the performance of the act. It opposes the impulse of the soul. It places its mark directly before the one already made. No sooner has this taken place than the conscience comes into prominence. Not willing to acquiesce with one repulse it incites us to a redoubled effort. It places its mark before the THE GETTYSBURG MERCURY. 123 original one in another direction. This being done up swell the passions and endeavor with vehemence to thwart the noble im-pulse and crush all that is holy and pure in man. So the game proceeds with vacillating fortunes until the lower or the higher na-ture is conqueror. A contest it is trying and severe, unheard by mortal ear, un-seen by mortal eye. Revealed only to Him under whose dispen-sation it is possible and under whose guidance only, success is at-tainable. —MARKS. A HERO'S REWARD. IN the spring of 1825, Mr. Perry decided to sell his plantation, very reluctantly however, for it was here that he was born, and then with his family, which consisted of his wife, a son, Philip, and a daughter, Mabel, to go North. It was at Mr. Hall's suggestion that he located in a small town in the northern part of New Jersey and went into business with him. These two families had known each other for years and naturally at once there sprung up a friendship between Philip Perry and Mr. Hall's only son and child, Tom; but from the start Tom seemed to have an especial regard for Mabel, which grew into an affection as they grew in years. The Perrys belonged to one of the old, aristocratic, south-ern families, and were, as most such families were, wealthy. The Halls were also quite independent, though not in such affluent circumstances. The two boys were sent to a small military academy near New York and graduated in the same class. A short time after this Mr. Hall was taken ill and died very suddenly, and a year later Mrs. Hall died through grief for her dead husband. Mr. Perry was also affected by his partner's death and having closed out the business, moved South and located in Richmond, Va. He in-sisted that Tom should go along and make his home with them, and Tom, with a little persuasion from Mabel, did so. The boys went to a southern college, where they stood high both in their class and in the esteem of their fellow students, for they were good, jolly boys. During this time the affection be-tween Mabel and Tom ripened into love and Tom often wished in-wardly that some day he might win Mabel for his wife. y—^——™—™——— miyiiyi 124 THE GETTYSBURG MERCURY. After their college days both young men had entered Mr. Perry's employ and held positions of trust and responsibility in his cotton mill. So well, indeed, did they manage their work, that Mr. Perry was about to entrust the entire management to them when that dreadful war, which so nearly resulted in the division of our Union, was declared. Recognizing his duty, Philip Perry at once left home and enlisted in the 9th Virginia Regiment. Tom Hall hesitated. He was undecided as to what to do. He knew full well that his duty was to go North and join a Northern regiment, and yet—if he went, it meant, as Mabel had said, that all would end between them, for Mabel was a Southern girl. What was he to do ? On the one side he could hear the call to duty, on the other Mabel wanted him, if he went at all, to go with "Phil." At last his love for his country conquered even his love for Mabel and as a true patriot he secretly made his way north and enlisted in the 1st New Jersey, which was mustered in at his old home. It is needless to follow these two soldiers through the entire campaign, but suffice it to say that they soon rose to high positions in their respective regiments on account of their bravery. On the evening of July 2, 1863, General Dee, who was in command of the Confederate forces at Gettysburg, realizing his perilous position and possibly expecting defeat, decided to make one final, desperate attempt to break through the Union line. That evening he had been reinforced by Stuart's Cavalry and was therefore hopeful of success. His plan was to pierce the Union line at a point now called the "High Water Mark," for that was the turning point of the greatest battle of the Civil War. Everyone has heard of Pickett's famous charge and how the men of the two armies fought hand to hand over the old stone wall. The 9th Virginia belonged to Armistead's brigade, which was almost annihilated in this charge; yet many were not killed outright, but after suffering untold agony, gave up their lives for the cause they thought right. During this battle, a number of regiments were held in reserve and among this number was the 1st New Jersey. On the evening of July 3d, the news of the famous charge of Pickett's Division and the successful repulse was reported among the various Union regiments, and of course reached the 1st New Jersey. \THE GETTYSBURG MERCURY. 125 Colonel Tom Hall recalled the fact that Philip Perry had en-listed in the 9th Virginia, and he imagined he heard some one say that he was dying on the field. Before dawn he had mounted his faithful horse and galloped off in the direction of the "clump of trees." For some time he searched, but all in vain, and he was about to leave when he heard a terrible groan a short dis-tance beyond the wall on the Union side. It startled him and he drew up his horse, dismounted and stooped over the half-dead body of a Confederate officer. Imagine his surprise to find his old friend, Philip Perry! He gently bound up his wounds and raising him, placed him on his horse and rode slowly back to his regiment. Major Perry remained in a semi-conscious state for several days and when he came to, he found himself in Colonel Hall's tent and over him was stooping his dear sister, washing off the blood stains and dressing his wounds. As soon as Major Perry was strong enough to be moved, Colonel Hall had him exchanged for a Northern officer, who was confined in one of the Southern prisons. However, before Major Perry was taken to his home in Rich-mond, the old love between Mabel and Colonel Hall had over-come all difficulties between them and under a tree not far from where Major Perry had fallen, he witnessed a short ceremony, performed by the Chaplain of the 1st New Jersey, in which Colo-nel Hall received "A Hero's Reward," the long desired hand of Mabel in marriage. —W. G. L. '01. «**£> AN ART FAD. IN these days when fads in almost every line of trade and pro-fession are so prominent, one is not surprised to find that there is such a thing as a fad in art also. The particular one selected for the subject of this essay is that style so prominent at this time in the art. of painting—the poster. The poster occu-pies the same place in the art of painting as do dialect stories in literature or syncopated rhythm, i. e. the so-called "rag-time" in music. Not any of these is a recent creation but rather a recent craze. For instance, considered from a scientific standpoint, "rag-time" has been co-eval with the history of music. 126 THE GETTYSBURG MERCURY. Beethoven and Mozart wrote it and even in the incomparable fugures of Bach we encounter it. And in literature, dialect did certainly not originate with James Whitcomb Riley. The possibilities of the colored poster were first made known to English and French artists when the great flaming advertise-ments of Barnum were first placed upon the exposed places of London and Paris. The influence of these American advertising posters became prominent and at once both England and France began to contribute colored products in poster art, which, while far more artistic than the pictures of Wild West performers, were not after all so widely different in outline, color and other quali-ties. Between that day when vivid and crude design was pre-dominant, and to-day when the artistic poster is so much in evi-dence, there is a considerable advance apparent. Simultaneous with the growth of the poster and practically very beneficial was the adoption of it by the up-to-date theatre for advertising purposes. And it lends itself admirably for this pur-pose. It has also been a favorite mode of advertising in the com-mercial world, but one sees less of its use in this manner now than formerly. In the literary advertising department, the poster still is very prominent and is the usual way of calling the attention of the public to the merits of some special edition of a publication. With the rise of the poster came collectors of posters ; in America alone, there are said to be over 6000 persons who devote themselves to this pursuit. Poster literature and expositions too have come into existence. Of the different nations and in point of art, France, as usual, leads. The "father of the modern poster," as he has been called, M. Cheret, however, says that he owes his first inspiration to the Barnum lithographs. America is greatly indebted to France in this line of art. One of the foremost poster artists who, before he studied in Paris, used to draw the gorgeous theatre lithographs, came back to America and completely transformed the coarse ex-aggerated travesties. For this reason Matt. Morgan stands high among the American poster artists. Of the English school, Aubrey Beardsley is probably the best known. He is said to be always "scholarly" and while "char-acteristic," yet he never loses sight of the fundamental principles of the art in his work. The purchase of a celebrated art-poster called "Bubbles" by the proprietors of a certain soap, seemed to THE GETTYSBURG MERCURY. 127 give a new impetus to the poster art in England, and many artists no longer hesitated to enter the ranks of poster painters. In Germany, the poster has not developed very rapidly or sat-isfactorily. German artists in every line of art work seem to ad-here strongly to allegorical symbols and types. This is evident in the tonal art as well as in painting. Probably the best known of the German school is Heine, who creates posters for several humorous periodicals. Austria seems to have paid little or no attention to the art; one can find no mention of Austrians who won a reputation for them-selves except in the line of music. All other arts seem to be con-sidered unworthy any attention. There is a poster art school in Belgium which has won a prominent position in this line of art. Though it requires a considerable amount of education on cer-tain lines to enable one to understand correctly any art—such a training, for instance as a good art-critic possesses—yet it is pos-sible for almost any one to appreciate, to some extent, at least, the art of poster painting. Tolstoi .says, "When I call up an emotion which I have ex-perienced, arid by signs, words, colors, sounds, transfer this emo-tion to another, that is art." Bearing this definition in mind and using it as a test, attention is called to a few examples of posters, each peculiarly distinctive in one manner or other. Probably one of the most striking and unique of the products of American artists was the poster announcing a special issue of the New York Sun. A woman with a trailing purple mantle walks through a green meadow, one hand uplifted with a warning ges-ture as if to command silence. The graceful though striking de-sign indicates a fertile imagination as the originator of it. That the creator—~L,. I. Rhead—is not only highly imaginative and fanciful but even verging upon the eccentric is evidenced by others of his productions, in one of which he has painted a woman with a cloak of dark green, outlined boldly against an orange back-ground. Among the posters published by Harpers Bros., was one en-titled "The Letter Box," which, though simple in ideas yet proved very effective. A little Cupid standing on tip-toe, drops a valentine in the slot of the corner letter-box. The entire pic-ture is not at all pretentious, but entirely characteristic and well adapted. ■pJMfiM 128 THE GETTYSBURG MERCURY. Another poster published by the same firm in 1892 is worthy of noting because of the manner in which the lettering is incor-porated in the picture. "The Wooly Horse" representing Napoleon I. on horseback overlooking the battlefield,—with a fiery sky for background, was a very successful poster published by the Century Co. A famous American artist in this line is W. H. Bradley, whose work resem-bles somewhat that of Aubrey Beardsley. His posters seem to have a peculiar melancholy in their expression. Among the prominent advertisements of merchandise, that of Pears' Soap—a humorous sketch of a ragged tramp—is, with its forcible inscription, one of the most prominent. An original idea was brought out by an English artist in the use of the "Silhouette"—a black figure outlined in white stand-ing out against a black background. The manufacturers of a certain blueing, first used this style of poster for an advertise-ment. An advance in poster drawing was made after the several ex-positions of posters which have been held lately. One of these, held in Belgium in 1894, served to propagate extensively the new ideas of the French and the Belgian schools. How long this fad will last, is difficult to predict. It is highly probable, however, that the art will advance with such strides in some particular direction that the new development will com-pletely swallow up the present popular poster style,—a style, which has been characterized as a "phantasy most horrid and de-testable." —W. W. F. '00. RETRIEVED. JIM HAL,Iy, an inhabitant of the village of Alberton, had the reputation of being the most cowardly man to be found in ten counties. He was known to sleep at night with his room door double-barred and the windows tightly fastened, for fear of being killed in his bed by some wandering burglar. He believed in ghosts and witches ; and the small boys often took advantage of this superstitious fear and belief by placing a white sheet over a stick and when Jim came along, waving it wildly. Jim ran like THE GETTYSBURG MERCURY. 129 a deer for home and next day was made the butt of innumerable jokes. This fear of Jim's was to be accounted for only by the fact that from his birth his mother had shielded him from all dan-ger and taught him to look to her as his natural protector. So when he had come to manhood he had not learned to rely upon himself. He often tried to overcome his cowardice but could not do so when the critical moment came. Affairs were in this state up to the year 1862 when the report was circulated in Alberton that Jim Hall had disappeared from the village. No one had seen him go away, so all the villagers could do was to make suppositions as to his whereabouts. Some thought he had run away for fear of being drafted into the service. A large number of the able-bodied men of the village had already joined as volunteers and now it was reported that additional men were needed and that these would be taken by drafting through-out the whole North. Just the day before Jim Hall's disappear-ance the report was brought that the drafting of Alberton men would take place in four days. So there were some grounds for the common belief that Jim had run away to escape the war. One can easily imagine their surprise when the next day they heard that he had gone to the camp of the Army of the Potomac and had been enlisted as a private soldier. The people treated it as a great joke and many were the jests at poor Jim's expense about his long legs standing him in good stead when a time of great danger should come. However Jim had realty joined the army and was by a lucky chance placed in the same company with the other Alberton men who had gone out long before as volunteers. And as another piece of good fortune the man who was now captain of the com-pany— the former captain having been killed shortly before—had been the only man in the village of Alberton who had not jeered and laughed at his cowardice. This gentleman, a Mr. Leonard, had been a friend of both of Jim's parents and when Jim's father died had been appointed guardian to Jim. He now encouraged Jim to make a man of himself and was the instrument of Jim's doing so. Soon under their gallant leaders they were fighting the rebels with varying success about the swamps and morasses of the Chickahominy. In the battle of Chancellorsville, lost though dearly sold, our hero was in the thick of the fight. At the first mmmw 130 THE GETTYSBURG MERCURY. shock, however, he turned as if to flee, but at the word of his commander he turned and fought so bravely and so well that he was commended by his captain. Nearly two months later he found himself marching north-ward with his companions to try to check the invasion which the victorious Lee was making upon the North. On July 1st they found themselves on the peaceful fields of Gettysburg so soon to be turned into a veritable slaughter pen. In the first day's fight their regiment was stationed at Seminary Ridge with several other regiments to check the advance of the so far victorious rebels until further reinforcements should come up. Soon the overwhelming numbers of the Confederates forced the greater part to fall back and one lone battered and torn regi-ment was left to face the storm. It was too late to retreat now and almost useless to fight longer, but the blood of the Halls who had fought in the Revolution suddenly came coursing through the veins of Jim, and seizing the colors from the color bearer who had just been shot down Jim waved them aloft and shouted, "Come on boys, don't run, only cowards run." As he uttered the words a volley from the enemy, who had now almost sur-rounded the gallant man and his little band, laid poor Jim low and silenced forever the heart which had just learned that it still had brave blood to force through a manly body. Now indeed had Jim retrieved his name from the most disgraceful blot which can be put on any man's name. The rest of the command were captured and taken prisoners. Several years after they were ex-changed and when those Alberton men who had come safely through the war had returned home, they never tired of telling how nobly Jim Hall had proven that he no longer was the coward whom they had once despised. —V. FREY, '01. c®P June falls asleep upon her bier of flowers; In vain are dew drops sprinkled o'er her, In vain would fond winds fan her back to life Her hours are numbered on the floral dial. * * * June is dead, Dead, without dread or pain, her gayest "Wreaths twined with her own hands for her funeral. —Lucy Larcotn. THE GETTYSBURG MERCURY. EDITOR'S DESK. 131 THE '00 Spectrum is ample proof that the catalogue of special features has not been exhausted. As it is customary for the Junior class in publishing a Spectrum to make a special feature, '00 has chosen the "Literary Record of Gettysburg Alumni.'' This feature alone would make thepresent Spectrttm val-uable, as well as interesting. Few besides those who have worked upon such a feature can form any idea of the toil and care re-quired to carry it to a successful issue. Certainly it is but justice that the college paper, in the name of the students of Gettys-burg, congratulates the editor and assistant editor, by whom the "Literary Record" has been compiled and arranged, upon their useful, hard work. But not only may the individuals, on whom rested the responsibility for such a task, be congratulated; Gettys-burg may congratulate herself upon the present annual, which un-doubtedly will be regarded for years as a model of neat, original work. Articles by our alumni relating to Gettysburg, would be re-ceived eagerly by the MERCURY. Stories about college life as it was some years ago, the difference between Gettysbtirg of to-day and Gettysburg of the past, or almost any article of like kind, would find space in our pages. The MERCURY would be glad to print poems by the alumni, as well as prose. HYPNOTISM. HYPNOTISM, as best defined, is a nervous artificial sleep. The same thing was formerly called animal magnetism. Hypnotism applies to a definite nervous state and is brought about mostly in persons having a delicate nervous system. The first true inquirer into hypnotism was Dr. Baird. He saw some experiments performed by a professional maguetizer and at once decided that they were merely an arrangement to deceive the people, but after careful observation and study into the methods of producing a state of hypnotism, he decided that it was genuine. After careful study and experiment, he decided that there was no such a thing as a magnetic fluid flowing from the mind of the operator to that of the subject; but that the true cause of hypno- ■mmtnm 132 THE GETTYSBURG MERCURY. tism lay in the fact that the nerves of one of the senses become deadened by over exertion or constant concentration on a point, and on this account become powerless to act and the person goes into a deep sleep or lethargy. In this, his followers disagree with the other school, headed chiefly by I,afosataine. He asserted that hypnotism was produced by a fluid, known as the magnetic fluid, which passed from one person to another and by its attraction could cause a person of strong will to have complete control of a person of weaker will power, being able to compel him to do anything commanded. Baird was led to his theory by the fact that his subject, while under the influence of this power, was unable to open the eyes. He at once came to the conclusion that excessive fatigue was the only thing that could cause this strange phenomenon as he made no attempt at personal magnetism in producing the sleep. His experiment was performed in the following way. He asked his subject to sit and look steadily at the neck of a wine bottle and allow his mind to wander. The bottle was placed at such an elevation as to cause considerable fatigue to the eyes. After three minutes the subject's eyes were filled with tears, then his eyelids closed and a little later he was in a sound sleep. This experiment proved beyond doubt that a person can be hypnotized without the presence of a second person or operator; but can do it himself by an experiment made under similar circumstances as mentioned above. Baird pursued his discoveries and with the aid of numerous other experiments tried hard to have hypnotism recognized as a science. They were not successful, however, and to-day it is re-garded mostly as something for a show, or to interest the people, without much regard to its cause and the scientific qualities. The most familiar form of producing the state of hypnotism is the following : the operator directs the subject to have no par-ticular thought on his mind, but to let it wander, and gaze steadily into his eyes. After that he generally makes a few passes with the hands, gently rubbing the eyelids, etc., until his subject is in a sound sleep. In explanation of this method I would say that the gazing into the eyes of the operator for some time, is exactly the same as looking at a brilliant object, both have the same effect of fatiguing the nerves of the eye and producing sleep. THE GETTYSBURG MERCURY. 133 This is strikingly illustrated in an experiment with a frog. If a frog is taken in the hand, having the thumb resting on the stomach, and the back gently rubbed ; the animal will go to sleep at once and can be stretched into all sorts of shapes. Another way, as has been stated before, is that of looking steadily at some object. It has also been discovered that the other senses have the same power as that of sight. Thus if you produce monotony in music sleep is produced. Sharp suspense or fright has the same effect of transfixing some people and this has been decided by students of the science ( as it is called by the disciples of hypnotism) to be hypnotism. After careful study it has been proven that the senses of taste and of smell have the same strange effect. As regards the uses of hypnotism little of importance can be said. It is used mostly by professional showmen who call up subjects from their audience or may have them with them. They compel them to do anything they command. One of the common-est ways and also the best to show the entire oblivion of the subject, is the experiment with the letter. The subject is handed a letter and told it is an orange, he immediately eats it with great relish, then if told it is sour at once spits it out with an expres-sion of disgust on his face, showing the subject believes every-thing the operator tells him and is entirely at his command. This, however, was never intended for the chief use of hypno-tism. The experimenters tried to use it in surgery, etc., but it has been found that while some people are easily influenced others give much trouble, so that it would be impracticable to use it in a case of amputation when ether or chloroform serves the same purpose more quickly and better. It has been settled, however, that strong habits can be changed. Persons who have been accus-tomed to strong habits all their lives have been entirely changed and new habits formed. Thus, while very little has been definitely decided about this strange phenomenon, there is every indication that some day in the near future, it will be taken up by experimenters and philoso-phers, thoroughly sifted, and then be proven to be of great value in many respects. It is now in its infancy. —C. J. D. '00. wmm 134 THE GETTYSBURG MERCURY. "THE INFLUENCE OF CHRISTIANITY ON ROMAN JURISPRUDENCE." CHRISTIANITY and civilization in its highest degree of ex-cellence are synonomous, hand in hand like two insepara-bles we find them enthroned upon a majestic seat, ruling, guiding, influencing, and may we say carving the destiny of every great nation. If a country is civilized and christianized we need no other proof to be convinced of her pre-eminence and suprem-acy. A glance will show us also that such countries have the most admirable and thoroughly developed codes of jurisprudence. The influences, whose marks upon "Roman Law" are par-ticularly indelible and prominent, may be divided into three classes: conventional morality and usage, natural reason and justice, and Christianity. These fundamental principles in turn clearly mark off three distinct epochs in the development of Ro-man Law. According to the law of the first nearly all power was vested in the individual and that individual was the "Pater familias." The idea of a State right has scarcely begun to dawn upon the Roman mind. At the beginning of the second epoch, Rome is no longer a col-lection of separate communities : Italy, Greece, Spain, Africa, in short the whole world is in her power. Law based on such a no-tion as practically unlimited power of the pater cannot regulate such an empire. No longer is Rome divided into families, tribes and clans, each separate and distinct, but everything concentrates upon and emanates from one person—the Emperor. Something broader, something more general is demanded and, in response, came the principles of the stoic philosophy. Roman Law can-not stand still while the State is enlarging; it too must broaden, and natural equity, justice and reason furnish the soil for its spreading roots. But one link yet is necessary, one step yet is lacking ere the ultimate degree ofperfection is reached. For Christianity it remains to weld the chain and fill the gap which is to make "Roman Law" such a body of principles as to be applicable at all times and among all nations. In such principles as—"honeste vivere, alterum non laedere, suum cinque tribuere," the dawn of Christian-ity can already be seen, only time is needed until its genial rays shall burst forth with increasing intensity. THE GETTYSBURG MERCURY. 135 Christianity had been now the established religion of the Ro-man Empire for more than two centuries; and the influence of its principles was making an untold effect upon the spirit, if not so much upon the letter, of Roman law. The complete moral, social, and political revolution, through Christianity, created a necessity for new laws adapted to the present order of things. Under it a new order of men of a peculiar character, with special privileges has grown up; churches and monasteries had been formed; certain offenses in the penal code were now looked on with a milder or more severe aspect, and vices, which formerly had been tolerated, became crimes against the new social order. It might be shown that Christianity as a system of doctrine, is peculiarity adapted to meet the secular as well as the spiritual wants of men and would naturally work its way into their codes of jurisprudence. But a direct proof is unnecessary, for after hav-ing shown its influence upon the various elements in "Roman L,aw," we can reason backward and reach the same conclusion. Roman Law may be conveniently divided into three classes:— that of Persons, Property and Crime. From time immemorial, slavery had been customary among all nations. Aristotle reasoned "that nature intended barbarians to be slaves, and among the natural and honorable means of ac-quiring wealth, he classes, making war in order to reduce to slavery such of mankind as are intended by nature for it." As an institution of custom, then, slavery received its sanction at Rome. Christianity had exalted a slave to spiritual equality and this religious elevation could not be without influence on their tem-poral and social position. They were no longer to be regarded as brute beasts and inanimate things, nor could they be destroyed by their masters with as much impunity as his other property. Our respect must here be paid the heathen sovereign, Antoniuns, who declared that the master who killed his slave without cause, was liable to the same penalty as if he had killed the slave of another. Justinian writes, "In these times, and under our Em-pire, no one must be permitted to exercise unlawful cruelty against a slave.'' Prohibition of marriage to slaves had been a deep-rooted prejudice for centuries, yet this too melted before the rays of its benign influence. The stricter forms of manumission—the vin-dicta freeing by census or testament were relieved by easier and ■VAMHtfi 136 THE GETTYSBURG MERCURY. more liberal ones,—for example, per epistolam, inter amicos, in ecclesiis; and whatever of legal impediments yet existed were re-moved by Justinian. Along with this the distinctions formerly made between freedmen, whereby a slave owing to certain kinds of misconduct, when manumitted, could not receive full citizen-ship, were likewise abolished so that after Justinian all libertine were cives Romani. The ancient laws regarding marriage and the legal status of women each crystallized itself in conformity with the new order of things. Marriage was no longer a civil contract but a religious sacrament and the penalties fixed upon celibacy and childlessness were removed. Divorce had been one of the greatest plagues at work in dis-solving the unity of the Roman family. Since the establishment of the XII tables, in 450 B. C, it had been legally recognized. Seneca says of Naecauss, probably satirically, that he changed his wives as he changed his dress. And it is the same writer who says '' that the noble women of Rome calculated the year not by the consuls, but by their husbands." Juvenal, in the bitterness of his satire, could not find words adequate to express his intense indignation of this evil. It is said that the sixth century of Roman greatness had begun ere the evils of a primitive conception that the wife was the property of her husband and might be dismissed at his pleasure were revealed and public feeling shocked by the re-pudiation of a virtuous but barren wife by Spurius Carvilius Ruga. Had Christianity performed no greater good for human society than the removal of this corruption, its influence would not have been in vain or useless. The rights of women over their property were made sub-stantially equal to men's as was the right of guardianship over their children. Parental power, though in theory absolute, had long fallen into disuse and was almost a theoretical nothing long before the ad-vent of Christianity, but whatever of severity yet remained was abolished. Constantine openly declared that the father, who killed his son, should be held for murder, nor was the father allowed to ex-pose his children or sell them into slavery, except in the rarest cases. The proprietary rights of the son, too, were extended from the peculium castreuse to the peculmm quasi castreuse and still later to the peculium adventitium. THE GETTYSBURG MERCURY. 137 Milman says '' Christianity made no change in the tenure or succession to property.'' '' Seeking inheritances by undue means was prohibited and restrained by law as an ecclesiastical evil." Church property was regarded sacred and inviolate and as Milman says was "the sole proprietor, whom forfeiture or confis-cation could never reach; whose title was never antiquated and before whose hallowed boundaries violence stood rebuked." Gifts to temples could now be sold or pledged for the redemp-tion of captives, a purpose which the old Roman law would have disdained to contemplate. In the penal laws of the Roman empire, the influence of Chris-tianity was but moderately exerted. The abolition of the distinc-tions drawn between freedmen and slaves have already been re-ferred to. Crucifixion as a means of punishment was removed by Constantine, rather as an act of religious reverence than of humanity. But in the suppression of gaming and the prohibition of women being forced on the stage, traces of its influence can be seen. As is natural from the subject material under discussion, the law respecting persons has undergone the greatest change. But all these changes, whether in the penal code or in the law of proprietary rights and obligations, were but a means, which made the Roman system adapted to the regulation of all peoples and at all times. When we see that the very barbarians who conquered Rome were in turn conquered by her system of jurisprudence, we are not a little filled with surprise; but when we find it not only influenc-ing and forming the basis of, but being incorporated in the legal codes of almost all nations, we come in contact with an effect that requires an adequate and efficient cause. After paying all due re-spect to that peculiar, innate faculty of administration in the Ro-man mind, without detracting one iota from the excellent opinions of the juristconsuls or limiting in the slightest degeee the wonder-ful influence of stoicism, as a system of philosophy, we are com-pelled to admit that none of these were individually or collectively efficient to produce such an effect. To Christianity must be as-cribed the credit of basing Roman law upon principles, so univer-sal and so humane, as to be applicable not only among the Roman state but among all nations of all times. If this statement seems rather large in its exposition and sweeping in its results, a few illustrations may be necessary to establish its validity. r \UIUW 138 THE GETTYSBURG MERCURY. Can a law, which considers certain classes of men as mere brutes or inanimate things be reconciled to our conception that by nature all men are horn equal ? Or who can reconcile the idea that a woman is but the property of her husband, capable of being dismissed at his bidding, with our conception of human society ? What place could the principle of "patri potesias have in the legal status of a nation, all the citizens of which have equal rights be-fore its laws—yet in the wisdom of the juristconsuls and in the records they have left us, these principles and many others similar to them are found embodied. Stoic philosophy left to Roman law the principles of equity and humanity, but the basis of natural law upon which they rested and by which they were judged and applied, was subjected to a complete change ere they were capable of incorporation into modern jurisprudence. Christianity recognized these same principles of equity and humanity, but substituted truth instead of natural law as their criterion. Based on this principle and judged by this standard the conceptions of equity and humanity lose their limi-tations and assert themselves with the force of universality. It is only under these conditions that we find Roman law incorpo-rated in the laws of every great nation, and only in Christianity do we find a cause adequate to such an effect. Among legal historians there is a vast diversity of opinions with regard to the influence of Christianity upon Roman legisla-tion. This variance, Morey rightly attributes to their failure to distinguish Christianity as an ethical system from the church as a corporate institution.'' It must be remembered that the church, like all institutions, even though divine in their origin, is never-theless subject to the frailties of humanity by which it is regu-lated and too often fails to cancel the limitations between the ideal and the real. The family and the matrimonial ceremony are regarded as divine in their origin and sanction, but do they ever conform to the high standard by which they should be regulated? Perfection is an attribute not of this world, and if the church as a corporate institution has failed to attain the high plane established by the principles it recognizes and enunciates we can condemn the prin-ciples with no more justice than we can reason that a college edu-cation is of no advantage because some particular individual, who has taken a college course, has made a miserable failure in life. THE GETTYSBURG MERCURY. 139 However intolerant the church may have been against pagans, jews, and heretics, the principles of Christianity as an ethical sys-tem remain unsullied and untainted, notwithstanding the injus-tice of their application. Morey has admirably summarized the whole matter: "In spite of the fact that the church in some cases set its face against civil equity, and the fact that Roman law had already received a liberal temper from the influence of Greek philosophy, it cannot be doubted that the progress of the law, in general, kept pace with the unfolding of ethical ideas in the Roman mind; and that so far as Christianity furnished a system of ethics more just, liberal and humane than that of stoicism, it brought to bear upon the Roman law a moral power superior to that which had previously been exerted upon it through the writings of the philosophical jurists." Who then can doubt that in Christianity, Roman law reaches the summit of its greatness and the beginning of its uni-versal application ! —W. E. B. '99. M THE CONFLICT OF THE AGES. AN is a progressive being. Contentment is foreign to his very nature. He is continuously looking to something beyond, to a condition higher and better. As his intellect broadens and quickens, he invariably becomes desirous of greater freedom. This love of liberty is connate with his physical and mental constitution. But there is also another desire deeply implanted within his breast, a desire which is destructive of the liberty of others. It is the love of power, the inherent desire of man to rule over his fellow:man, an ambition, the natural outcome of which is despot-ism. These two desires tend toward opposite directions. Between them is an irrepressible conflict. This conflict is as old as society and as persistent as humanity. From the earliest times its vary-ing phases have determined the condition of the race. The history of civilization is largely the story of this conflict, the story of human liberty struggling against human despotism. The outcome of this struggle has varied in different countries. ; 140 THE GETTYSBURG MERCURY. As a result their states of society have been vastly different. Just in proportion as liberty has triumphed over despotism so civiliza-tion has advanced beyond barbarism. Among the nations of an-tiquity despotism prevailed everywhere. As a consequence their civilization never advanced beyond a certain point. They were marked in every case either by iunobility or by slight advances and retrogressions. In the countries of Northern Europe arose a people whose chief characteristic was their love of freedom. Here liberty found a soil peculiarly fitted for her growth and develop-ment. What has been the result? Have these people an}' ele-ments of civilization not enjoyed by the nations of antiquity? Read the story of their steady progress through the Middle Ages. L,ook upon the unequalled state of civilization among them to-day and question not the advantages of liberty over despotism. Con-trast the despotic nature of ancient Assyria with the liberal char-acter of modern England and wonder not that the latter stands to-day the first empire of the world, while the former exists only upon the pages of history. During the dark ages humanity struggled against the most terrible despotism man had ever known,—the despotism of igno-rance and superstition. The human mind neglected, uncultivated and depressed sank into the deepest ignorance. So prolonged and intense was the gloom enveloping Europe that her people seemed incapable of advancement, society seemed destined to end-less barbarism. Gradually, however, knowledge became more diffused, inventions and discoveries awakened the human intellect from its long sleep, and man began to learn the truth about him-self and the world. This truth has made him free. Freedom of intellect naturally led to a desire for religious freedom. Ecclesiastical tyranny was incompatible with intellect-ual liberty. Enlightened minds refused to submit any longer to the authority of the Pope. Contentment gave place to unrest, un-rest to action, and action to liberty. The Reformation was more than a contest between Protestant-ism and Catholicism. It was an insurrection of the human mind against pure ecclesiastical monarchy. Do you wonder that the movement was crowned with the most glowing success ? Papal authority in Northern Europe was destroyed forever. This religi-ous liberty will eventually spread over the entire world. The religions of the world are becoming more and more imbued with THE GETTYSBURG MERCURY. 141 the sentiment of liberality. Sectarian differences are gradually disappearing before the growing light of intelligence. Creed and dogma will be re-adjusted more and more under the light of ad-vancing truth. Formal religion is being supplanted by true Christianity—that "divine keystone in the arch of universal his-tory." With an ever increasing radiance the light of Christianity is slowly but surely penetrating the darkness of heathenism, and hastening the approach of the time when the people of all the earth, regardless of race, sect or nationality, shall bow in worship before the one true God. Turning from the religious to the political world, we behold a revolution no less wonderful, a mighty struggle between despotic and liberal principles of government. This struggle shook Europe from Scandanavia to Italy, and snatched a new world from the threatened grasp of tyranny; a revolution of which the Reign of Terror was but an incident. The ideas engendered by the Reformation inaugurated a mighty epoch of political regeneration. The great sovereigns of Europe, one after another, have been deprived of their prerogatives until to-day the last one sits trembling upou a tottering throne that threatens to fall at any instant. The day is not far distant when even the "Autocrat of all the Russias" shall see his sceptre depart into the hands of his subjects. Thus we have seen during the last three epochs three great stages of the onward march of civilization; three mighty victories for the cause of struggling humanity; victories which include in-tellectual, religious and political freedom. To-day the world has entered upon another epoch; an epoch which brings with it questions far more complicated than those of the past, and far more momentous than those that have convulsed Europe with centuries of revolution. The great struggles of the past have been, in the main, suc-cessful, and the echoes of the mighty battles for civil and religious freedom are growing fainter and fainter. But the cause of freedom is not yet won. The hosts of oppression have been driven from the fields of church and state only to return with renewed vigor to attack freedom in the field of industry. The scene of conflict has extended from the old world to the new. Society has entered upon an industrial age. Modern civilization is marked by ma-terial progress unprecedented in the history of mankind. Great 142 THE GETTYSBURG MERCURY. inventions have revolutionized travel, commerce and manufacture. Ocean steamers, railroads and telegraphs have practically annihi-lated time and space. By constant and easy intercourse with the world, man's views have been enlarged, his energies stimulated, and his rate of progress quickened. Yet with all this unparalleled progress in the industrial power of society, there has come no proportionate improvement in the condition of the masses. While the great industrial development of the present age has brought many blessings for mankind, the tyranny of selfish men has monopolized these blessings for the few. Capital gets the lion's share of the world's wealth, while Labor is reduced to a condition of servitude. A few monopolists amass colossal fortunes and revel in Croe-cian luxury, while thousands of wage earners, becoming more and more pauperized, sink into intellectual and moral degradation. Millions are wasted in feasting while gaunt starvation stalks the streets. Society has become a vast machine which turns out at one end milliouaries, and at the other tramps, paupers and anarch-ists. The enormous inequalities of existing conditions are creating a discontent in the minds of the laboring classes; a discontent that foreshadows an impending revolution. Profound discontent preceded the great religious upheaval in the sixteenth century. Great unrest ushered in the awful convul-sions of the French revolution. With the reappearance of the same conditions to-day, revolution is as inevitable as the laws of the universe. Human nature will not tolerate abuse forever. Labor will not always submit to the tyranny of capital. Even now the cohorts of freedom are gathering for a mighty effort. There is every indication that we are on the eve of a momen-tous struggle. The discontent of the masses is '' no longer the fretting of the waves;" it is "the roar of the rushing tide." It is to be a contest for the supremacy of wealth on the one hand or the freedom of opportunity on the other ;—a conflict that will decide whether the combined money power of the world is to per-petuate its tyranny of greed and avarice, or whether the toiling millions are at last to enjoy unmolested the products of their own labor. History teaches that there can be but one outcome to this struggle. Despotism again will fall. The indomitable forces of THE GETTYSBURG MERCURY. freedom will win another victory. Economic despotism is simply fighting the same hopeless battle that was fought and lost by spiritual and political despotism in the ages that have passed. Civilization will never rest until this great barrier is removed. There are only two ways in which this can be accomplished; by the peaceful methods of education and religion, or through the instrumentalities of war. Should the latter method prevail, and should the masses be led by designing demagogues, or by reason-ing anarchists inspired only by a sense of injustice, and revenge, the innocent will perish with the guilty in the most dreadful social catastrophe that has ever darkened the pages of history. Do the conditions indicate that such will be the result ? Are we to sup-pose that the increased intelligence and morality of the present age will permit such a solution of our great sociological problem ? Have we read history in vain or profited nothing by the great lessons of the past, that we must see re-enacted on the stage of modem history the bloody scenes of the sixteenth century? Is the nineteenth century civilization so little advanced that it is about to behold a social convulsion compared with which the aw-ful horrors of the French Revolution shall sink into insignificance ? A million Christian hearts answer, "No." A million earnest workers for the triumph of right over might, filled with the belief that the signs of the times point upward, and inspired with the hope that social and economic freedom shall come as the product of better hearts and better souls, respond with a mighty " NO." The wrongs of our present industrial system shall not be righted among scenes of violence and confusion. The ceaseless unrest of the multitudes, that are to mould the destinies of the future, is the sign of an advancing civilization. It means that they are acquiring more brain force, more manhood, the raw ma-terials out of which God will shape a better future for humanity The dawn of a better day is breaking the deep clouds of sin. The heart of the world is beating more truly than ever before. Men are beginning to realize that the prosperity of society depends upon the well-being of the whole people. They are coming to see that a divine fatherhood implies an universal brotherhood. The world is moving onward toward the realization of the ideal life of human happiness; a life where manhood shall count for more than gold, where character shall outweigh the dollar ; a life free from selfishness and tyranny, abounding injustice, liberty and equality. i44 THE GETTYSBURG MERCURY. In this life shall the Conflict of the Ages cease and man find his highest place as he ministers to the good of all. "Then the common sense of most Shall hold a fretful realm in awe, And the kindly earth shall slumber, Lapt in universal law. And the war drum throb no longer, And the battle flags be furled In the parliament of man, The Federation of the world." —W. R. E., '99. THE PHILOMATHAEAN SOCIETY. BY PROF. L. H. CROIX. [From the Pennsylvania College Book, 1832.] MORE than a year before the charter of Pennsylvania Col-lege was granted by the legislature of the State, the Philomathaean Society had its organization, in the "Gettysburg Gymnasium," on the corner of Washington and High streets, Gettysburg, Pa. The students of the institution assembled in the west room of the second story, on the 4th of February, A. D., 1831, to form literary societies whose generous rivalry would stimulate the members to mutual, intellectual and moral improvement. It was agreed to divide the whole number of students into two equal parts, in the order in which their names stood enrolled, each division then withdrew to the "East Room," second story, becoming the founders of the Philomathaean So-ciety, with Prof. M. Jacobs as chairman. With the permission of the Professor of Theology, the meeting continued to be held in the rooms devoted to theological instruction, the corner-stone of the Theological Seminary not being laid until the following- May. A Constitution and a name were adopted, but the latter was not at first settled in its orthography, for the different secretaries give "Philomathian," "Philomathean," "Philomatheon" as the name before the present Philomathaean became confirmed. The signification of the names, "lovers of learning," implies the object of the organization, "to create and cherish a taste for learning, and to promote sentiments of mutual regard and friend- THE GETTYSBURG MERCURY. 145 ship;" or, as afterwards modified, "to cultivate and diffuse among its members liberal principles, and to promote the great objects of social, moral, and intellectual improvements." The constitution provides for the election of all officers, for the admission and the dismissal of members, for fines and penalties, for meetings and work, for the formation and use of a library; and it emphasizes the requirement of each member to hold inviolate his duty to preserve a proper secrecy of the affairs of the society. One of the first peculiarities was the appointment of a "Room-keeper," taken in alphabetical order, to make all the arrangements necessary for holding the next meeting. He seems to have been keeper of the door, introducing any new or honorary member, but, in connection with his more dignified work, he was also "hewer of wood and drawer of water,'' polisher of lamps and factotum in general. This office was abandoned in the new college building, when a janitor become necessary on account of the increased work in hall, library and reading-rooms, and when the funds of the society allowed a consideration for services required. The meetings were first held on Friday evening, and as lamps were a necessity, with the order for their purchase was joined that of a "jug," or "bottle" for the use of the society. Now this bot-tle is evidently not the decanter held in bad repute, nor is the jug the famous "little brown jug," celebrated by the students in their later years in their rollicking glee; for the society was strongly in favor of total abstinence, as the votes on all temperance debates proved. As an illustration of the small beginnings of a society, there is an account of the purchase of a "suitable desk, or covert, for the use of the Secretary, library, lamps, etc." Some later Secretary has changed the v of covert to b, making it "cobert," having doubtless in mind the old family cupboard at home. From the day when a single desk or closet would accommodate not only the library, but the articles of the Secretary and the Janitor be-sides, to the present, when even the present library room has be-come too cramped to display all the volumes to advantage, an earnest of what may be expected in another half century is exhib-ited. Another illustration of small beginnings was the original initiation fee of fifty cents, which rose to two dollars and a half when the college obtained its charter, and not long afterwards to five dollars, at which figure it has since remained. 146 THE GETTYSBURG MERCURY. The first original declamation, by one of the still surviving founders (1882), by permission of the society, was in the German language. From the first the debate took high rank, and seemed to claim the highest interest of the members. The subjects chosen often bore directly upon their personal relations, and the first was upon their call or right to existence as a society. Then the ques-tion of social visiting, the granting of diplomas for partial or special courses of study, and other like topics, were discussed, as well as the questions of public interest in their day. The first anniversary celebration was held February 17, 1832, and the speeches were made by two of the founders. At first these exercises were held in the Gymnasium building, and invita-tions were sent to such persons as were supposed to appreciate literary entertainment. It may seem somewhat primitive at the present day to learn that '' a few verses '' were sung between the speeches, instead of the classical instrumental music furnished at later entertainments. Another novelty was the '' privilege given to those present of making any remarks to the society that might be thought proper. Afterward the exercises were held in the German church, until 1835, when they were transferred to the Presbyterian church, in consequence of obligations being made to the introduction of in-strumental music into the church. After 1836 the public exer-cises were held in Christ (college) church, then completed. In connection with the spring examinations, by request of the Professors, each society appointed an essayist, an orator, and a debater as performers at the closing exercises of the session. The exercises were to be original, and each society was to "chal-lenge" the other alternately to select the subject of debate. Thus originated the annual "contests," which grew in interest from year to year until 1849, when a dispute with the church officers brought all public exercises ofthe societies to a close forseveral years. The customary fees for the sexton and other incidents were asked for in advance, by a regulation of the church officers, in conse-quence of the difficulty of collecting them after the interest of the occasion had passed and the officers of the societies had been changed. This action being misapprehended as a charge for the use of the church, which was free to exercise under the direction of the faculty, or as a reflection upon the integrity of the socie-ties was resisted. Not satisfied with the explanation that the THE GETTYSBURG MERCURY. 147 sum assessed merely covered the expenses incident to the opening of the church, the societies memorialized the Board of Trustees on the question, who replied that the demand was not unreason-able; and thus ended the dispute and the contests at the same time. At the time of the earlier anniversaries, an honorary member was elected to deliver an address. From 1836 to 1853 an address was delivered each year before the societies jointly. From this time there have been annual and biennial addresses, the societies usually alternating in the choice. As a matter of history, between 1852 and 1855, with an organ-ization or union of the different literary societies of various col-leges, bearing the prae-nomen of Philo, and known as the "Philo Union," must not be omitted. It originated at Shelby College, Kentucky, and enrolled Philo Societies of more than a score of colleges, extending from New England to the West. Member-ship in any one of these societies secured admission to all the others, and a general plan of simultaneous anniversaries was pro-posed. The fraternal relations of the brotherhood were to be cul-tivated and the general interest to be promoted by a periodical es-tablished at some central institution; but the difficulties of practi-cal co-operation and the excessive labor of correspondence made the union of short duration, and a second generation of students scarcely learned of its existence. MONOTONY OF LIFE. THAT one could complain of the monotony of life, living in an age and in a nation like ours, certainly seems strange to a wide-awake person with an active mind. One certainly cannot get such an idea from nature in her ever changing forms, if one observes her. She assumes in turn every color known to us, the tender green of spring, the bounteous variety of blossoms and flowers, the splendor of the autumn foliage, the white mantles of snow and the brilliant sunsets. Instead of monotony to the observer it seems all unrest and change with hardly any continua-tion in the same line or place. There is variety in the life all around us, from the tiniest insect up to man ; there is continual change in the life of even the humblest individual. Great changes mmim 148 THE GETTYSBURG MERCURY. occur in all nations. Thought on different subjects changes, pub-lic opinion changes and is a mighty power worthy of a care-ful consideration. In fact everything changes with the pro-gress of civilization. Truly it is only the inactive mind and un-observant eye and the sluggish spirit that can for a moment imag-ine life to be monotonous. If we look closely we will notice certain principles running through life's changes. We see a union between the old and the new. It is the same old earth, it matters not under how many changes. The same trees are white with blossoms in the spring, green with foliage in the summer and brown and bare in the autumn. So with ourselves, a change of occupation or of resi-dence, a change in our financial circumstances, a marriage, a death, a journey, each brings a new experience for our old selves and forms a fresh union between our past and our present condi-tion. These things may bring happiness or sorrow for the time being, but they all have the power of enriching, enlarging and improving our characters and lives by making good additions to our stock of old experiences. Of course if we do not want it so, we can make it otherwise to a certain extent. We can be dull and inactive and cling to the old, see nothing in all the changing world about us, make no new friends, cling to old ideas, discuss no new methods, hold the same opinions and pride ourselves upon what we might call con-sistency, but which is really only thestubbornness of a mind which thinks that the world is becoming worse with new ideas, new methods and new experiences. We can plainly see that to lead a life like that is to cross our Maker's purpose, for his purpose was without doubt that we should grow into the full richness and value of manhood by cherishing our past experiences and learning well the lessons taught by them while we step forward into new and untried paths with vigor and hope. —R. Z. I., '00. 'Twas an evening of beauty ; the air was perfume, The earth was all greenness, the trees were all bloom And softly the delicate viol was heard, Like the murmur of love or the notes of a bird. —Whittier. THE GETTYSBURG MERCURY. 149 ATHLETICS. BASEBALL, this year is not as successful in some senses as usual, but in others we can pride ourselves upon our team. In the beginning of the season they encountered six hard games in succession, five being away from home, and were greatly hindered by lack of sufficient practice. But in the later games they seem to have rounded well into form, and are playing pretty good ball. The greatest surprise of the year has been Roehner's pitching, he having developed wonderfully, and doing work which, with better support, would have won a number of the games which were lost. The season was opened 011 April 15th, with Franklin and Mar-shall on their grounds at Lancaster, and was won by Gettysburg by a score of 6 to 4. The game was very pretty, both sides play-ing good ball, except in one inning, when the F. and M. boys did their only scoring. The feature of the game was Lantz's home run over left field fence with two men on bases. The trip to the central part of the state was opened at Susque-hanna April 20th, when we were beaten 12 to 6, by a comedy of errors in the first three innings which netted the home team eight runs. After that the boys settled down and played well, but Sus-quehanna's lead was too great. On April 21st we beat Bucknell by a score of 12 to 7, through hard batting coupled with the best fielding of the season. The game throughout was highly interesting and exciting, being marked by a number of pretty plays. Roehner pitched a fine game, allowing Bucknell but six hits, to Gettysburg's eleven. State defeated us April 22d, by the score of 7 to 6 in a game that was very close and exciting, though marked by bad errors on both sides. Ketterman pitched a good game, receiving poor sup-port, while Farr was knocked out of the box, and Morgan sub-stituted. At Bloomsburg, March 24th, we were defeated by the Normal School by the score of 14 to 4. The Normal boys have a good team, but it is only right to say that they would not have beaten us so badly if it had not been for the umpire. The first home game was with Dickinson on April 27th, when we were beaten by a score of 15 to 6. The game was poorly played on both sides, but tight until the sixth inning, when it THE GETTYSBURG MERCURY. was tied, after which our boys went to pieces, and Dickinson brought in nine more runs. We were beaten for the second time by Susquehanna Univer-sity on Nixon Field, May 5th, the score being 6 to 5. Our team did far better work in every way than the visitors, but their only two errors were costly, bringing in four runs, aud^poor judgment in base-running at a couple critical points lost a game by what can be termed nothing but hard luck. Games scheduled with the Indians and Dickinson at Carlisle were unavoidably canceled and prevented by rain respectively, and the next game was on Nixon Field with Franklin and Mar-shall, who were beaten in a very pretty game by the same score as in first game, 6-4. They were shut out until the eighth, and secured but four hits in all off Roehner. The Preps have manifested a good college spirit this year by getting up a team that is doing good work in its class. They were beaten by Dickinson Prep at Carlisle, 13-4, and returned the compliment on Nixon Field by the score of 13-9. They also played against '01's team, by whom they were beaten in a one-sided game by a score of 15-0. At the relay carnival at the University of Pennsylvania, April 29th, we were classed with Dickinson, Bucknell, Franklin and Marshall, and Ursinus, and came in fourth in one of the speediest races of the day. Dickinson won, having a clear lead, and Buck-nell, F. & M., and Gettysburg came in in the order named, bunched very close together, with Ursinus trailing some distance in the rear. Probably the most interesting and significant event in athletics of recent years was the dual meet with Dickinson held on Nixon Field, May 17. We were defeated, the score of points being 60 to 28, but can feel that the meet was a success as far as we are concerned, for it has given track athletics the impetus which it has needed so long. Dickinson won all the first places except the high hurdle, captured by Koller, '00, and the high jump a tie between Albers, '99, and Brown, of Dickinson. Our men showed however, that they could have done far better work with proper training, and we believe that they have caught the spirit now, and we can turn out a winning team next year. —W. THE GETTYSBURG MERCURY. Flowery June, When brooks send up a cheerful tune, And groves a joyful sound. JX 151 —Bryant. And what is so rare as a day in June ? Then, if ever, come perfect days; Then heaven tries the earth if it be in time, And over it softly her warm ear lays. -Lowell. And so beside the silent sea I wait the muffled oar; No harm from Him can come to me On ocean or on shore. I know not where His islands lift Their fronded palms in air ; I only know I cannot drift Beyond His love and care. — Whittier. The last bird I ever fired at was an eaglet on the shore of the Gulf of Ir\DT Successor to W. J7. VAJLAJKl, Simon J. Codori Dealer in Beef, Pork, Lamb, Veal, Sausage. Special rates to Clubs. York St., GETTYSBURG. Davib Croxel, Dealer trt ^ine groceries anb ttottons «-x4}ork Street. .GO TO. CHAS. E. BARBEHENN, Barber, In the Eagle Hotel, Cor. Main and Washington Sts. YOHN BROS. Agents for the Keystone State, Waldo, Washburn, Groupner & Meyer. Highest Grade Mandolins, Guitars, Banjos, Mandollas and Mandocellos. Headquarters for Phonographs, G-raphophones and supplies. Trimmings of every description. All sheet music one-half off. Large discounts on Books and studies. 326 Market St., Harrisburg, Pa. FAVOR THOSE WHO FAVOR US. Baseball v>tipptie& .Spaloing's league JSall, /Iftits, jflftaelie, Etc. Managers should send for samples and special rates. Every requisite for aennf0, ©olf, Grtcftet, Gracft ano fftelo, ©Ktnnastum Equipments anD ©utfite Complete Catalogue Spring and Summer Sports Free. The Name the Guar-antee." a. ©. SpalOing SL JBros. New York .". Philadelphia Chicago ROWE, .Your Grocer. Carries Full Line of Groceries, Canned Goods, Etc, Best Coal Oil and Brooms at most Reasonable Prices. OPPOSITE COLLEGE CAMPUS. S. /. CODORI, Jr. t* Druggists Dealer in Drugs, Medicines, Toilet Articles, J> Stationery, Blank Books, Amateur Pho-tographic Supplies, Etc., Etc. .Baltimore Street. R. H. Culp, PAPER HANGER, Second Square, York St. COLLEGE EMBLEMS. EMIL ZOTHE, ENGRAVER, DESIGNER AND MANUFACTURING JEWELER. 19 S. NINTH ST. PHILADELPHIA. PA. SPECIALTIES: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through C. H. Tilp. Gotrell & Leonard, 472-474 Broadway, Albany, N. Y. makers of CAPS, GOWNS and. HOODS To the leading- American Colleges. Illus-trated Manual, etc., upon application. Meneely Bell Co. TROY, N. Y. MANUFACTURERS OF SUPERIOR BELLS The 2000 pound bell now ringing in the tower of Pennsylvania Col-lege was manufactured at this foundry. r . nmmwmmiiMMMmwimmmmmm PATRONIZE OUR ADVERTISERS. You can't expect to create the im-pression that you are well dressed unless your clothes are MADE FOR YOU. Equivocate as you may, the fact remains that ready-made garments lack that air of exclusiveness which custom work possesses. J. D. LIPPY, Merchant Tailor 39 Chambersburg St., Gettysburg, Pa. G. E. SPANGLER, ^ Dealer in Pianos, Organs, Music, Musical Instruments, Strings, Etc. YORK STREET, 1ST SQUARE. GETTYSBURG. L. D. Miller, Grocer, Confectioner and Fruiterer. Ice Cream and Oysters in Season . . . \0) lUaxn St., ©ettusburg. City Hotel, Main St. Gettysburg. Free 'Bus to and from all Trains Thirty seconds' walk from either depot Dinner with drive over field with four or more, $1.35 Rates $1.50 to $2.00 per day. John E. Hughes, Prop. WlLLlHSURE^OUR^ lfiiilnl'iil¥rii;TJH w&receipt ot SI0-0 A6AINST ILLNESS., PHYSICIANS'* PLUMBERS- ' BILLS.DUETO IMPURE AIR, ^ FROM CLOGGEDjJ^'HS flew York, Bosfo/i. P/>//dde//i/>/fr<}/7c/sco. lo/?

JUNE, J899 ooTlhe, Qettysbur ercury CONTENTS. Our College Home 117 The 1900 Spectrum 119 Tick-tack-to 120 A Hero's Reward 123 An Art Fad 125 Retrieved 128 Editor's Desk, 131 Hypnotism 131 " The Influence of Christianity on Roman Jurisprudence ". 134 The Conflict of the Ag-es 139 The Philomathaean Society 144 Monotony of Life 147 Athletics 149 YMMUM FAVOR THOSE WHO FAVOR US. wmomrn For Fine Printing GO TO The J. E. WIBLE .Printing Rouee Carlisle Street, GETTYSBURG, PA. C. B. Kitzmiller, Dealer in Hats, Caps, Boots and . Douglas Shoes GETTYSBURG, PA. J. H. Myers, Fashionable Tailor, Clothier and Gents' Furnisher. The best place in town to have your Cloth-ing made to order. All workmanship and Trimmings guaranteed. No charge for re-pairs and pressing for one year. Dyeing and Repairing a specialty. Ready-made Clothing the largest stock in town. Up-to-date styles. Bicycle Suits and Breeches Headquarters. 11 Baltimore St., Gettysburg, Pa. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp. Eagle Hotel. GETTYSBURG, A. Have you an assured livelihood? "Would you try for a government posi-tion, if you knew just how to apply, and the kinds of positions from which you can choose, and what to do to insure your getting on the list after you have applied! The Government of the United States is the best of employers. Fair compen-sation, regularity of payment, reason-ably Bure tenure, tasks not too difficult, | ana hours not too I ong, offer strong at-tractions to young persons of both sexes whohavenosettledinuome. Manyenter Government employ, spend their spare i hours in studying law or medicine, or finance, and save enough from their salaries to start in a professional or business career. We have just published a book from whichanj/candidate maylearnjustwhat is necesaary and what unnecessary in brushing up his studies for an examina-tion ; and what his chances are, all things considered, for making bis way into the Civil Service, and staying there. The title of this book is " How to Prepnre for a Civil Service Examination; With Recent Questions and An-swers." It contains all Information which any candidate would require to firepare for any competitive office under ' he Government, and includes a "Ten Weeks' Course of 8tudy,"ln the form of questions actually asked at recent ex-aminations, with the correct answers to i them. Besides the technical require- ' mentSjitalso covers all the elementary branches, like arithmetic, spelling, pen- , manship, geography, letter writing, civil government, etc., etc., so that one who masters this course of study would not only pass well an examination for a gov- , ernment position, but would be sure of I preferment over other applicants for a clerkship in a business house. CLOTH—$2.00 Postpaid—560 PAGES Anotherbookfree(Quickat Figures)if you mention this paper when ordering. HINDS A NOBLE, Publishers 4-5-13-14 Cooper Institute, N. Y. City Schoolbooks ofallpublishers at one store .THE. GETTYSBURG MERCURY Entered at the Postoffice at Gettysburg as second-class matter. Voi,. VIII. GETTYSBURG, PA., JUNE, 1899. No. 4 Editor-in- Chief. J. FRANK EEILMAN, '00. Alumni Editor. REV. F. D. GARLAND. Assistant Editors. LUTHER A. WEIGLE, '00. S. A. VAN ORMER, '01. Business Manager. Assistant Business Manager. JOHN K. HAMACHER, '00. CLARENCE MOORE, '02. Advisory Board. PROF. J. A. HIMES, L,IT. D. PROF. G. D. STAHLEY, M. D. PROF. J. W. RICHARD, D. D. Published monthly by the students of Pennsylvania (Gettysburg) College. Subscription price One Dollar a year in advance, single copies Fifteen Cents. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. OUR COLLEGE HOME. Oh bright for us the sunbeams rest On tower and town with rosier glow, On sentry Round Top's rugged crest And on the immortal Ridge below, Where marble Victory's fadeless bays The patriot soldier crown, And History graves for future days The deeds of his renown. CHORUS—Then ring we clear a loyal cheer, Wnere'er we rest or roam, For Gettysburg, for Gettysburg, Our famous College home,— Hurrah, hurrah, hurrah ! O fair for us the moonlight falls, To brighten with its silver flame At once the stately College halls wmm 118 THE GETTYSBURG MERCURY. And the memorials of fame That peer from every grove and grange, And in their silence tell That here heroic spirits range O'er meads of asphodel. CHORUS—Then ring we clear a loyal cheer, Where'er we rest or roam, For Gettysburg, for Gettysburg, Our honored College home,— Hurrah, hurrah, hurrah ! O soft for us the shadows play Among the Campus elms, and woo To merry converse and delay From tasks we busily pursue. Ah Youth and Friendship, how ye charm In Learning's calm abode,— True Graces, twining arm in arm On sweet Arcadian sod ! CHORUS—Then ring we clear a loyal cheer, Where'er we rest or roam, For Gettysburg, for Gettysburg, Our glorious College home,— Hurrah, hurrah, hurrah! At morn the duty-call of bells Rings clear and urgent, near and far, At eve a gentler music swells From gleeful viol or guitar. O jolly is the life we lead In study, song or games ! O fortunate the fate indeed That here inscribes our names ! CHORUS—Then ring- we clear a loyal cheer, . Where'er we rest or roam, For Gettysburg, for Gettysburg, Our dear old College home,— Hurrah, hurrah, hurrah ! Energy will do anything that can be done in this world; and no talents, no circumstances, no opportunities will make a two-legged animal a man without it. —Goethe. THE GETTYSBURG MERCURY. 119 THE J900 SPECTRUM. THE most recent claimant, in our midst, to literary and ar-tistic honors, is the class of 1900. Its Spectrum, just is-sued, challenges our admiration from start to finish, and we heartily accord to it equal rank with the best of our college annuals, thus far issued. The form of the book, and the general arrangement of its con-tents, show a pleasing appreciation of responsibility in the plac-ing of details to secure good effects. There has been an evident purpose on the part of the printers, publishers, managers, artists and editors, to produce a work which should be alike creditable to themselves, as well as to the college which this publication represents. The volume is fittingly dedicated to Prof. Klinger, who is justly characterized as "both teacher and fellow student." The various classes and associations are given due recogni-tion by verbal statement, cut, pencil and photograph. The latter are unusually good throughout and constitute an attractive fea-ture. The sketches, are, as a rule, very clearly executed, and are amusing without being either vulgar or rude. The "Literary Record of Gettysburg Alumni," is an import-ant feature and will add permanency to the value of this publication. It will be interesting and profitable for our alumni and friends to have a record of this sort for handy reference. The "Spanish War Record" is not less interesting and valu-able. It is something for us to be proud of, that when our coun-try needed men to prosecute a war in the interests of humanity, against a cruel oppressor, that twenty-eight men, from our grad-uate and undergraduate ranks, cheerfully enlisted and did honor-able service. The humorous thoughts and aspects of college life, receive literary embodiment in the concluding pages of the volume. These show a commendable degree of appreciation of humor, in both possible and impossible, but easily imagined situations. It is a pity that so much of this kind of literature, must necessarily go unappreciated, for it requires an acquaintance with the dramatis personae and the conditions under which described events happen, in order to extract all the flavor of humor which makes them en-joyable. ■MMtimp mum. 120 THE GETTYSBURG MERCURY. This volume is certainly deserving of hearty recognition, and it is hoped that many of our alumni and friends of the college, will show their appreciation of the arduous labors of the class by acquiring a copy. Reader,—it will add permanent value to your library. Send for a copy at once. —G. D. S. TICK-TACK-TO. THERE is scarcely a conversation indulged in with a greater relish, by persons of a maturer age, than that relating to bygone games and pastimes. The children love to linger by the hearth and will listen with rapt attention, as their father relates to them the strange and antiquated games of his boyhood days. There are, perhaps, few things that brighten the eyes of our sires more readily than mere mention of puerile games. They love to cast away the titles of Rev., Dr., or Mr. and think of the time " when you were Bill and I was Joe " and, if one is in their presence when they are exchanging reminiscences he may be both instructed and agreeably entertained. Nor is the relish for this peculiar sort of conversation peculiar to those who have already passed the meridian of life and can no more win for themselves the eclat of the beholding multitude, or the more modest commendation of a few admiring friends, or even the laudatory look of defeated opponents. It belongs also to us. What conversation can be introduced into our college boudoirs that will be more highly appreciated and rejuvenate happier reminiscences than that relating to the games we used to play. The occasional rehearsing of them forms a condiment whose pungency quickens our appetites for more solid and substantial forms of mental food. As such, however, they tend only to excite pleasure and enter-tain, and are evanescent in their effects. If, on the other hand, we view them in a more serious manner and forget them as prolific of. an almost boundless store of sport and hilarity, we may not only become instructed but learn, to our amazement perhaps, that we are playing the same old games to-day. THE GETTYSBURG MERCURY 121 To demonstrate this we might choose almost any one of the limited number of juvenile games as an example. Since they all bring forth some phase of life and all contain some suggestion for reflection. Blind-man's-buff for instance, teaches us how gro-tesquely we often grope after the fleeing prizes of life. Leap-frog portrays to us the use to which we are sometimes put by men of ulterior motives and the humility connected therewith, but there are some, however, whose peculiarities stand out in bolder relief than in others ; some whose lessons are more drastic than others, and in few is this more obvious than in the triplicate game of tick-tack-to. It is very simple and probably the most universally known game of childhood. As a palladium against the captiousness of the nursery its charm is talismanic. In point of economy there are few games that excel it: a pencil, a slate or a small slip of paper with two parallel lines drawn perpendicularly upon it and two similar ones crossing them horizontally constitute all that there is of a material outlay. A series of three marks occupying three successive spaces in any direction brings to a proper conclusion the course of the game and suggests to us now, what in childhood's happy hours were arcanums unraveled. One of them is contained in the nature of the game. Unlike many other of our juvenile pastimes tick-tack-to is not a game of luck nor chance but a game of skill and intelligence. Were it a game of luck we would be at a loss to derive any lessons from it and could certainly not compare it to life; since those who have attained to the highest success in life cherish little hope for the man who depends on luck. One of our beloved martyred Presidents, the lamented Jas. A. Garfield, once said, "Luck is an ignis fatuus. It leads to ruin but never to success." The idea that certain men are rich, or prosperous, or popular, because they were born under such circumstances under which it would be impossible for them to be otherwise, finds little credence among successful men. It is not the man who is born at a certain time, in a certain place and under certain environments who attains to success but he who works; he who is active; he who is alive to every oppor-tunity; he whose every mark is prompted by an intelligent judgment. 122 THE GETTYSBURG MERCURY. Another deduction that we can 333ke from the game and apply to life is the mode of procedure. "We used to play7 it under dif-ficulties. Our advance was retarded by opposition. This of course is a common condition to all games and would not distinguish this particular one from any other; but the unique-ness of it lies in the fact that the opposition is created by one op-ponent and only one. Thus in the game of life we proceed against hindrances and against hindrances of but one opponent. Who is that opponent? Who is he, or what is it, that barricades our onward march every time we take a stride toward success ? Who is he who with rude hand dashes a cross before our line of progress every time our success is partially and almost entirely accomplished ? Is he to be found in the personality of some one other than ourselves ? May we detect him among the multitudes that pass before us from day to day ? May we discover him among those with whom we are continually associated ? No, prospection will never reveal him, introspection may. We have but one opponent to contend with, and that oppo-nent is self, the lower self; the material as opposed to the spiritual self. We sometimes suppose that our embarrassments in life, are traceable to external circumstances, to some person or company of persons, or to some combination of circumstances. But they are only the marks used by ourselves against our-selves. They form the media through which our lower nature reacts upon the higher and thus continues the dualisdc game of life. St. Bernard appreciating this fact once said "Nothing can do me damage but myself," and if we wish to reject authority can we not by a little self-examination verify this statement within the scope of our own experience ? Does not the soul in becoming cognizant of the virtue of a certain act urge us to do it ? Does it not in the language of the game place its mark in one of the spaces ? What follows ? The body shrinks from the performance of the act. It opposes the impulse of the soul. It places its mark directly before the one already made. No sooner has this taken place than the conscience comes into prominence. Not willing to acquiesce with one repulse it incites us to a redoubled effort. It places its mark before the THE GETTYSBURG MERCURY. 123 original one in another direction. This being done up swell the passions and endeavor with vehemence to thwart the noble im-pulse and crush all that is holy and pure in man. So the game proceeds with vacillating fortunes until the lower or the higher na-ture is conqueror. A contest it is trying and severe, unheard by mortal ear, un-seen by mortal eye. Revealed only to Him under whose dispen-sation it is possible and under whose guidance only, success is at-tainable. —MARKS. A HERO'S REWARD. IN the spring of 1825, Mr. Perry decided to sell his plantation, very reluctantly however, for it was here that he was born, and then with his family, which consisted of his wife, a son, Philip, and a daughter, Mabel, to go North. It was at Mr. Hall's suggestion that he located in a small town in the northern part of New Jersey and went into business with him. These two families had known each other for years and naturally at once there sprung up a friendship between Philip Perry and Mr. Hall's only son and child, Tom; but from the start Tom seemed to have an especial regard for Mabel, which grew into an affection as they grew in years. The Perrys belonged to one of the old, aristocratic, south-ern families, and were, as most such families were, wealthy. The Halls were also quite independent, though not in such affluent circumstances. The two boys were sent to a small military academy near New York and graduated in the same class. A short time after this Mr. Hall was taken ill and died very suddenly, and a year later Mrs. Hall died through grief for her dead husband. Mr. Perry was also affected by his partner's death and having closed out the business, moved South and located in Richmond, Va. He in-sisted that Tom should go along and make his home with them, and Tom, with a little persuasion from Mabel, did so. The boys went to a southern college, where they stood high both in their class and in the esteem of their fellow students, for they were good, jolly boys. During this time the affection be-tween Mabel and Tom ripened into love and Tom often wished in-wardly that some day he might win Mabel for his wife. y—^——™—™——— miyiiyi 124 THE GETTYSBURG MERCURY. After their college days both young men had entered Mr. Perry's employ and held positions of trust and responsibility in his cotton mill. So well, indeed, did they manage their work, that Mr. Perry was about to entrust the entire management to them when that dreadful war, which so nearly resulted in the division of our Union, was declared. Recognizing his duty, Philip Perry at once left home and enlisted in the 9th Virginia Regiment. Tom Hall hesitated. He was undecided as to what to do. He knew full well that his duty was to go North and join a Northern regiment, and yet—if he went, it meant, as Mabel had said, that all would end between them, for Mabel was a Southern girl. What was he to do ? On the one side he could hear the call to duty, on the other Mabel wanted him, if he went at all, to go with "Phil." At last his love for his country conquered even his love for Mabel and as a true patriot he secretly made his way north and enlisted in the 1st New Jersey, which was mustered in at his old home. It is needless to follow these two soldiers through the entire campaign, but suffice it to say that they soon rose to high positions in their respective regiments on account of their bravery. On the evening of July 2, 1863, General Dee, who was in command of the Confederate forces at Gettysburg, realizing his perilous position and possibly expecting defeat, decided to make one final, desperate attempt to break through the Union line. That evening he had been reinforced by Stuart's Cavalry and was therefore hopeful of success. His plan was to pierce the Union line at a point now called the "High Water Mark," for that was the turning point of the greatest battle of the Civil War. Everyone has heard of Pickett's famous charge and how the men of the two armies fought hand to hand over the old stone wall. The 9th Virginia belonged to Armistead's brigade, which was almost annihilated in this charge; yet many were not killed outright, but after suffering untold agony, gave up their lives for the cause they thought right. During this battle, a number of regiments were held in reserve and among this number was the 1st New Jersey. On the evening of July 3d, the news of the famous charge of Pickett's Division and the successful repulse was reported among the various Union regiments, and of course reached the 1st New Jersey. \THE GETTYSBURG MERCURY. 125 Colonel Tom Hall recalled the fact that Philip Perry had en-listed in the 9th Virginia, and he imagined he heard some one say that he was dying on the field. Before dawn he had mounted his faithful horse and galloped off in the direction of the "clump of trees." For some time he searched, but all in vain, and he was about to leave when he heard a terrible groan a short dis-tance beyond the wall on the Union side. It startled him and he drew up his horse, dismounted and stooped over the half-dead body of a Confederate officer. Imagine his surprise to find his old friend, Philip Perry! He gently bound up his wounds and raising him, placed him on his horse and rode slowly back to his regiment. Major Perry remained in a semi-conscious state for several days and when he came to, he found himself in Colonel Hall's tent and over him was stooping his dear sister, washing off the blood stains and dressing his wounds. As soon as Major Perry was strong enough to be moved, Colonel Hall had him exchanged for a Northern officer, who was confined in one of the Southern prisons. However, before Major Perry was taken to his home in Rich-mond, the old love between Mabel and Colonel Hall had over-come all difficulties between them and under a tree not far from where Major Perry had fallen, he witnessed a short ceremony, performed by the Chaplain of the 1st New Jersey, in which Colo-nel Hall received "A Hero's Reward," the long desired hand of Mabel in marriage. —W. G. L. '01. «**£> AN ART FAD. IN these days when fads in almost every line of trade and pro-fession are so prominent, one is not surprised to find that there is such a thing as a fad in art also. The particular one selected for the subject of this essay is that style so prominent at this time in the art. of painting—the poster. The poster occu-pies the same place in the art of painting as do dialect stories in literature or syncopated rhythm, i. e. the so-called "rag-time" in music. Not any of these is a recent creation but rather a recent craze. For instance, considered from a scientific standpoint, "rag-time" has been co-eval with the history of music. 126 THE GETTYSBURG MERCURY. Beethoven and Mozart wrote it and even in the incomparable fugures of Bach we encounter it. And in literature, dialect did certainly not originate with James Whitcomb Riley. The possibilities of the colored poster were first made known to English and French artists when the great flaming advertise-ments of Barnum were first placed upon the exposed places of London and Paris. The influence of these American advertising posters became prominent and at once both England and France began to contribute colored products in poster art, which, while far more artistic than the pictures of Wild West performers, were not after all so widely different in outline, color and other quali-ties. Between that day when vivid and crude design was pre-dominant, and to-day when the artistic poster is so much in evi-dence, there is a considerable advance apparent. Simultaneous with the growth of the poster and practically very beneficial was the adoption of it by the up-to-date theatre for advertising purposes. And it lends itself admirably for this pur-pose. It has also been a favorite mode of advertising in the com-mercial world, but one sees less of its use in this manner now than formerly. In the literary advertising department, the poster still is very prominent and is the usual way of calling the attention of the public to the merits of some special edition of a publication. With the rise of the poster came collectors of posters ; in America alone, there are said to be over 6000 persons who devote themselves to this pursuit. Poster literature and expositions too have come into existence. Of the different nations and in point of art, France, as usual, leads. The "father of the modern poster," as he has been called, M. Cheret, however, says that he owes his first inspiration to the Barnum lithographs. America is greatly indebted to France in this line of art. One of the foremost poster artists who, before he studied in Paris, used to draw the gorgeous theatre lithographs, came back to America and completely transformed the coarse ex-aggerated travesties. For this reason Matt. Morgan stands high among the American poster artists. Of the English school, Aubrey Beardsley is probably the best known. He is said to be always "scholarly" and while "char-acteristic," yet he never loses sight of the fundamental principles of the art in his work. The purchase of a celebrated art-poster called "Bubbles" by the proprietors of a certain soap, seemed to THE GETTYSBURG MERCURY. 127 give a new impetus to the poster art in England, and many artists no longer hesitated to enter the ranks of poster painters. In Germany, the poster has not developed very rapidly or sat-isfactorily. German artists in every line of art work seem to ad-here strongly to allegorical symbols and types. This is evident in the tonal art as well as in painting. Probably the best known of the German school is Heine, who creates posters for several humorous periodicals. Austria seems to have paid little or no attention to the art; one can find no mention of Austrians who won a reputation for them-selves except in the line of music. All other arts seem to be con-sidered unworthy any attention. There is a poster art school in Belgium which has won a prominent position in this line of art. Though it requires a considerable amount of education on cer-tain lines to enable one to understand correctly any art—such a training, for instance as a good art-critic possesses—yet it is pos-sible for almost any one to appreciate, to some extent, at least, the art of poster painting. Tolstoi .says, "When I call up an emotion which I have ex-perienced, arid by signs, words, colors, sounds, transfer this emo-tion to another, that is art." Bearing this definition in mind and using it as a test, attention is called to a few examples of posters, each peculiarly distinctive in one manner or other. Probably one of the most striking and unique of the products of American artists was the poster announcing a special issue of the New York Sun. A woman with a trailing purple mantle walks through a green meadow, one hand uplifted with a warning ges-ture as if to command silence. The graceful though striking de-sign indicates a fertile imagination as the originator of it. That the creator—~L,. I. Rhead—is not only highly imaginative and fanciful but even verging upon the eccentric is evidenced by others of his productions, in one of which he has painted a woman with a cloak of dark green, outlined boldly against an orange back-ground. Among the posters published by Harpers Bros., was one en-titled "The Letter Box," which, though simple in ideas yet proved very effective. A little Cupid standing on tip-toe, drops a valentine in the slot of the corner letter-box. The entire pic-ture is not at all pretentious, but entirely characteristic and well adapted. ■pJMfiM 128 THE GETTYSBURG MERCURY. Another poster published by the same firm in 1892 is worthy of noting because of the manner in which the lettering is incor-porated in the picture. "The Wooly Horse" representing Napoleon I. on horseback overlooking the battlefield,—with a fiery sky for background, was a very successful poster published by the Century Co. A famous American artist in this line is W. H. Bradley, whose work resem-bles somewhat that of Aubrey Beardsley. His posters seem to have a peculiar melancholy in their expression. Among the prominent advertisements of merchandise, that of Pears' Soap—a humorous sketch of a ragged tramp—is, with its forcible inscription, one of the most prominent. An original idea was brought out by an English artist in the use of the "Silhouette"—a black figure outlined in white stand-ing out against a black background. The manufacturers of a certain blueing, first used this style of poster for an advertise-ment. An advance in poster drawing was made after the several ex-positions of posters which have been held lately. One of these, held in Belgium in 1894, served to propagate extensively the new ideas of the French and the Belgian schools. How long this fad will last, is difficult to predict. It is highly probable, however, that the art will advance with such strides in some particular direction that the new development will com-pletely swallow up the present popular poster style,—a style, which has been characterized as a "phantasy most horrid and de-testable." —W. W. F. '00. RETRIEVED. JIM HAL,Iy, an inhabitant of the village of Alberton, had the reputation of being the most cowardly man to be found in ten counties. He was known to sleep at night with his room door double-barred and the windows tightly fastened, for fear of being killed in his bed by some wandering burglar. He believed in ghosts and witches ; and the small boys often took advantage of this superstitious fear and belief by placing a white sheet over a stick and when Jim came along, waving it wildly. Jim ran like THE GETTYSBURG MERCURY. 129 a deer for home and next day was made the butt of innumerable jokes. This fear of Jim's was to be accounted for only by the fact that from his birth his mother had shielded him from all dan-ger and taught him to look to her as his natural protector. So when he had come to manhood he had not learned to rely upon himself. He often tried to overcome his cowardice but could not do so when the critical moment came. Affairs were in this state up to the year 1862 when the report was circulated in Alberton that Jim Hall had disappeared from the village. No one had seen him go away, so all the villagers could do was to make suppositions as to his whereabouts. Some thought he had run away for fear of being drafted into the service. A large number of the able-bodied men of the village had already joined as volunteers and now it was reported that additional men were needed and that these would be taken by drafting through-out the whole North. Just the day before Jim Hall's disappear-ance the report was brought that the drafting of Alberton men would take place in four days. So there were some grounds for the common belief that Jim had run away to escape the war. One can easily imagine their surprise when the next day they heard that he had gone to the camp of the Army of the Potomac and had been enlisted as a private soldier. The people treated it as a great joke and many were the jests at poor Jim's expense about his long legs standing him in good stead when a time of great danger should come. However Jim had realty joined the army and was by a lucky chance placed in the same company with the other Alberton men who had gone out long before as volunteers. And as another piece of good fortune the man who was now captain of the com-pany— the former captain having been killed shortly before—had been the only man in the village of Alberton who had not jeered and laughed at his cowardice. This gentleman, a Mr. Leonard, had been a friend of both of Jim's parents and when Jim's father died had been appointed guardian to Jim. He now encouraged Jim to make a man of himself and was the instrument of Jim's doing so. Soon under their gallant leaders they were fighting the rebels with varying success about the swamps and morasses of the Chickahominy. In the battle of Chancellorsville, lost though dearly sold, our hero was in the thick of the fight. At the first mmmw 130 THE GETTYSBURG MERCURY. shock, however, he turned as if to flee, but at the word of his commander he turned and fought so bravely and so well that he was commended by his captain. Nearly two months later he found himself marching north-ward with his companions to try to check the invasion which the victorious Lee was making upon the North. On July 1st they found themselves on the peaceful fields of Gettysburg so soon to be turned into a veritable slaughter pen. In the first day's fight their regiment was stationed at Seminary Ridge with several other regiments to check the advance of the so far victorious rebels until further reinforcements should come up. Soon the overwhelming numbers of the Confederates forced the greater part to fall back and one lone battered and torn regi-ment was left to face the storm. It was too late to retreat now and almost useless to fight longer, but the blood of the Halls who had fought in the Revolution suddenly came coursing through the veins of Jim, and seizing the colors from the color bearer who had just been shot down Jim waved them aloft and shouted, "Come on boys, don't run, only cowards run." As he uttered the words a volley from the enemy, who had now almost sur-rounded the gallant man and his little band, laid poor Jim low and silenced forever the heart which had just learned that it still had brave blood to force through a manly body. Now indeed had Jim retrieved his name from the most disgraceful blot which can be put on any man's name. The rest of the command were captured and taken prisoners. Several years after they were ex-changed and when those Alberton men who had come safely through the war had returned home, they never tired of telling how nobly Jim Hall had proven that he no longer was the coward whom they had once despised. —V. FREY, '01. c®P June falls asleep upon her bier of flowers; In vain are dew drops sprinkled o'er her, In vain would fond winds fan her back to life Her hours are numbered on the floral dial. * * * June is dead, Dead, without dread or pain, her gayest "Wreaths twined with her own hands for her funeral. —Lucy Larcotn. THE GETTYSBURG MERCURY. EDITOR'S DESK. 131 THE '00 Spectrum is ample proof that the catalogue of special features has not been exhausted. As it is customary for the Junior class in publishing a Spectrum to make a special feature, '00 has chosen the "Literary Record of Gettysburg Alumni.'' This feature alone would make thepresent Spectrttm val-uable, as well as interesting. Few besides those who have worked upon such a feature can form any idea of the toil and care re-quired to carry it to a successful issue. Certainly it is but justice that the college paper, in the name of the students of Gettys-burg, congratulates the editor and assistant editor, by whom the "Literary Record" has been compiled and arranged, upon their useful, hard work. But not only may the individuals, on whom rested the responsibility for such a task, be congratulated; Gettys-burg may congratulate herself upon the present annual, which un-doubtedly will be regarded for years as a model of neat, original work. Articles by our alumni relating to Gettysburg, would be re-ceived eagerly by the MERCURY. Stories about college life as it was some years ago, the difference between Gettysbtirg of to-day and Gettysburg of the past, or almost any article of like kind, would find space in our pages. The MERCURY would be glad to print poems by the alumni, as well as prose. HYPNOTISM. HYPNOTISM, as best defined, is a nervous artificial sleep. The same thing was formerly called animal magnetism. Hypnotism applies to a definite nervous state and is brought about mostly in persons having a delicate nervous system. The first true inquirer into hypnotism was Dr. Baird. He saw some experiments performed by a professional maguetizer and at once decided that they were merely an arrangement to deceive the people, but after careful observation and study into the methods of producing a state of hypnotism, he decided that it was genuine. After careful study and experiment, he decided that there was no such a thing as a magnetic fluid flowing from the mind of the operator to that of the subject; but that the true cause of hypno- ■mmtnm 132 THE GETTYSBURG MERCURY. tism lay in the fact that the nerves of one of the senses become deadened by over exertion or constant concentration on a point, and on this account become powerless to act and the person goes into a deep sleep or lethargy. In this, his followers disagree with the other school, headed chiefly by I,afosataine. He asserted that hypnotism was produced by a fluid, known as the magnetic fluid, which passed from one person to another and by its attraction could cause a person of strong will to have complete control of a person of weaker will power, being able to compel him to do anything commanded. Baird was led to his theory by the fact that his subject, while under the influence of this power, was unable to open the eyes. He at once came to the conclusion that excessive fatigue was the only thing that could cause this strange phenomenon as he made no attempt at personal magnetism in producing the sleep. His experiment was performed in the following way. He asked his subject to sit and look steadily at the neck of a wine bottle and allow his mind to wander. The bottle was placed at such an elevation as to cause considerable fatigue to the eyes. After three minutes the subject's eyes were filled with tears, then his eyelids closed and a little later he was in a sound sleep. This experiment proved beyond doubt that a person can be hypnotized without the presence of a second person or operator; but can do it himself by an experiment made under similar circumstances as mentioned above. Baird pursued his discoveries and with the aid of numerous other experiments tried hard to have hypnotism recognized as a science. They were not successful, however, and to-day it is re-garded mostly as something for a show, or to interest the people, without much regard to its cause and the scientific qualities. The most familiar form of producing the state of hypnotism is the following : the operator directs the subject to have no par-ticular thought on his mind, but to let it wander, and gaze steadily into his eyes. After that he generally makes a few passes with the hands, gently rubbing the eyelids, etc., until his subject is in a sound sleep. In explanation of this method I would say that the gazing into the eyes of the operator for some time, is exactly the same as looking at a brilliant object, both have the same effect of fatiguing the nerves of the eye and producing sleep. THE GETTYSBURG MERCURY. 133 This is strikingly illustrated in an experiment with a frog. If a frog is taken in the hand, having the thumb resting on the stomach, and the back gently rubbed ; the animal will go to sleep at once and can be stretched into all sorts of shapes. Another way, as has been stated before, is that of looking steadily at some object. It has also been discovered that the other senses have the same power as that of sight. Thus if you produce monotony in music sleep is produced. Sharp suspense or fright has the same effect of transfixing some people and this has been decided by students of the science ( as it is called by the disciples of hypnotism) to be hypnotism. After careful study it has been proven that the senses of taste and of smell have the same strange effect. As regards the uses of hypnotism little of importance can be said. It is used mostly by professional showmen who call up subjects from their audience or may have them with them. They compel them to do anything they command. One of the common-est ways and also the best to show the entire oblivion of the subject, is the experiment with the letter. The subject is handed a letter and told it is an orange, he immediately eats it with great relish, then if told it is sour at once spits it out with an expres-sion of disgust on his face, showing the subject believes every-thing the operator tells him and is entirely at his command. This, however, was never intended for the chief use of hypno-tism. The experimenters tried to use it in surgery, etc., but it has been found that while some people are easily influenced others give much trouble, so that it would be impracticable to use it in a case of amputation when ether or chloroform serves the same purpose more quickly and better. It has been settled, however, that strong habits can be changed. Persons who have been accus-tomed to strong habits all their lives have been entirely changed and new habits formed. Thus, while very little has been definitely decided about this strange phenomenon, there is every indication that some day in the near future, it will be taken up by experimenters and philoso-phers, thoroughly sifted, and then be proven to be of great value in many respects. It is now in its infancy. —C. J. D. '00. wmm 134 THE GETTYSBURG MERCURY. "THE INFLUENCE OF CHRISTIANITY ON ROMAN JURISPRUDENCE." CHRISTIANITY and civilization in its highest degree of ex-cellence are synonomous, hand in hand like two insepara-bles we find them enthroned upon a majestic seat, ruling, guiding, influencing, and may we say carving the destiny of every great nation. If a country is civilized and christianized we need no other proof to be convinced of her pre-eminence and suprem-acy. A glance will show us also that such countries have the most admirable and thoroughly developed codes of jurisprudence. The influences, whose marks upon "Roman Law" are par-ticularly indelible and prominent, may be divided into three classes: conventional morality and usage, natural reason and justice, and Christianity. These fundamental principles in turn clearly mark off three distinct epochs in the development of Ro-man Law. According to the law of the first nearly all power was vested in the individual and that individual was the "Pater familias." The idea of a State right has scarcely begun to dawn upon the Roman mind. At the beginning of the second epoch, Rome is no longer a col-lection of separate communities : Italy, Greece, Spain, Africa, in short the whole world is in her power. Law based on such a no-tion as practically unlimited power of the pater cannot regulate such an empire. No longer is Rome divided into families, tribes and clans, each separate and distinct, but everything concentrates upon and emanates from one person—the Emperor. Something broader, something more general is demanded and, in response, came the principles of the stoic philosophy. Roman Law can-not stand still while the State is enlarging; it too must broaden, and natural equity, justice and reason furnish the soil for its spreading roots. But one link yet is necessary, one step yet is lacking ere the ultimate degree ofperfection is reached. For Christianity it remains to weld the chain and fill the gap which is to make "Roman Law" such a body of principles as to be applicable at all times and among all nations. In such principles as—"honeste vivere, alterum non laedere, suum cinque tribuere," the dawn of Christian-ity can already be seen, only time is needed until its genial rays shall burst forth with increasing intensity. THE GETTYSBURG MERCURY. 135 Christianity had been now the established religion of the Ro-man Empire for more than two centuries; and the influence of its principles was making an untold effect upon the spirit, if not so much upon the letter, of Roman law. The complete moral, social, and political revolution, through Christianity, created a necessity for new laws adapted to the present order of things. Under it a new order of men of a peculiar character, with special privileges has grown up; churches and monasteries had been formed; certain offenses in the penal code were now looked on with a milder or more severe aspect, and vices, which formerly had been tolerated, became crimes against the new social order. It might be shown that Christianity as a system of doctrine, is peculiarity adapted to meet the secular as well as the spiritual wants of men and would naturally work its way into their codes of jurisprudence. But a direct proof is unnecessary, for after hav-ing shown its influence upon the various elements in "Roman L,aw," we can reason backward and reach the same conclusion. Roman Law may be conveniently divided into three classes:— that of Persons, Property and Crime. From time immemorial, slavery had been customary among all nations. Aristotle reasoned "that nature intended barbarians to be slaves, and among the natural and honorable means of ac-quiring wealth, he classes, making war in order to reduce to slavery such of mankind as are intended by nature for it." As an institution of custom, then, slavery received its sanction at Rome. Christianity had exalted a slave to spiritual equality and this religious elevation could not be without influence on their tem-poral and social position. They were no longer to be regarded as brute beasts and inanimate things, nor could they be destroyed by their masters with as much impunity as his other property. Our respect must here be paid the heathen sovereign, Antoniuns, who declared that the master who killed his slave without cause, was liable to the same penalty as if he had killed the slave of another. Justinian writes, "In these times, and under our Em-pire, no one must be permitted to exercise unlawful cruelty against a slave.'' Prohibition of marriage to slaves had been a deep-rooted prejudice for centuries, yet this too melted before the rays of its benign influence. The stricter forms of manumission—the vin-dicta freeing by census or testament were relieved by easier and ■VAMHtfi 136 THE GETTYSBURG MERCURY. more liberal ones,—for example, per epistolam, inter amicos, in ecclesiis; and whatever of legal impediments yet existed were re-moved by Justinian. Along with this the distinctions formerly made between freedmen, whereby a slave owing to certain kinds of misconduct, when manumitted, could not receive full citizen-ship, were likewise abolished so that after Justinian all libertine were cives Romani. The ancient laws regarding marriage and the legal status of women each crystallized itself in conformity with the new order of things. Marriage was no longer a civil contract but a religious sacrament and the penalties fixed upon celibacy and childlessness were removed. Divorce had been one of the greatest plagues at work in dis-solving the unity of the Roman family. Since the establishment of the XII tables, in 450 B. C, it had been legally recognized. Seneca says of Naecauss, probably satirically, that he changed his wives as he changed his dress. And it is the same writer who says '' that the noble women of Rome calculated the year not by the consuls, but by their husbands." Juvenal, in the bitterness of his satire, could not find words adequate to express his intense indignation of this evil. It is said that the sixth century of Roman greatness had begun ere the evils of a primitive conception that the wife was the property of her husband and might be dismissed at his pleasure were revealed and public feeling shocked by the re-pudiation of a virtuous but barren wife by Spurius Carvilius Ruga. Had Christianity performed no greater good for human society than the removal of this corruption, its influence would not have been in vain or useless. The rights of women over their property were made sub-stantially equal to men's as was the right of guardianship over their children. Parental power, though in theory absolute, had long fallen into disuse and was almost a theoretical nothing long before the ad-vent of Christianity, but whatever of severity yet remained was abolished. Constantine openly declared that the father, who killed his son, should be held for murder, nor was the father allowed to ex-pose his children or sell them into slavery, except in the rarest cases. The proprietary rights of the son, too, were extended from the peculium castreuse to the peculmm quasi castreuse and still later to the peculium adventitium. THE GETTYSBURG MERCURY. 137 Milman says '' Christianity made no change in the tenure or succession to property.'' '' Seeking inheritances by undue means was prohibited and restrained by law as an ecclesiastical evil." Church property was regarded sacred and inviolate and as Milman says was "the sole proprietor, whom forfeiture or confis-cation could never reach; whose title was never antiquated and before whose hallowed boundaries violence stood rebuked." Gifts to temples could now be sold or pledged for the redemp-tion of captives, a purpose which the old Roman law would have disdained to contemplate. In the penal laws of the Roman empire, the influence of Chris-tianity was but moderately exerted. The abolition of the distinc-tions drawn between freedmen and slaves have already been re-ferred to. Crucifixion as a means of punishment was removed by Constantine, rather as an act of religious reverence than of humanity. But in the suppression of gaming and the prohibition of women being forced on the stage, traces of its influence can be seen. As is natural from the subject material under discussion, the law respecting persons has undergone the greatest change. But all these changes, whether in the penal code or in the law of proprietary rights and obligations, were but a means, which made the Roman system adapted to the regulation of all peoples and at all times. When we see that the very barbarians who conquered Rome were in turn conquered by her system of jurisprudence, we are not a little filled with surprise; but when we find it not only influenc-ing and forming the basis of, but being incorporated in the legal codes of almost all nations, we come in contact with an effect that requires an adequate and efficient cause. After paying all due re-spect to that peculiar, innate faculty of administration in the Ro-man mind, without detracting one iota from the excellent opinions of the juristconsuls or limiting in the slightest degeee the wonder-ful influence of stoicism, as a system of philosophy, we are com-pelled to admit that none of these were individually or collectively efficient to produce such an effect. To Christianity must be as-cribed the credit of basing Roman law upon principles, so univer-sal and so humane, as to be applicable not only among the Roman state but among all nations of all times. If this statement seems rather large in its exposition and sweeping in its results, a few illustrations may be necessary to establish its validity. r \UIUW 138 THE GETTYSBURG MERCURY. Can a law, which considers certain classes of men as mere brutes or inanimate things be reconciled to our conception that by nature all men are horn equal ? Or who can reconcile the idea that a woman is but the property of her husband, capable of being dismissed at his bidding, with our conception of human society ? What place could the principle of "patri potesias have in the legal status of a nation, all the citizens of which have equal rights be-fore its laws—yet in the wisdom of the juristconsuls and in the records they have left us, these principles and many others similar to them are found embodied. Stoic philosophy left to Roman law the principles of equity and humanity, but the basis of natural law upon which they rested and by which they were judged and applied, was subjected to a complete change ere they were capable of incorporation into modern jurisprudence. Christianity recognized these same principles of equity and humanity, but substituted truth instead of natural law as their criterion. Based on this principle and judged by this standard the conceptions of equity and humanity lose their limi-tations and assert themselves with the force of universality. It is only under these conditions that we find Roman law incorpo-rated in the laws of every great nation, and only in Christianity do we find a cause adequate to such an effect. Among legal historians there is a vast diversity of opinions with regard to the influence of Christianity upon Roman legisla-tion. This variance, Morey rightly attributes to their failure to distinguish Christianity as an ethical system from the church as a corporate institution.'' It must be remembered that the church, like all institutions, even though divine in their origin, is never-theless subject to the frailties of humanity by which it is regu-lated and too often fails to cancel the limitations between the ideal and the real. The family and the matrimonial ceremony are regarded as divine in their origin and sanction, but do they ever conform to the high standard by which they should be regulated? Perfection is an attribute not of this world, and if the church as a corporate institution has failed to attain the high plane established by the principles it recognizes and enunciates we can condemn the prin-ciples with no more justice than we can reason that a college edu-cation is of no advantage because some particular individual, who has taken a college course, has made a miserable failure in life. THE GETTYSBURG MERCURY. 139 However intolerant the church may have been against pagans, jews, and heretics, the principles of Christianity as an ethical sys-tem remain unsullied and untainted, notwithstanding the injus-tice of their application. Morey has admirably summarized the whole matter: "In spite of the fact that the church in some cases set its face against civil equity, and the fact that Roman law had already received a liberal temper from the influence of Greek philosophy, it cannot be doubted that the progress of the law, in general, kept pace with the unfolding of ethical ideas in the Roman mind; and that so far as Christianity furnished a system of ethics more just, liberal and humane than that of stoicism, it brought to bear upon the Roman law a moral power superior to that which had previously been exerted upon it through the writings of the philosophical jurists." Who then can doubt that in Christianity, Roman law reaches the summit of its greatness and the beginning of its uni-versal application ! —W. E. B. '99. M THE CONFLICT OF THE AGES. AN is a progressive being. Contentment is foreign to his very nature. He is continuously looking to something beyond, to a condition higher and better. As his intellect broadens and quickens, he invariably becomes desirous of greater freedom. This love of liberty is connate with his physical and mental constitution. But there is also another desire deeply implanted within his breast, a desire which is destructive of the liberty of others. It is the love of power, the inherent desire of man to rule over his fellow:man, an ambition, the natural outcome of which is despot-ism. These two desires tend toward opposite directions. Between them is an irrepressible conflict. This conflict is as old as society and as persistent as humanity. From the earliest times its vary-ing phases have determined the condition of the race. The history of civilization is largely the story of this conflict, the story of human liberty struggling against human despotism. The outcome of this struggle has varied in different countries. ; 140 THE GETTYSBURG MERCURY. As a result their states of society have been vastly different. Just in proportion as liberty has triumphed over despotism so civiliza-tion has advanced beyond barbarism. Among the nations of an-tiquity despotism prevailed everywhere. As a consequence their civilization never advanced beyond a certain point. They were marked in every case either by iunobility or by slight advances and retrogressions. In the countries of Northern Europe arose a people whose chief characteristic was their love of freedom. Here liberty found a soil peculiarly fitted for her growth and develop-ment. What has been the result? Have these people an}' ele-ments of civilization not enjoyed by the nations of antiquity? Read the story of their steady progress through the Middle Ages. L,ook upon the unequalled state of civilization among them to-day and question not the advantages of liberty over despotism. Con-trast the despotic nature of ancient Assyria with the liberal char-acter of modern England and wonder not that the latter stands to-day the first empire of the world, while the former exists only upon the pages of history. During the dark ages humanity struggled against the most terrible despotism man had ever known,—the despotism of igno-rance and superstition. The human mind neglected, uncultivated and depressed sank into the deepest ignorance. So prolonged and intense was the gloom enveloping Europe that her people seemed incapable of advancement, society seemed destined to end-less barbarism. Gradually, however, knowledge became more diffused, inventions and discoveries awakened the human intellect from its long sleep, and man began to learn the truth about him-self and the world. This truth has made him free. Freedom of intellect naturally led to a desire for religious freedom. Ecclesiastical tyranny was incompatible with intellect-ual liberty. Enlightened minds refused to submit any longer to the authority of the Pope. Contentment gave place to unrest, un-rest to action, and action to liberty. The Reformation was more than a contest between Protestant-ism and Catholicism. It was an insurrection of the human mind against pure ecclesiastical monarchy. Do you wonder that the movement was crowned with the most glowing success ? Papal authority in Northern Europe was destroyed forever. This religi-ous liberty will eventually spread over the entire world. The religions of the world are becoming more and more imbued with THE GETTYSBURG MERCURY. 141 the sentiment of liberality. Sectarian differences are gradually disappearing before the growing light of intelligence. Creed and dogma will be re-adjusted more and more under the light of ad-vancing truth. Formal religion is being supplanted by true Christianity—that "divine keystone in the arch of universal his-tory." With an ever increasing radiance the light of Christianity is slowly but surely penetrating the darkness of heathenism, and hastening the approach of the time when the people of all the earth, regardless of race, sect or nationality, shall bow in worship before the one true God. Turning from the religious to the political world, we behold a revolution no less wonderful, a mighty struggle between despotic and liberal principles of government. This struggle shook Europe from Scandanavia to Italy, and snatched a new world from the threatened grasp of tyranny; a revolution of which the Reign of Terror was but an incident. The ideas engendered by the Reformation inaugurated a mighty epoch of political regeneration. The great sovereigns of Europe, one after another, have been deprived of their prerogatives until to-day the last one sits trembling upou a tottering throne that threatens to fall at any instant. The day is not far distant when even the "Autocrat of all the Russias" shall see his sceptre depart into the hands of his subjects. Thus we have seen during the last three epochs three great stages of the onward march of civilization; three mighty victories for the cause of struggling humanity; victories which include in-tellectual, religious and political freedom. To-day the world has entered upon another epoch; an epoch which brings with it questions far more complicated than those of the past, and far more momentous than those that have convulsed Europe with centuries of revolution. The great struggles of the past have been, in the main, suc-cessful, and the echoes of the mighty battles for civil and religious freedom are growing fainter and fainter. But the cause of freedom is not yet won. The hosts of oppression have been driven from the fields of church and state only to return with renewed vigor to attack freedom in the field of industry. The scene of conflict has extended from the old world to the new. Society has entered upon an industrial age. Modern civilization is marked by ma-terial progress unprecedented in the history of mankind. Great 142 THE GETTYSBURG MERCURY. inventions have revolutionized travel, commerce and manufacture. Ocean steamers, railroads and telegraphs have practically annihi-lated time and space. By constant and easy intercourse with the world, man's views have been enlarged, his energies stimulated, and his rate of progress quickened. Yet with all this unparalleled progress in the industrial power of society, there has come no proportionate improvement in the condition of the masses. While the great industrial development of the present age has brought many blessings for mankind, the tyranny of selfish men has monopolized these blessings for the few. Capital gets the lion's share of the world's wealth, while Labor is reduced to a condition of servitude. A few monopolists amass colossal fortunes and revel in Croe-cian luxury, while thousands of wage earners, becoming more and more pauperized, sink into intellectual and moral degradation. Millions are wasted in feasting while gaunt starvation stalks the streets. Society has become a vast machine which turns out at one end milliouaries, and at the other tramps, paupers and anarch-ists. The enormous inequalities of existing conditions are creating a discontent in the minds of the laboring classes; a discontent that foreshadows an impending revolution. Profound discontent preceded the great religious upheaval in the sixteenth century. Great unrest ushered in the awful convul-sions of the French revolution. With the reappearance of the same conditions to-day, revolution is as inevitable as the laws of the universe. Human nature will not tolerate abuse forever. Labor will not always submit to the tyranny of capital. Even now the cohorts of freedom are gathering for a mighty effort. There is every indication that we are on the eve of a momen-tous struggle. The discontent of the masses is '' no longer the fretting of the waves;" it is "the roar of the rushing tide." It is to be a contest for the supremacy of wealth on the one hand or the freedom of opportunity on the other ;—a conflict that will decide whether the combined money power of the world is to per-petuate its tyranny of greed and avarice, or whether the toiling millions are at last to enjoy unmolested the products of their own labor. History teaches that there can be but one outcome to this struggle. Despotism again will fall. The indomitable forces of THE GETTYSBURG MERCURY. freedom will win another victory. Economic despotism is simply fighting the same hopeless battle that was fought and lost by spiritual and political despotism in the ages that have passed. Civilization will never rest until this great barrier is removed. There are only two ways in which this can be accomplished; by the peaceful methods of education and religion, or through the instrumentalities of war. Should the latter method prevail, and should the masses be led by designing demagogues, or by reason-ing anarchists inspired only by a sense of injustice, and revenge, the innocent will perish with the guilty in the most dreadful social catastrophe that has ever darkened the pages of history. Do the conditions indicate that such will be the result ? Are we to sup-pose that the increased intelligence and morality of the present age will permit such a solution of our great sociological problem ? Have we read history in vain or profited nothing by the great lessons of the past, that we must see re-enacted on the stage of modem history the bloody scenes of the sixteenth century? Is the nineteenth century civilization so little advanced that it is about to behold a social convulsion compared with which the aw-ful horrors of the French Revolution shall sink into insignificance ? A million Christian hearts answer, "No." A million earnest workers for the triumph of right over might, filled with the belief that the signs of the times point upward, and inspired with the hope that social and economic freedom shall come as the product of better hearts and better souls, respond with a mighty " NO." The wrongs of our present industrial system shall not be righted among scenes of violence and confusion. The ceaseless unrest of the multitudes, that are to mould the destinies of the future, is the sign of an advancing civilization. It means that they are acquiring more brain force, more manhood, the raw ma-terials out of which God will shape a better future for humanity The dawn of a better day is breaking the deep clouds of sin. The heart of the world is beating more truly than ever before. Men are beginning to realize that the prosperity of society depends upon the well-being of the whole people. They are coming to see that a divine fatherhood implies an universal brotherhood. The world is moving onward toward the realization of the ideal life of human happiness; a life where manhood shall count for more than gold, where character shall outweigh the dollar ; a life free from selfishness and tyranny, abounding injustice, liberty and equality. i44 THE GETTYSBURG MERCURY. In this life shall the Conflict of the Ages cease and man find his highest place as he ministers to the good of all. "Then the common sense of most Shall hold a fretful realm in awe, And the kindly earth shall slumber, Lapt in universal law. And the war drum throb no longer, And the battle flags be furled In the parliament of man, The Federation of the world." —W. R. E., '99. THE PHILOMATHAEAN SOCIETY. BY PROF. L. H. CROIX. [From the Pennsylvania College Book, 1832.] MORE than a year before the charter of Pennsylvania Col-lege was granted by the legislature of the State, the Philomathaean Society had its organization, in the "Gettysburg Gymnasium," on the corner of Washington and High streets, Gettysburg, Pa. The students of the institution assembled in the west room of the second story, on the 4th of February, A. D., 1831, to form literary societies whose generous rivalry would stimulate the members to mutual, intellectual and moral improvement. It was agreed to divide the whole number of students into two equal parts, in the order in which their names stood enrolled, each division then withdrew to the "East Room," second story, becoming the founders of the Philomathaean So-ciety, with Prof. M. Jacobs as chairman. With the permission of the Professor of Theology, the meeting continued to be held in the rooms devoted to theological instruction, the corner-stone of the Theological Seminary not being laid until the following- May. A Constitution and a name were adopted, but the latter was not at first settled in its orthography, for the different secretaries give "Philomathian," "Philomathean," "Philomatheon" as the name before the present Philomathaean became confirmed. The signification of the names, "lovers of learning," implies the object of the organization, "to create and cherish a taste for learning, and to promote sentiments of mutual regard and friend- THE GETTYSBURG MERCURY. 145 ship;" or, as afterwards modified, "to cultivate and diffuse among its members liberal principles, and to promote the great objects of social, moral, and intellectual improvements." The constitution provides for the election of all officers, for the admission and the dismissal of members, for fines and penalties, for meetings and work, for the formation and use of a library; and it emphasizes the requirement of each member to hold inviolate his duty to preserve a proper secrecy of the affairs of the society. One of the first peculiarities was the appointment of a "Room-keeper," taken in alphabetical order, to make all the arrangements necessary for holding the next meeting. He seems to have been keeper of the door, introducing any new or honorary member, but, in connection with his more dignified work, he was also "hewer of wood and drawer of water,'' polisher of lamps and factotum in general. This office was abandoned in the new college building, when a janitor become necessary on account of the increased work in hall, library and reading-rooms, and when the funds of the society allowed a consideration for services required. The meetings were first held on Friday evening, and as lamps were a necessity, with the order for their purchase was joined that of a "jug," or "bottle" for the use of the society. Now this bot-tle is evidently not the decanter held in bad repute, nor is the jug the famous "little brown jug," celebrated by the students in their later years in their rollicking glee; for the society was strongly in favor of total abstinence, as the votes on all temperance debates proved. As an illustration of the small beginnings of a society, there is an account of the purchase of a "suitable desk, or covert, for the use of the Secretary, library, lamps, etc." Some later Secretary has changed the v of covert to b, making it "cobert," having doubtless in mind the old family cupboard at home. From the day when a single desk or closet would accommodate not only the library, but the articles of the Secretary and the Janitor be-sides, to the present, when even the present library room has be-come too cramped to display all the volumes to advantage, an earnest of what may be expected in another half century is exhib-ited. Another illustration of small beginnings was the original initiation fee of fifty cents, which rose to two dollars and a half when the college obtained its charter, and not long afterwards to five dollars, at which figure it has since remained. 146 THE GETTYSBURG MERCURY. The first original declamation, by one of the still surviving founders (1882), by permission of the society, was in the German language. From the first the debate took high rank, and seemed to claim the highest interest of the members. The subjects chosen often bore directly upon their personal relations, and the first was upon their call or right to existence as a society. Then the ques-tion of social visiting, the granting of diplomas for partial or special courses of study, and other like topics, were discussed, as well as the questions of public interest in their day. The first anniversary celebration was held February 17, 1832, and the speeches were made by two of the founders. At first these exercises were held in the Gymnasium building, and invita-tions were sent to such persons as were supposed to appreciate literary entertainment. It may seem somewhat primitive at the present day to learn that '' a few verses '' were sung between the speeches, instead of the classical instrumental music furnished at later entertainments. Another novelty was the '' privilege given to those present of making any remarks to the society that might be thought proper. Afterward the exercises were held in the German church, until 1835, when they were transferred to the Presbyterian church, in consequence of obligations being made to the introduction of in-strumental music into the church. After 1836 the public exer-cises were held in Christ (college) church, then completed. In connection with the spring examinations, by request of the Professors, each society appointed an essayist, an orator, and a debater as performers at the closing exercises of the session. The exercises were to be original, and each society was to "chal-lenge" the other alternately to select the subject of debate. Thus originated the annual "contests," which grew in interest from year to year until 1849, when a dispute with the church officers brought all public exercises ofthe societies to a close forseveral years. The customary fees for the sexton and other incidents were asked for in advance, by a regulation of the church officers, in conse-quence of the difficulty of collecting them after the interest of the occasion had passed and the officers of the societies had been changed. This action being misapprehended as a charge for the use of the church, which was free to exercise under the direction of the faculty, or as a reflection upon the integrity of the socie-ties was resisted. Not satisfied with the explanation that the THE GETTYSBURG MERCURY. 147 sum assessed merely covered the expenses incident to the opening of the church, the societies memorialized the Board of Trustees on the question, who replied that the demand was not unreason-able; and thus ended the dispute and the contests at the same time. At the time of the earlier anniversaries, an honorary member was elected to deliver an address. From 1836 to 1853 an address was delivered each year before the societies jointly. From this time there have been annual and biennial addresses, the societies usually alternating in the choice. As a matter of history, between 1852 and 1855, with an organ-ization or union of the different literary societies of various col-leges, bearing the prae-nomen of Philo, and known as the "Philo Union," must not be omitted. It originated at Shelby College, Kentucky, and enrolled Philo Societies of more than a score of colleges, extending from New England to the West. Member-ship in any one of these societies secured admission to all the others, and a general plan of simultaneous anniversaries was pro-posed. The fraternal relations of the brotherhood were to be cul-tivated and the general interest to be promoted by a periodical es-tablished at some central institution; but the difficulties of practi-cal co-operation and the excessive labor of correspondence made the union of short duration, and a second generation of students scarcely learned of its existence. MONOTONY OF LIFE. THAT one could complain of the monotony of life, living in an age and in a nation like ours, certainly seems strange to a wide-awake person with an active mind. One certainly cannot get such an idea from nature in her ever changing forms, if one observes her. She assumes in turn every color known to us, the tender green of spring, the bounteous variety of blossoms and flowers, the splendor of the autumn foliage, the white mantles of snow and the brilliant sunsets. Instead of monotony to the observer it seems all unrest and change with hardly any continua-tion in the same line or place. There is variety in the life all around us, from the tiniest insect up to man ; there is continual change in the life of even the humblest individual. Great changes mmim 148 THE GETTYSBURG MERCURY. occur in all nations. Thought on different subjects changes, pub-lic opinion changes and is a mighty power worthy of a care-ful consideration. In fact everything changes with the pro-gress of civilization. Truly it is only the inactive mind and un-observant eye and the sluggish spirit that can for a moment imag-ine life to be monotonous. If we look closely we will notice certain principles running through life's changes. We see a union between the old and the new. It is the same old earth, it matters not under how many changes. The same trees are white with blossoms in the spring, green with foliage in the summer and brown and bare in the autumn. So with ourselves, a change of occupation or of resi-dence, a change in our financial circumstances, a marriage, a death, a journey, each brings a new experience for our old selves and forms a fresh union between our past and our present condi-tion. These things may bring happiness or sorrow for the time being, but they all have the power of enriching, enlarging and improving our characters and lives by making good additions to our stock of old experiences. Of course if we do not want it so, we can make it otherwise to a certain extent. We can be dull and inactive and cling to the old, see nothing in all the changing world about us, make no new friends, cling to old ideas, discuss no new methods, hold the same opinions and pride ourselves upon what we might call con-sistency, but which is really only thestubbornness of a mind which thinks that the world is becoming worse with new ideas, new methods and new experiences. We can plainly see that to lead a life like that is to cross our Maker's purpose, for his purpose was without doubt that we should grow into the full richness and value of manhood by cherishing our past experiences and learning well the lessons taught by them while we step forward into new and untried paths with vigor and hope. —R. Z. I., '00. 'Twas an evening of beauty ; the air was perfume, The earth was all greenness, the trees were all bloom And softly the delicate viol was heard, Like the murmur of love or the notes of a bird. —Whittier. THE GETTYSBURG MERCURY. 149 ATHLETICS. BASEBALL, this year is not as successful in some senses as usual, but in others we can pride ourselves upon our team. In the beginning of the season they encountered six hard games in succession, five being away from home, and were greatly hindered by lack of sufficient practice. But in the later games they seem to have rounded well into form, and are playing pretty good ball. The greatest surprise of the year has been Roehner's pitching, he having developed wonderfully, and doing work which, with better support, would have won a number of the games which were lost. The season was opened 011 April 15th, with Franklin and Mar-shall on their grounds at Lancaster, and was won by Gettysburg by a score of 6 to 4. The game was very pretty, both sides play-ing good ball, except in one inning, when the F. and M. boys did their only scoring. The feature of the game was Lantz's home run over left field fence with two men on bases. The trip to the central part of the state was opened at Susque-hanna April 20th, when we were beaten 12 to 6, by a comedy of errors in the first three innings which netted the home team eight runs. After that the boys settled down and played well, but Sus-quehanna's lead was too great. On April 21st we beat Bucknell by a score of 12 to 7, through hard batting coupled with the best fielding of the season. The game throughout was highly interesting and exciting, being marked by a number of pretty plays. Roehner pitched a fine game, allowing Bucknell but six hits, to Gettysburg's eleven. State defeated us April 22d, by the score of 7 to 6 in a game that was very close and exciting, though marked by bad errors on both sides. Ketterman pitched a good game, receiving poor sup-port, while Farr was knocked out of the box, and Morgan sub-stituted. At Bloomsburg, March 24th, we were defeated by the Normal School by the score of 14 to 4. The Normal boys have a good team, but it is only right to say that they would not have beaten us so badly if it had not been for the umpire. The first home game was with Dickinson on April 27th, when we were beaten by a score of 15 to 6. The game was poorly played on both sides, but tight until the sixth inning, when it THE GETTYSBURG MERCURY. was tied, after which our boys went to pieces, and Dickinson brought in nine more runs. We were beaten for the second time by Susquehanna Univer-sity on Nixon Field, May 5th, the score being 6 to 5. Our team did far better work in every way than the visitors, but their only two errors were costly, bringing in four runs, aud^poor judgment in base-running at a couple critical points lost a game by what can be termed nothing but hard luck. Games scheduled with the Indians and Dickinson at Carlisle were unavoidably canceled and prevented by rain respectively, and the next game was on Nixon Field with Franklin and Mar-shall, who were beaten in a very pretty game by the same score as in first game, 6-4. They were shut out until the eighth, and secured but four hits in all off Roehner. The Preps have manifested a good college spirit this year by getting up a team that is doing good work in its class. They were beaten by Dickinson Prep at Carlisle, 13-4, and returned the compliment on Nixon Field by the score of 13-9. They also played against '01's team, by whom they were beaten in a one-sided game by a score of 15-0. At the relay carnival at the University of Pennsylvania, April 29th, we were classed with Dickinson, Bucknell, Franklin and Marshall, and Ursinus, and came in fourth in one of the speediest races of the day. Dickinson won, having a clear lead, and Buck-nell, F. & M., and Gettysburg came in in the order named, bunched very close together, with Ursinus trailing some distance in the rear. Probably the most interesting and significant event in athletics of recent years was the dual meet with Dickinson held on Nixon Field, May 17. We were defeated, the score of points being 60 to 28, but can feel that the meet was a success as far as we are concerned, for it has given track athletics the impetus which it has needed so long. Dickinson won all the first places except the high hurdle, captured by Koller, '00, and the high jump a tie between Albers, '99, and Brown, of Dickinson. Our men showed however, that they could have done far better work with proper training, and we believe that they have caught the spirit now, and we can turn out a winning team next year. —W. THE GETTYSBURG MERCURY. Flowery June, When brooks send up a cheerful tune, And groves a joyful sound. JX 151 —Bryant. And what is so rare as a day in June ? Then, if ever, come perfect days; Then heaven tries the earth if it be in time, And over it softly her warm ear lays. -Lowell. And so beside the silent sea I wait the muffled oar; No harm from Him can come to me On ocean or on shore. I know not where His islands lift Their fronded palms in air ; I only know I cannot drift Beyond His love and care. — Whittier. The last bird I ever fired at was an eaglet on the shore of the Gulf of Ir\DT Successor to W. J7. VAJLAJKl, Simon J. Codori Dealer in Beef, Pork, Lamb, Veal, Sausage. Special rates to Clubs. York St., GETTYSBURG. Davib Croxel, Dealer trt ^ine groceries anb ttottons «-x4}ork Street. .GO TO. CHAS. E. BARBEHENN, Barber, In the Eagle Hotel, Cor. Main and Washington Sts. YOHN BROS. Agents for the Keystone State, Waldo, Washburn, Groupner & Meyer. Highest Grade Mandolins, Guitars, Banjos, Mandollas and Mandocellos. Headquarters for Phonographs, G-raphophones and supplies. Trimmings of every description. All sheet music one-half off. Large discounts on Books and studies. 326 Market St., Harrisburg, Pa. FAVOR THOSE WHO FAVOR US. Baseball v>tipptie& .Spaloing's league JSall, /Iftits, jflftaelie, Etc. Managers should send for samples and special rates. Every requisite for aennf0, ©olf, Grtcftet, Gracft ano fftelo, ©Ktnnastum Equipments anD ©utfite Complete Catalogue Spring and Summer Sports Free. The Name the Guar-antee." a. ©. SpalOing SL JBros. New York .". Philadelphia Chicago ROWE, .Your Grocer. Carries Full Line of Groceries, Canned Goods, Etc, Best Coal Oil and Brooms at most Reasonable Prices. OPPOSITE COLLEGE CAMPUS. S. /. CODORI, Jr. t* Druggists Dealer in Drugs, Medicines, Toilet Articles, J> Stationery, Blank Books, Amateur Pho-tographic Supplies, Etc., Etc. .Baltimore Street. R. H. Culp, PAPER HANGER, Second Square, York St. COLLEGE EMBLEMS. EMIL ZOTHE, ENGRAVER, DESIGNER AND MANUFACTURING JEWELER. 19 S. NINTH ST. PHILADELPHIA. PA. SPECIALTIES: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through C. H. Tilp. Gotrell & Leonard, 472-474 Broadway, Albany, N. Y. makers of CAPS, GOWNS and. HOODS To the leading- American Colleges. Illus-trated Manual, etc., upon application. Meneely Bell Co. TROY, N. Y. MANUFACTURERS OF SUPERIOR BELLS The 2000 pound bell now ringing in the tower of Pennsylvania Col-lege was manufactured at this foundry. r . nmmwmmiiMMMmwimmmmmm PATRONIZE OUR ADVERTISERS. You can't expect to create the im-pression that you are well dressed unless your clothes are MADE FOR YOU. Equivocate as you may, the fact remains that ready-made garments lack that air of exclusiveness which custom work possesses. J. D. LIPPY, Merchant Tailor 39 Chambersburg St., Gettysburg, Pa. G. E. SPANGLER, ^ Dealer in Pianos, Organs, Music, Musical Instruments, Strings, Etc. YORK STREET, 1ST SQUARE. GETTYSBURG. L. D. Miller, Grocer, Confectioner and Fruiterer. Ice Cream and Oysters in Season . . . \0) lUaxn St., ©ettusburg. City Hotel, Main St. Gettysburg. Free 'Bus to and from all Trains Thirty seconds' walk from either depot Dinner with drive over field with four or more, $1.35 Rates $1.50 to $2.00 per day. John E. Hughes, Prop. WlLLlHSURE^OUR^ lfiiilnl'iil¥rii;TJH w&receipt ot SI0-0 A6AINST ILLNESS., PHYSICIANS'* PLUMBERS- ' BILLS.DUETO IMPURE AIR, ^ FROM CLOGGEDjJ^'HS flew York, Bosfo/i. P/>//dde//i/>/fr<}/7c/sco. lo/?

Issue 61.1 of the Review for Religious, 2002. ; ,2002 VOLUME 61 NUMBER'1 Review for Religious helps people respond and be faitlsful to God's universal call to tsoliness by making available to them the spiritual legades tbat flow from the cbarisms of Catholic consecrated life. Review for Religious (ISSN 0034-639X) is published bimonthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-977-7363 ° Fax: 314-977-7362 E-Mail: review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP Mount St. Mary's Seminary; Emmitsburg, Maryland 21727 POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2002 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be consi~tered on written application to the Editor, Review for Religious. .for religious LIVING OUR CATHOLIC LEGACIES Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisot7 Board David L. Fleming SJ Clare Boehmer ASC Philip C. Fischer SJ Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm Judy Sharp Jame~ and Joan Felling Adrian Gaudin SC Sr. Raymohd Marie Gerard FSP Eugene Hen,sell OSB Ernest E. Larkin OCarm Bishop Carlos A. Sevilla sJ Miriam D. Ukeriti~ CSJ JANUARY FEBRUARY 2002 VOLUME 61 NUMBER 1 contents 6 religious culture Teresa: Story Theologian and Transforzner of Culture Mary Frohlich HM provides a different lens for reading The Book of Her Foundations by Teresa of Avila in order to find some of Teresa's most profound teaching about the potential fruits of the contemplative life. 23 Instilling Christian/Religious Culture: Instinct and Connaturality Nihal Abeyasingha CSSR envisages a rationally planned and directed program for the transmission of the "subculture" of religious life and the "culture" of the Christian life to new entrants. 39 Conversion: A Summons from the Word of God 51 Kathleen McMpin RSM explores how the word of God comes to us through daily life experiences, calling us to an ongoing conversion that leads to mercy as justice. Seminary Formation and Lonergan's Conversion Theory Steve Wlusek uses Bernard Lonergan's theory of conversions to illuminate personal development in seminary formation. Review for Religious 57 moral insight The Workers in the Vineyard: Insights for the Moral Life Patricia Ann Lamoureux and Paul Zilonka CP reflect on one Gospel parable as an example of how to develop moral theology in accordance with biblical vision. 70 Creative Response to Racism Mary Alice Chineworth OSP shares her experiences of racism within the religious-life context. adaptive prayer 75 Lectio Divina: A Means to Wholeness Mary Ren~e Nienaber SND reviews the six parts that make up the practice of lectio divina, which fosters a spiritual-life wholeness. 84 St. Albert's Method: 19th-Annotation Retreats at Parishes and Schools Hank Hilton SJ shares an adaptation of the retreat method according to the Spiritual Exercises of St. Ignatius for larger group settings in a parish or school situation. departments 4 Prisms 97 Canonical Counsel: Transfer 104 Book Reviews January-February 2002 prisms ¯ I .l.s we enter into the second year of this new millennium, the world presents us with a different face. The September 11, 2001, events that took place in the United States brought about a coop-erative stance of many of the world's nations against a terrorism grown to huge and horrendous proportions. Many agree in perceiving that terrorism breeds in behav-iors that denigrate others, in poverty that dehumanizes, and in politics that canonizes a status quo. Throughout history, there have been wars of religion, but today peo-ple question whether any war can be valued as religious or justified as just. No one could have suspected that the call which Pope John Paul II made only a year ago in his apostolic letter "At the Beginning of the New Millennium" would ring out with even greater challenge. The pope signaled our approach to this new age in the gospel words of Jesus "duc in altum," "put out into the deep" (Lk 5:4). He saw the new millennium as a vast ocean onto which the world's peoples were setting sail. We needed to hear God's call to set forth--fearlessly--because we often prefer to live with what is known, the past and the pre-sent. It is truly difficult, and sometimes fearful, to move into a future unknown and uncontrollable. Beyond our imagining, this is where we find ourselves as we begin the new year. John Paul II talked about a new face of Christ with which we refamiliarized ourselves as we entered into this Review for Religqous new millennium--a face that we had been contemplating in three preparatory years. When the pope had us focus on the face of Jesus in sorrow, we little realized that we would see that face in image after image during the final months of this past year. Where the pope turned our attention also to the face of Jesus who is risen, we found many weary faces of hope and help that became a part of our international drama. Beyond all our imaginings, we have been given a Pauline conversion moment in seeing Christ. This face arouses no fear, but rather leads us only to new ways of living, loving, and working. The pope challenged all Christians to be, and so to act as, "agents of communion." Being agents of communion is a necessary identity of being Christian in this age calling for a new evange-lizatiofi. The continuing public cooperation of many leaders of the various world religious traditions, especially Christian, Jewish, and Muslim, concretizes for us what an agent of communion attempts. Never have Jesus' directions about praying for our ene-mies and for those who do us wrong been writ so large and clear on the screen of our consciousness. Religious services, both in the public forum and in the neighborhood .church, have incarnated Jesus' injunction and continue to feed personal ways of praying. Humanitarian efforts to help the Afghan people in the midst of a wartime effort against their nation's ruling power are also an action of agents of communion. If images played out so vividly on the world stage call forth such prayer and action, we cannot fail to examine ourselves anew in our own little world of prayer and relationships. How does our prayer need to be enlarged beyond our narrow focusing on self, those dear to us, and our local concerns for well-being? What are the deeds we do that bring about a greater sense of community, of people working together, of a reaching out to the forgotten and neglected? Yes, the face of our world has changed, we say. But does this new face not give us the opportunity to see the face of Christ more clearly and to act, like Christ, as agents of communion? The Greek word kairos signified not ordinary measurement of time (chronos) but rather the special time of encounter with God. This kairos moment challenges us to set out fearlessly into the deep, "duc in altunl. " David L. Fleming SJ January-February 2002 MARY FROHLICH Teresa: Story Theologian and Transformer of Culture Even among fans of Teresa of Avila, comparatively few have read The Book of Her Foundations. Why has Foundations been comparatively neglected in relation to Teresa's other works? Probably because it has a rather different character. Although Teresa can never be accused of being a "systematic thinker," her other three books (the Book of Her Life, the Way of Perfection, and the Interior Castle) offer more or less organic overviews of contemplative life and development. If one looks for the same in the Foundations, one is likely at first to be disappointed. Here, however, I will pro-pose that, by reading with a different lens, we may find in this book some of Teresa's most profound teaching about the potential fruits of the contempla-tive life. ¯ Through the lens I experiment with here, Teresa can be seen as what Terrence Tilley calls a "story the-ologian." In 1972, when Teresa was named one of the first two female doctors of the church, the question arose how someone who was clearly not a systematic theologian, but rather an image-smith and a story- Mary Frohlich HM is associate professor of spirituality at Chicago Theological Union; 5401 South Cornell Avenue; Chicago, Illinois 60615. Review for Religi'ous teller, could attain this title. Since that time, awareness has grown that, in fact, stories and images are at the grass roots of all the theology that has ever been created and communicated. The example par excellence of "story theology" is the Bible. In his book Story Theology, Tilley proposes that theology in this genre has three major tasks: (1) to tell new and flesh stories which show a new era what the key Christian words mean, (2) to transform creatively the narratives handed down by tradi-tion, and (3) to proclaim and manifest the Good News in a way that speaks to and transforms the heart of a culture) In this article I explore Teresa's Foundations as an example of story the-ology that has a remarkable capacity to transform the heart of her culture and, as a classic, all cultures. The Text and Its Context The thirty-one chapters of the Foundations recount, in vary-ing degrees of detail, the circumstances and efforts pertaining to the founding of seventeen Discalced Carmelite monasteries. The text consists mainly of stories--some humorous, some poignant, some edifying, some pretty incredible--interspersed with shorter or longer asides of sage advice for her nuns and especially for her prioresses. Other features include several hagiographical accounts of the remarkable lives and deeds of individual nuns, friars, and benefactors and, of course, a good deal of autobiographical information about Teresa's attractions, friendships, physical sufferings, and moods. In short, the Foundations is decidedly not an organic presentation of spiritual principles, but rather more of a "down and dirty" chronicle of what happens when one tries to do God's work in this raucous and resistant "real world" in which we live. And that, I think, is why at this time in my life I am so strongly drawn to the Foundations. It is certainly not because I am any less interested in the interior life, but because I am now even more interested in what difference it makes. By that I do not mean taking a utilitarian approach to prayer, as if it has no value unless one can immediately see its fruits. I mean something more like what Teresa says at the end of the Interior Castle (VII.4.6): "This is the reason for prayer, my daughters, the pur-pose of this spiritual marriage: the birth always of good works, January-February 2002 Frohlich ¯ Teresa: Story Theologian The Foundations is the "first fruit" (literarily speaking) of Teresa's spiritual marriage. good works." In the Foundations we see what that statement meant, concretely, in Teresa's own life. Like the apostles in Acts, Teresa in the Foundations is a woman of mission, sent forth into the hurly-burly of the real world to Fooperate with the Holy Spirit in the construction of multiple "dwelling places of God," places that are not only interior but also physical and social and political, places in which deep interiority can find a home and can continue to be propagated far and wide. In view of this, it is helpful to note where the writing of the Foundations occurred in Teresa's life. Teresa was forty-seven years old when, in 1562, she made her first Discalced founda-tion at St. Joseph's in Avila. Over the next four years, she wrote her Life and the Way of Perfection and ¯ then began the whirlwind of founding activity that would continue until the end of her life. Nine new Discalced monasteries had already been established by the time Teresa received the grace of spiritual marriage on 18 November 1572 at age fifty-seven. It was about nine months after this breakthrough spiritual event that she began to write The Book of Her Foundations. Work on this text con-tinued intermittently until November 1576, by which time she had completed twenty-seven chapters and made four more foundations. Between June 1577 and November, right in the midst of one of the most intense periods of squabbling and harassment related to her reforming activity, she wrote the entire text of the Interior Castle. Finally, between 1580 and 1582, she made four more foundations and added their stories to the text of the Foundations. Chapter 31 and the epilogue were completed only a few months before her death on 4 October 1582 at age sixty-seven. Two things are interesting to note here. One is that this book, the Foundations, is the "first fruit" (literarily speaking) of Teresa's spiritual marriage. The other is that the first and last parts of the Foundations form a kind of sandwich around the Interior Castle. These two books are closely related to each other. Together--not separately--they are the fully developed fruit of -o°-j Teresa's human and spiritual maturity. And so, before delving Review for Religqous more deeply into the Foundations, let us review what Teresa says about the spiritual marriage in the Interior Castle. Spiritual Marriage: At One with God, Sell and World In the Seventh Dwelling Places of the Interior Castle, Teresa teaches that the soul that receives the culminating grace of the spiritual marriage is brought fully into its own center, where God alone dwells. Like a river that has flowed into the ocean, the soul now is completely and unchangeably at one with God. This differs from earlier stages of union and rapture in that here the faculties are not lost. That is, one retains the ability to understand what is happening and to carry on external activities even while in this form of union. This latter is especially impor-tant: Teresa repeatedly emphasizes that the purpose of the spir-itual marriage is not rest and delight, but to be joined to the sufferings of Christ and to spend oneself on behalf of souls. She describes the typical condition of such a person as consisting of deep interior peace while enduring extremes of exterior per-secution, struggle, and hard work for the sake of the gospel. When we put the stories told in the Foundations next to this, Teresa's astute but rather decontextualized description of spir-itual marriage takes on life. The stories reveal to us how Teresa's transformed interior self was united not only with God, but also in a transformative way with the physical, social, cultural, and ecclesial world in which she lived. In other words, the stories both depict and enact the way persons in spiritual marriage gain the capacity to transform their cultural world at its heart. Most obviously, the stories about Teresa herself depict a union of the divine and human, played out in this feisty, witty, and indomitable woman's adventures in living her gospel mission amidst the gritty reality of business affairs, human squabbles, stress, and struggle that looks a lot like what we all deal with in our day-to-day lives. But it is in Teresa's minibiographies of holy Christians--most of them women--that she expresses most fascinatingly for the heart of her culture the explosive truth of the gospel. It is by a deep reading of these stories that we may begin to get a glimpse of what it means to call Teresa a "story theologian and transformer of culture." January-February 2002 Froblicls ¯ Teresa: Story Theologian A "Little Story": The Testimony of a Female Infant Let us listen, then, to Teresa's stoW about Dofia Teresa de Layz, founding benefactress of the monastery at Mba de Tormes. As the fifth daughter of parents who desperately wanted a son, she was such a disappointment to them that--although they took care to have her baptized at once--they left her alone all day "as if she mattered little to them." The stoW continues: When at nightfall a woman came who was taking care of the baby and found out what was going on, she has-tened to see if the child was dead . Weeping, the woman took the baby into her arms and, complaining of the cruelty, said: "How is it, my daughter, are you not a Christian?" The baby girl lifted her head and answered, "Yes, I am," and spoke no more until reach-ing that age at which all children begin to speak. (20.4)2 At first glance we may find this story a bit. incredible. It is what Alex Garcfa-Rivera, in his recent book about the mulatto saint Martin de Porres, calls a "little story.''3 While "big stories" aim to speak universal truth and are acclaimed by those belonging to dominant cultures, "little stories" like this give the appearance of just being naive or superstitious tales aimed at the poor and uneducated. For example, many "little stories" about St. Martin de Porres tell of the saint healing animals and speaking with them as if they were human persons. Garcfa-Rivera shows how, despite their lowly appearance, "little stories" like those may actually convey potent gospel messages of the reversal of values. In a culture where those (such as Martin) with Indian or African blood were regarded as "like animals," the stories of him treat-ing animals "like humans" imaged a shocking upending of all-too- common assumptions. Garcfa-Rivera shows how in such popular "little stories" marginalized people not only express their conflicted position within cultural and religious systems of power, but also challenge and reinterpret those systems within a faith context. Tellers of "little stories" are ci'eatively working out painful personal struggles for meaning and identity and at the same time are offering their culture something new and potentially transformative.4 In view of this, there may be a lot more being conveyed by Teresa's "little stow" of the abandoned infant who speaks up Review for Religious for herself than we would see with only a superficial reading. Teresa is graphically expressing what was probably the most painful fact affecting her own struggle for meaning and identity, namely, the extreme devaluing of the female sex within the Spanish culture of that time. This poignant story of child aban-donment impresses readers with the death-dealing consequences of that devaluation more than any bare assertion ever could. There is more, however, in this story. The newborn female child miraculously speaks, testifying that she is a Christian. Teresa expresses deep irony here, for within the cultural mentality of the time it was as incredible for any female to speak in the name of the gospel as it would be if a newborn infant spoke intelligibly. Thus, through her "little story," Teresa artfully but quite potently affirms women's God-given vocation to proclaim the gospel. In fact, she is claiming that females and others who are cultur-ally regarded as valueless may be even more gifted by God than those who have been accorded an approved voice.5 Tellers of "'little stories" are offering their culture something new and potentially transformative. The Challenges of Teresa's World The stow, then, indirectly but powerfully presents a gospel perspective on the sociocultural and historical situation in which Teresa found herself.6 Let us review the characteristics of that situation and the very serious risks it posed for Teresa and her mission. Throughout the 16th century the Spanish Roman Catholic hierarchy was becoming increasingly rigid and con-trolling towards a series of perceived thi'eats to its authority. The first perceived threat was that of "judaizing" tendencies among those whose ancestors had been forced to convert from Judaism to Catholicism in 1492. Teresa came from such a con-verso family, a fact she always had to conceal, but which was probably known or suspected by many of her contemporaries. In this milieu those with Jewish blood were always considered sus-pect, regardless of their personal belief and behavior. Teresa, January-February 2002 Frohlich ¯ Teresa: Story Theologian The pain that led to Teresa's transformative storytelling was the spiritual anguish of one with a soul-hunger for God. therefore, was deeply sensitive to all forms of marginalization. The story of the child unwanted by people but gifted by God is about women, but it is. also a basic gospel message applicable to all who are devalued in human eyes. The second perceived threat of that era was the so-called "Lutherans," a category that expanded to include anyone who appeared to express any lack of respect for the pope, the priesthood, or the sacraments. It is noteworthy that, in the story of the infant Teresa de Layz, Teresa makes a point of saying that she was baptized, thereby depicting the child's amazing testi-mony not as a random outbreak of the supernatural, but asthe miraculous fruit of sacramental initiation. This is an important nuance, and typical of Teresa's careful balance in relation to the concerns of her environment. The third perceived threat of the time was a growing wave of illuminists or alumbrados, who claimed special spiritual author-ity on the basis of their mystical experiences and visions. Many of the alumbrados who were prosecuted by the inquisition were women; in the mentality in Spain at the time, women's assumed inferior intelligence made them particularly susceptible to being seduced by the devil. This pr6blem was exacerbated by the Index of 1559, which made most Spanish-language books on prayer and spirituality unavailable and thus prevented women--very few of whom were trained in Latin--from having access to the technical vocabulary and the theology of the spiritual life. Thus, throughout her life but espe.cially during the peak period of her activities of founding and writing, Teresa faced a huge personal and political challenge. Her culture insisted that no mujercita or "little woman"--particularly one of converso back-ground-- should be teaching others about the spiritual life, let alone doing so on the authority of her own spiritual experiences. In view of this, the.seemingly innocent "little story" of the baby Teresa de Layz speaks volumes to those who can read between Review for Religious the lines. Far from being merely a cute and improbable anec-dote suited to the low intellectual capacities of the mujercitas, it is a subtle and explosive parable aimed directly at the very heart of the antigospel forces that impinged upon Teresa's vocation to live out the full effects of her spiritual marriage. What Fueled Teresa's Imagination? In the story of Teresa de Layz, we see Teresa doing exactly what Terrence Tilley describes as the mandate of "story theol-ogy," namely, creatively telling the gospel story for her own culture. But where did Teresa's creative genius as a "story theologian" come from? Elaine Scarry's book The Body in Pain proposes that the basic motivator of creative imagination is pain? A simple, everyday example is the pinch of hunger, which moves us to creatively find a way around any obstacle that is preventing us from getting food. Several recent feminist inter-preters have taken a similar perspective on Teresa, proposing that her creative activity as writer and foundress was primarily a way of subverting the painful limitations imposed on her by her status as a woman in a repressive patriarchal milieu.8 There is an important element of truth here, yet it only goes halfway. The pain that led to Teresa's transformative sto-rytelling was not only social and cultural; it was the spiritual anguish of one with a soul-hunger for God. Above all, Teresa felt herself called to pursue the life of mystical union in its fullness, and to cooperate with God in creating the best possible condi-tions and guidance for others to do the same.9 Yet, as we have seen, there were many serious cultural obstacles to her doing this. She contended, then, with two sources of pain: both the interior rending that resulted from her hurtling into God and the exterior conflict stirred up by her determined efforts to live out her call to be a woman of God, a preacher of the gospel, and a foundress. Let us look at another story to see bow Teresa wrestled creatively and imaginatively with these inner and outer conflicts. "Uppity Women": Catalina Godlnez and Teresa This is Teresa's account of the sudden conversion of Catalina ~1~3~ .~anuary-February 2002 Froblicb ¯ Teresa: Story Theologian Godfnez, founding benefactress and one of the first to enter the monastery at Beas: [Catalina] had been thinking of a marriage that was being sought for her, which was better than she could have hoped for, and saying to herself: "With what lit-tle my father is content, that I.become connected with an entailed estate; I am thinking of becoming the ori-gin of a new line of descendants." She was not inclined toward marriage, for she considered it demeaning to be subject to someone; nor did she know where this pride came from . The moment she read the inscription [on a nearby crucifix], it seemed to her that, just as sunshine enters a dark room, a light came into her soul by which she understood the truth . Thus she began to despise herself, to have .great desires for penance, which after-ward she put into effect. She at once promised chastity and poverty and wanted to see herself so subject that she would have rejoiced to be carried off then to the land of the Moors and remain there. All of these virtues lasted in her, so that the experience was clearly seen to be a supernatural favor from our Lord. (22.5-6) The story continues on for many pages, recounting an uproar of demons disturbed by Catalina's conversion, then her conflicts with her parents, who refused to give her permission to become a nun, her extreme penances and illnesses, and finally her dra-matic challenge to her relatives and to God that, if she were healed by a certain day, she should be permitted to become a nun. Sure enough, on the appointed day she rose from her bed, ready to assist Teresa in founding the monastery of Beas. Some feminist interpreters have pointed out the fascinat-ing tension he?e between Teresa's delight in portraying Catalina's feisty statement of her desire to "found her own lineage" and not to be subject to anyone and her equal delight in portraying Catalina's conversion to fervent desire for suffering and sub-jection. The dramatic tension between willfulness and obedi-ence continues to play out in the story as Catalina steadfastly refuses to be subject to the wishes of her parents or relatives and then endures years of extreme physical suffering while stub-bornly holding out for fulfillment of her personal vision. It is a Review for Relig4ous great story in itself, and it is a prime illustration of a tension, at the heart of Teresa's story theology, between her culturally sub-versive claim for female authority and her acceptance of abso-lute obedience to God. In the eyes of her culture, Catalina Godfnez was, like Teresa, an "uppity woman." When Catalina dares to say in so many words that she wanted to "found her own lineage" and be sub-ject to no one, one can hardly help hearing Teresa behind her saying, "And look at me! In making these foundations I am actually doing it! I am founding my own female lineage!" Yet, in the next few lines, Teresa successfully dissociates her-self from the "pride" of such a statement as she affirms that God has supernaturally transformed Catalina so that she now desires to be subject to everyone and to be humiliated with Christ cruci-fied. It is as if Teresa is saying, "This is the way my new female lineage will be founded: not in pride, but in humble union with God." While some feminist interpreters have presumed that Teresa's frequent protestations of humility and obedience are largely a smokescreen thrown up to obscure her real goals of female power, my interpretation would be that her commitment to humility and obedience in relation to God was indeed radi-cal. For example, at the heart of all Teresa's stories about her founding activities is the conviction that God is the real founder. She repeatedly says things like "I want our Lord to make known to everyone how in these foundations we creatures have done next to nothing. The Lord directed all by means of such lowly beginnings that only His Majesty could have raised the work to what it now is" (13.7). Although her words about doing "next to nothing" are somewhat hyperbolic, her core conviction is clear: both the initiative and the ultimate success of her found-ing activity come from God. Indeed, it is exactly because she believed her commission for this work came from God that she was willing and able to take such great risks on behalf of estab- At the heart of all Teresa's stories about her founding activities is the conviction that God is the real founder. January-Februa~y 2002 Froblicb * Teresa: Story Theologian lishing the authority and lineage of women. Radical Obedience and the Lineage of Women The next story is one example of these linked commitments to radical obedience and to the spiritual lineage of holy women. In chapter 28 she recounts at great length the story of Dofia Catalina de Cardona,who left her life among the nobility for a hermitage, where she wore coarse cloth, ate only every third day, took the discipline with a heavy chain, and practiced many other harsh austerities and virtuous acts. Later on she suffered greatly in order to found the Discalced friars' monastery at Pastrana. One day Teresa, after Commu'nion in the church there (which was on the site of Dofia Catalina's original hei'mitage), experienced a "suspension." She states: In this suspension, through an intellectual vision, this holy woman appeared in a glorified body and some angels with her. She told me not to grow weary, but that I should strive to go ahead with these foundations. I understood, although she did not indicate this, that she was helping me before God. She also told me something else, but there is no reason to put it here in writing. I was left very much consoled and with a great desire to work hard, and I hope in the goodness of the Lord that with help as good as these prayers of hers I will be able to serve Him in some way. (28.36) In this story Teresa not only explicitly claims the patronage of a holy female spiritual ancestor in her work of founding, but also implicitly affirms what Gillian Ahlgren calls the "visionary epis-temology" that, for at least four centuries before Teresa's time, had been the primary path to spiritual empowerment for women,l° A visionary epistemology asserts that real knowledge of God and real wisdom in relation to the world are conveyed through visionary experience. Throughout the Middle Ages, when women were systematically denied access to theological education and to positions of ecclesial power, the main route by which women could gain religious status and voice was by claim-ing to have visions or locutions in which God communicated directly with them. This was always a dangerous path, subject to suspicion and curtailment from powers that felt threatened. But Review for Religious in Teresa's time it was even more dangerous because of the inten-sive inquisitorial campaign that was being waged against the alumbrados, who claimed special religious experiences. It is quite remarkable that Teresa and her claims to special knowledge through visions not only survived in this atmosphere, but actu-ally thrived. To see how she did it, let us look again at her account of her vision of Dofia Catalina de Cardona. Teresa states, first, that the vision took place immediately after Communion, thus affirming an intrinsic connection between her experience and the church's sacraments. She states, second, that it was an intellectual vision, not an imaginative or bodily one. Although all visions were suspect, those involving less of the sensual component were slightly less so. Over time Teresa became increasingly adept at making this kind of tech-nical distinction, helping to allay the fears of her learned cen-sors. Third, her main emphasis in this story is on the good effects of the vision: it encourages her to dedicate herself even more firmly to serving God and building up the church through making monastic foundations. Gillian Ahlgren notes that, while in her earlier writings Teresa lingers longer over the experien-tial aspects of her visions, in later writings she focuses much more on how to discern their authenticity; and her key test was usually to note their effects)1 Thus we see in this story, written very near the end of Teresa's life, the masterful way in which she tiptoes through the minefields of criticism that could easily have doomed her and her projects. And once again we see how she manages to accom-plish two seemingly contradictory goals at once: reaffirming her humility and obedience to the purposes of God and the church and presenting herself as a uniquely favored female apos-tle and heir to a powerful female spiritual lineage. Troubling and Transforming the Status Quo With hindsight we kntw that, despite her radical and auda-cious vision, Teresa not only succeeded in her life's mission but even became a canonized saint and a doctor of the church. Yet, as the Foundations makes abundantly clear, Teresa's founding activities faced formidable obstacles and often stirred up intense opposition. There is high drama in the stories of Teresa push- January-February 2002 Froblicb ¯ Teresa: Story Theologian ing indomitably forward while bishops and religious superiors balk, wealthy people or town councils demand conditions she cannot accept, the owners of desired houses refuse to negotiate or their tenants refuse to vacate the premises, nuns and friars lose heart or get into squabbles with one another, and even the weather, the roads, and her aging body seem increasingly to conspire against her. In all this, Teresa usually attributes any form of suffering or resistance to the devil's opposition to her "good works." But, as Alex Garcfa-Rivera notes in relation to St. Martin de Porres, stories about troublesome demons always seem to appear exactly at the place where the symbols most cherished by cult-oral and political powers are being challenged. In Teresa's case, as we have seen, both her activity of founding and her written works artfully contested some of the key assumptions of the cultural and ecclesial status quo: namely, that women cannot teach or lead, that knowledge of God must come in an institutionally approved package, and that money, pedigree, and "pure blood" are the determinants of honor. It seems that in her spiritual marriage Teresa's ability to speak troublesomely and transfor-matively to the very heart of her culture came to fullness. "Water for All Our Needs" As a way of summing up the gist of the perspective pre-sented here--and, more importantly, of Teresa's key spiritual insights--let us listen to one more "little story" from the Foundations. Teresa recounts what transpired when, in the newly founded monastery at Medina del Campo, the nuns suffered from lack of good water: When I called some workmen to dig a new [well], they laughed at me as though I were wanting to throw money away. I asked the sisters what they thought. One said that it should be tried, that since our Lord would have to provide someone to bring us water as well as food, it would be cheap.er for His Majesty to give us the well on the grounds of the house and that thus He would not fail to do so. Observing the great faith and determination with which she said it, I became certain. And, contrary to the opinion of the Review for Religious one who understood all about founts and water, I went ahead. And the Lord was pleased that we were able to put in a conduit which provided enough water for our needs, and for drinking, and which we now have. (1.4) Once again, we see the mujercitas, the foolish little women who have nothing but their faith, being justified over those who sup-posedly "understood all about founts and water." But there may be more in this "little story," particularly when we recall the importance of the imagery of water, wells, and founts in each of Teresa's major books.~3 Given my original premise that the Foundations needs to be interpreted as a sort of"first fruit" of Teresa's spiritual marriage and as having a special relation to the Interior Castle, around which it forms a sandwich, I think we need to place Teresa's "little story" of the well next to this text from the Seventh Dwelling Places: For from these divine breasts where it seems God is always sustaining the soul there flow streams of milk bringing comfort to all the people of the castle. It seems the Lord desires that in some manner these oth-ers in the castle may enjoy the great deal the soul is enjoying and that from that full-flowing river, where this tiny fount is swallowed .up, a spurt of that water will sometimes be directed toward the sustenance of those who in corporeal things must serve these two who are wed . For just.as a great gush of water could not reach us if it didn't have a source, as I have said, so it is understood clearly that there is Someone in the interior depths who shoots these arrows and gives life to this life. (VII.2.6)14 This text from the Interior Castle is clearly talking about the mystical life. Teresa mixes several biblical images with long his-tories of use by mystical writers, such as the "divine breasts," "streams of milk," and "arrows." But Teresa's central image for the welling up of God's lif( in our interior depths is, as usual, water. Here she proclaims that the water of mystical union does not simply remain in the center of the soul, but gushes abun-dantly outward to sustain, enrich, and heal the whole bodily and psychological person. Yet I believe we can take the image one step further, especially if we understand the human person as an intrinsically relational and social being. After all, it is only January-February 2002 Froblicb ¯ Teresa: Story Theologian a few pages further on that Teresa makes her well-known affir-mation that the purpose of the spiritual marriage is not simply to rest in delightful interiority, but to share those riches with others through "good works." The "little stow" of the well at Medina del Campo is a very concrete, down-to-earth vignette of how the life of mystical union which it is Teresa's mission to promote bears fruit. Here it is physical water that gushes up because of the nuns' faith, providing abundantly for their bod-ily needs. The "spiritual marriage" is complete: divine and human, mystical and physical, are at one. Yet this reading of the Foundations suggests that the outflow of the spiritual marriage goes even further. The nuns' miracu-lous well is also a public testimony to the presence and activity of God in those whom society regards as mere mujercitas, foolish little women. The water of God that gushes up in the spiritual marriage works to sustain, heal, and transform not only the indi-vidual person, but her whole social and cultural world as well. For a perspective on this that is from a completely different tradition, yet is remarkably consonant with Teresa's spiritual insight, listen to this poetic text fromthe Chinese Tao-te- Ching:ts The highest motive is to be like water. Water is essential to all living things, yet it demands no pay or recognition. Rather it flows humbly to the lowest level. Nothing is weaker than water, yet, for overcoming what is hard and strong, nothing surpasses it. It seems that in The Book of Her Foundations Teresa teaches, through her consummate "stoW theology," that the gift of union with God in the ~piritual marriage indeed makes a person like water. Such a person flows humbly to the lowest level and is rad-ically obedient to the direction of her own and others' thirst for God. In this way she unites herself intimately with the heart of her culture and can ov4rcome that in it which is hard and strong. Notes Terrence W. Tilley, StoO, Tbeolog~ (V~lmington: Michael Glazier, 1985), pp. 11-16. All quotations from the Foundations are from The Collected Works Review for Religious of St. Teresa ofAvila, Vol. 3, trans. Kieran Kavanaugh and Otilio Rodriguez (Washington, D.C.: Institute of Carmelite Studies, 1985). 3 Alex Garcfa-Rivera, St. Ma~-tin de Porres: The "Little Stories" and the Semiotics of Culture (Maryknoll: Orbis Books, 1995). 4 As several commentators have noted, Teresa's style of rhetoric is "women's language"; that is, not only is it the vernacular instead of Latin, but it is conversational, imagistic, elliptical, and aimed at the general populace rather than an elite. See, for example, Elias R. Rivers, "The Vernacular Mind of St. Teresa," Carmelite Studies 3 (1984). In recent years feminist analyses have revealed how this "women's lan-guage" is far more sophisticated than it first appears; it often functions as a sort of "Trojan horse" strategy that lets Teresa speak in places and ways that would otherwise be closed to her. See especially Alison Weber, Teresa of Avila and the Rhetoric of Femininity (Princeton: Princeton University Press, 1990), and Carole Slade, St. Teresa of Avila: Author of a Heroic Life (Berkel.ey: University of California Press, 1995). s See Antonio P~rez-Romero, Subversion and Liberation in the Writings of St. Teresa of Avila (Atlanta: Rodopi, 1996). 6 For an overview of these trends, see Te6fanes Egido, "The HistoriCal Setting of St. Teresa's Life," trans. S. Payne and M. Dodd, Carmelite Studies 1 (1980); also Gillian Ahlgren, Teresa of Avila and the Politics of Sanctity (Ithaca: Cornell University Press, 1996), especially chap. 1. 7 Elaine Scarry, The Body in Pain: The Maki~zg and Unmaking of the World (New York: Oxford University Press, 1985). 8 See Weber, Slade, Ahlgren, and P~rez-Romero. 9 Among the above commentators, Ahlgren and P~rez-Romero offer an interpretation of Teresa's motives that is similar to my own. 10 Ahlgren, chap. 7. On the tradition of women visionaries, see Elizabeth Alvilda Petroff, Medieval Women's Visionary Literature (New York: Oxford University Press, 1986). 1, See Ahlgren, especially p. 10 I, for discussion of Teresa's devel-oping theology in relation to visions. ,2 Garcfa-Rivera, p. 36. ,3 In the Life, chaps. 11-22, she wrote of the "Four Waters," and in the Way, chaps. 19-21, of the "fount of living water." In the Interior Castle the same imagery appears, most prominently in the First, Fourth and Seventh Dwelling Places. 14 The Collected Works of St. Teresa of Avila, Vol. 2 (Washington, D.C.: Institute of Carmelite Studies, 1980). ,s Having been given this quotation on a prayer card, I consulted several English versions of the Tao-te-Ching without being able to locate this specific translation. I was able to determine, however, that .~anuary-February 2002 Frohlich ¯ Teresa: Story Theologian the first half of the quotation comes from poem 8 and the second half from poem 78. The Beast of Contemplation I walked past someflattened grass behind the house this morning, where an animal had lain in the night, touching a mystery by touching the fringe of the turf where something wild had passed and paused and passed again. What did the animal lying in that place think (or not think) in the otherness of its sojourn there? I ask this, even as I know the wild creature lying behind the house to be none other than myself. This, after all, is the patch of grass where I sprawl under the stars each night, sometimes lost in contemplation, other times in sleep. Them is an animal of God that makes its lair in me, some distance, often,from my mind. It comes as stranger, glimpsed in a vestige of presence, a pressed-smooth swath ofunmowed lawn. I marvel at the wildness of this elusive beast, leaving only the bay of its body at the place where God has passed and paused and passed again. Belden C. Lane Review for Religious NIHAL ABEYASINGHA Instilling Christian/ Religious Culture: Instinct and Connaturality At on the Internet, there is a link to Chimpanzee Cultures Website. Accustomed to speaking of culture as a human creation, one wonders how it might apply to the animal world. In fact, given that there are certain characteristics common to an entire species in the ani-mal world and that there are variants identifiable within the species, there is some evidence that one animal's "discovery" can gradually spread to other animals of the same species) The key words here--common, variants, spread--contain concepts to consider in discussing culture in human societies. The pre-sent article will use those concepts in looking at the culture of religious life. Religious or consecrated life has not been of a single mold through history. Common to it always and everywhere is the following of Christ in accord with one's baptismal commitment. Variants include hermit life and common life, enclosed monas-tic life and mendicant life, institutes of apostolic life and secu-lar institutes. Religious life that sprang up in one set of circumstances has often spread to other circumstances, and today religious life cannot hold itself entirely aloof from the many rapid changes occurring differently all over the world. Nihal Abeyasingha CSSR wrote for us twice in 1999. His address is 454/9 Piachaud Gardens; Peradeniya Road; 20000 Kandy; Sri Lanka. ~-2~ --- 2- January-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture The present article makes two proposals. First, if there is transmission of a common way of life all through a group and if innovations can be spread within a given species in the animal world, one can envisage a rationally planned and directed pro-gram for transmitting to new entrants the culture of the Christian life and the subculture of religious life. Second, I pro-pose certain "settings" where new entrants might be placed, where their religious instinct and sense of connaturality could be fostered. How Transmit Culture? Culture can be considered as the behaviors, skills, and knowl-edge that you acquire from and share with others of your species, but that differ from the way of life lived by members of your species elsewhere. This culture is neither acquired genetically nor compelled by the environment, but neither can it be taught-- it has to be caught. In odaer words, there is a memory (one could call it "institutional memory") that the older generation of a species embodies and carries. In associating with that genera-tion and experiencing various of its devices, the younger gener-ation comes to share in the culture. These younger members do so not by compulsion, but because that way of doing things is "connatural" to them. They do it because they want to do it. John Henry Newman (1801-1890) suggested "that our most natural mode of reasoning is, not from propositions to propo-sitions, but from things to things, from concrete to concrete, from wholes to wholes.''2 He says that, as regards "the great fun-damental truths of religion, natural and revealed, and as regards the mass of religious men, these truths, doubdess, may be proved and defended by an array of invincible natural arguments, but such is not commonly the method in which those same logical arguments make their way into our minds. The grounds on which we hold the divine origin of the church and the previous truths which are taught us by nature--the being of a God and the immortality of the soul--are felt by most men to be recondite and impalpable, in proportion to their depth and reality.''3 Animals seem to have this concrete kind of "reasoning." Endowed with a natural sense, they learn their "culture" by liv-ing it and doing the things that accord with it. People are born Review for Religious with natural instincts and reason; they learn to be human beings within a culture somewhat as animals do. But, because of their reason and free will, they are not determined by their instincts. Yet--and here we enter the sphere of religion--the human being cannot be satisfied with the material. "Our hearts are made for you, O Lord, and they are restless until they rest in you" are the famous words of Augustine of Hippo (354-430). Religion provides for the restlessness of the heart. Some indi-viduals experience that restlessness more intensely, and often with particular nuances. This leads them to seek rest for their restlessness not only in Christian living within the broad framework of the church, but along a specific way of following Christ closely. This they find instinctively in a par-ticular religious congrega-tion. When asked why they entered this one and not that, they have their own idiosyncratic modes of saying so. But most impor-tant is that they feel at home in the institute and are happy in its life and apostolate. Today's religious come from a different social background from the religious of the first half of the 20th century. Ministering to Today's World Feeling at home and happy does not mean that they have reached the end of their journey. In fact, they have only begun. And that is why I suggest that there must be some way in which they can be helped to grow. Instinctively and by way of con-naturality, they should be assisted to grow, incorporating what is in accord with their quest and rejecting what is contrary to it. Today's religious come from a different social background from the religious of the first half of the 20th century.4 They bring with them a certain culture and the popular piety with which they have grown up in their homes. During the training period they are filled with a whole range of knowledge. But, once the period of training is over, they try to use as the basis of their ministry the popular piety they carried with them at their entrance.~ This does not work. ~tanuary-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture Change (rapid, radical, in almost every sphere) and diversity (abundant and bewildering) are unavoidable present-day reali-ties, but Christians have no cause to fear them. By baptism (see Rm 6:3-11) we are participants in the most radical of changes, the death and resurrection of Christ, phenomena that express themselves in a never-ending variety of ways. This reality, how-ever, needs to be instilled more and more into the life and min-istry of religious. In other words, in their response to problems related to all the change and diversity in the world, Christians and especially religious are continually called to return to the Christian mystery of Christ's death and resurrection. Popular piety is inadequate to face the modern world. Popular piety can be seen as "contractual": if one fulfills certain set obligations, then one will grow as a Christian and attain sal-vation. Sometimes this piety may border on the magical: if one does certain things in a certain way, then various desirable results will follow. This approach, still present in the life of many peo-ple, has helped many on the path of holiness. But is it the answer to today's problematic of change and diversity? Is going with the practices of many a help or a hindrance for religious in their life and work with and for others? Today's change and diversity have far-reaching effects. The Christian perspective on this situation might be stated briefly as follows: Human freedom is used and abused, but, no matter what, God remains faithful. The death and resurrection of Christ shows this, and Christians share in it. Their share is in what they do, not merely what they talk about. Jesus, knowing who would betray or deny him, shared a special meal with them. The church continues to remember that, on the night he was betrayed (by his disciples and by us), he took bread and said "Take and eat . " This meal shared with his betrayers--and continued by the community of believers--is the place where we learn how to handle the world in which we live. We learn, not by study, but by doing.We learn, not bj~ logical reasoning so much as by a kind of instinct and connaturality. This doing (in memory of him) is the source of knowledge, knowledge of a unique opportunity for us to turn to the pure victim of our betrayal and find both salvation for ourselves and cordial reciprocity with one another. If we learn by what we do, it follows that there can be no Review for Religious predetermined curriculum. We can only seek or provide set-tings where connaturality and the religious instinct can be evoked and then try to adopt or inculcate a "rationalized asceti-cism," that is, a commitment to continual self-control and dis-cipline over what does not serve our vocation as religious--in other words, engagement in ongoing discernment. The religious instinct and discernment need to work in har-ness. In a variety of settings, rationalized asceticism is only a means. What is primary is the goal, namely, following Christ according to the particular focus of one's institute. A kind of rationalized asceticism, however, could function, not so much by logical reasoning as by instinct and connaturality. The one who joins an institute feels "at home." In that situation, one is helped to rationally understand and discern one's way in the actual world where one lives. Gradually, feeling at home takes on a focus and content. Settings Where Connaturality Can Function By a setting I mean something on the lines of the Santiniketan, the school established in 1901 by Rabindranath Tagore (1861-1941). That school was meant to be a place where students could absorb the Indian spirit. It was out of the ordi-nary; it had eminent teachers, but few pupils. Yet those few learned something which others did not and made a contribu-tion to India as a whole. Times have changed, but the need remains for us to experience the world existentially and to work out our response in accord with the gospel and the charism of our institute. The extraordinary, if it happens, is something to be thank-ful for. Normal growth takes place in the ordinary situations of life. Growth in religious life occurs best, I think, when religious envision their own life stories (with their own memories, behav-iors, skills, and knowledge) against their faith-vision of their baptism--which made them sharers in the mystery of Jesus Christ dying and rising again. A certain interpretation and synthesis of his own life can perhaps be detected in Pope John Paul's first encyclical, Redemptor hominis (§ 14): Man in the full truth of his existence . . . --in the January-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture sphere of his own family, in the sphere of society and very diverse contexts, in the sphere of his own nation or people, and in the sphere of the whole of mankind--this man is the primary route that the church must travel in fulfilling her mission: he is the primary and j~tndamental way for the church, the way traced out by Christ himself, the way that leads invariably through the mystery of the incarnation and the redemption. In 1979 (within the first year of his pontificate), during the Mass celebrated in the Oswiecim-Brzezinka (Auschwitz- Birkenau) concentration camp, he said: Can it still be a surprise to anyone that the pope born and brought up in this land,, the pope who came to the See of St. Peter from the diocese in whose territory is situated the camp of Oswiecim, should have begun his first encyclical with the words Redemptor hominis and should have dedicated it as a whole to the cause of man, to the dignity of man, to the threats to him, and finally to his inalienable rights that can so easily be trampled on and annihi-lated by his fellow men?6 John Paul II lived and was educated in the West. Naturally his categories of thought are derived from the Western tradition. Is it not possible, though, for people of the East as well as the West, to see beneath these thoughts of his the process by which he worked through various situations and reached a synthesis that was connatural to him? That is, to see his experience of life in Poland (as worker, stage actor, writer, and so forth), the experience of the concentration camps, the search for the "causes" of the concentration camps, the articulation of the principles of his life, and finally, the synthesis of Christ, the church, and man as all interrelated.7 And this in the first year of his papacy! And now the evening of his life is filled with sym-bolic gestures flowing from that same synthesis--attempts to bring about reciprocal relations among human beings, Christ, and the church--a visit to a synagogue in Rome and to a mosque in Syria, asking pardon of God and of fellow human beings for the sins committed by the church and tendering apologies to the Greek and Ukrainian churches. Review for Religious Experience and Exemplary Religious Behavior Popular piety, as I have said, cannot respond to the present world with its change and diversity. No matter how much one repeats this to new entrants, the response is to point to how well popular piety is doing in pilgrimage centers, among a high percentage of regular churchgoers, among the Christian right, and in various emerging movements. Perhaps they are correct. The majority of Christians are rooted in popular or traditional piety. But is that the climax and high point of the following of Christ? Hardly. Without the interaction of popular piety with its roots in the Christian tradition in a context of continual conversion, does popular piety not dete-riorate into the justification and ratio-nalization of the baser instincts? Well-known preachers advocating a pop-ular and populist piety have been dis-covered to have been leading double lives. Corruption and violence are known as much among "practicing" Christians as among the general population. Religious, too, may experience a dichotomy between their piety and their work, between what they do in church and what they do outside. It can be valu-able to experience it, to have an ordinary job while at the same time trying to fulfill the obligations of a religious.8 This is a common situation for ordinary Christians-- the need to combine work with family life. In ordinary work-places, individuals claim no privileges, but simply share the lot of the others. In such circumstances, people discover the pres-sures that flow from the pace of change and the range of diver-sity that has to be confronted. Confronting the real world of jealousy, fraud, cutthroat com-petition, and intrigue provides an opportunity to reflect care-fully on one's behavioral response in the light of one's Christian commitment. In a study of the attitudes of people working in several private-sector companies in Sri Lanka, the following atti-tudes were measured (on a scale of ten): Among superiors: authoritarian 8, egalitarian 2, and permissive 5; among subor-dinates: rebel i0, cooperation 1, ingratiator 5.9 It is highly likely Popular piety, as I have said, cannot respond to the present world with its change and diversity. January-February 2002 Abeyasingba ¯ Instilling Cbristian/Religious Culture that Christians and religious in similar work situations have adopted similar behavioral patterns. How does such behavior fit in with gospel norms? Is equality not implied in baptism, the root of the religious vocation and of cooperation in the mission of a religious institute? Does the high score for authoritarian attitudes not imply that Jesus' exhortation about the greatest and the least, about the master washing the feet of his disciples, has been forgotten? The question arises: Can a process of"con-scious reflection" for religious be initiated on these lines? Conscious Reflection When young people tell Archbishop Rembert Weakland of Milwaukee that they are having a difficult time understanding what it means to be a Catholic,-he tells them to participate in the Eucharistic celebration with the same parish community every Sunday for six months and, during the same six-month period, to work in a soup kitchen. If they follow these two prac-tices, they will see for themselves what it means to be a Catholic.1° The question posed is conceptual ("understanding"); the remedy suggested is an existential commitment (the Eucharist in the same community, the same soup kitchen, for six months). It leads to a realization that Christian life is about worship and service. Commitment to the same group--but why? Because then one works one's way beyond immediate emotions (sense plea-sure), beyond the true-false dichotomy (intellectual pleasure), and beyond control-or-be-controlled situations (the pleasure of power), towards accepting realities for which no words can be found and tasks which are not directly pleasurable--but all of which, at a deep level, give satisfaction and joy. Following that advice, one avoids a "shopping" mentality; one learns through the drudgery and happiness of one's commitment. Oliver Goldsmith implies this about the parson in his "Deserted Village": "All his serious thoughts had rest in heaven. / As some tall cliff, that lifts its awful form, / Swells from the vale, and mid-way leaves the storm, / Though round its breast the rolling clouds are spread,/Eternal sunshine settles in its head" (lines 188-192). The "eternal sunshine" 6f a holiness that brings joy and fulfillment is for all. Religious are meant to pursue holiness Review for Religious with great intensity in the service of all Christians. In the Middle Ages, religious were more prominent in the guidance and accompaniment of the faithful in holiness than priests were.~L "All the faithful of Christ of whatever rank or status are called to the holiness of the Christian life and to the perfection of charity" (LG §40). "Mother Church rejoices at finding within her bosom men and women who more closely follow and more clearly demonstrate the Savior's self-giving by embracing poverty with the free choice of God's sons, and by renouncing their 6wn wills . . ." (LG §42). The point of the "specialized" pursuit of holiness is to bear witness among the followers of Christ that everything should not be cut down to the size of the self, but rather that the self needs to be expanded to recognize and embrace the glory of God man-ifested in the world, in one's fellow humans, and in Christ. Religious Cultural Literacy In the Catholic tradition, faith is a personal adherence to God that involves, inseparably, "free assent to the whole truth that God has revealed" (tides quae). It differs from faith in the Reform tradition, which emphasizes trust and commitment (tides fiducialis). Sometimes the distinction is forgotten. It is important to maintain the difference if one wants to remain rooted in the Catholic tradition. Thus a first requirement would be cultural literacy~2 within the Catholic tradition--in church doctrine, in religious life in general, and in one's own institute in particular. What is needed is a clear and accurate understanding of the truths that one's community shares and the standard of behavior that community members together endorse, as approved by the church. This is not expert knowledge, but simply accurate knowledge. Accuracy is, I think, not too much to ask in an age of computers, where email addresses and Web sit~s have to be keyed in without an error of even a single letter. Beyond an accurate minimum, one can and should, of course, increase one's knowledge, while not necessarily claiming that one always practices the behavior that one endorses. This knowledge and these standards of behavior must, however, be understood as constituting the bottom line without which the present collectivity will not survive as a group. January-February 2002 Abeyasingha ¯ Instilling Christian/Religious Culture This minimum has to be learned by rote. "Learning by heart" is one of the most popular techniques of education in Asia. It has to be tested not just once but periodically. This knowledge and these behavioral standards should be the content of discussions, decisions, and vision statements. Otherwise, indi-viduals might interpret the words to mean exactly what serves their own personal interest within the existing network of roles and relationships. Before entering the novitiate, candidates should be able to move easily and accurately within the idiom and grammar specific to the Catholic tradition. Afterwards, in the novitiate, they can learn the idiom, grammar, and standard of behavior specific to the institute. The Eucharist as Cultural Activity The great formative influence in Christian living and a for-tiori in religious life is the Eucharist and the other sacraments. There is a constant danger in Asia that these sacramental rites may be reduced to the level of popular religion and sometimes even of magic. Two aspects of the Eucharistic celebration are relevant here. First, people should have a basic knowledge of the elements that come together in the liturgy.~3 Second, but far more important, is the actual celebration of the Eucharist. Every Eucharistic celebration includes the great metaphors and images of Christianity. Every celebration has at least seven points of reference--assembly and gathering, table of the word, memo-rial, sacrifice, food for the journey, eschatological reality, and cosmic transformation.~4 Every celebration cannot highlight all these, but the meaning of the celebration is in the reality that is done by the group of believers. The liturgy is not an act of per-sonal piety or a situation for personal devotion. It is of its very nature community building. Even these ordinary actions and realities are sacred, binding the group together in Christ as they do. In Christ, the Eucharist makes the church and the church makes the Eucharist. This imposes a certain style and spirit on the participants.~5 Linked to this style and spirit is a rationalized asceticism, a renunciation of self in order to share the celebration with others. This elementary structure, idiom, and grammar of the liturgy needs, then, to be understood and the liturgy's forma- Review for Religious tive process realized. This formation is also a journey. Its out-line is the Rite of Initiation of Adults,16 which consists of our personal pilgrimage to know ourselves, reflection on the story of other Christians, purification and enlightenment, accepting the mystery, reflecting on the mystery and renewing our lives. Here, in the context of the metaphors and images of the Christian faith remembered and celebrated in the liturgy, can-didates move to total conversion: intellectual (without which there is no growth in under-standing the Christian mystery), moral (with-out which one does not seek to improve one's life), and religious (without which one makes no judgment about the condition of one's own faith). One learns from what one does (the way of action). This has a knowledge dimension in which the memory is recalled and cel-ebrated, a pledge of future glory is given, and devotion is nour-ished for continued Christian living. Christian cultural literacy provides one with the language and communication needed to be part of the Christian tradition as it is at this time in history. Lamentation about what might have been serves little purpose. What possibilities exist within the Asian tradition for carrying the Christian tradition further? While the idiom and grammar of the Christian tradition can be stated and understood briefly, there is a richness of imagery that aims at evoking faith beyond some brief concepts. Take the language of the creed: "I believe in Jesus Christ, [the Father's] only Son, our Lord. He was conceived by the power of the Holy Spirit and born of the Virgin Mary. He suffered under Pontius Pilate, was crucified, died, and was buried. He descended into hell. On the third day he rose again. He ascended into heaven and is seated at the right hand of the Father. He will come again to judge the living and the dead." Clearly, this profession of faith includes more concrete images than abstract Before entering the novitiate, candidates should be able to move easily and accurately within the idiom and grammar specific to the Catholic tradition. January-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture concepts. It is perhaps, in this area that Asia would be most com-petent to make a contribution. Possible Asian Enrichments The "text"--the idiom and grammar--remains untouched. Without denying the text, Asia is supremely gifted to enrich the imagery. Jacome Gonsalvez (1676-1742), who is considered an important writer in Sinhala (the local language of Sri Lanka), did not try to reexpress theology in the Sinhala idiom: his the-ology repeats the Scholastics. But, relying on the apocryphal tradition (as regards details of Mary's early years) and on an abundance of imagery drawn from local sources, his work evokes an attitude of respect for the Christian faith even among read-ers of other religious persuasionsY Given the technique of learning the idiom and grammar by heart, the specific Asian contribution would be faith reflection in love--not by negating that idiom and grammar, not by lamenting the shortcomings of history, not by challenging or seeming to defy authority, but by being rooted in our tradition and proposing to our countrymen, especially fellow believers, images and perspectives that serve to enrich their faith. Another element of enrichment is the liturgy. Here we are to find meaning in what we do within our community of believ-ers. But there is the danger of making the liturgical action (com-munitarian of its very nature) an act of private and personal devotion. This is a real danger, and not only in the Christian religion. In Sri Lankan Buddhism, certain innovations, espe-cially the inclusion of the vernacular in a form of devotion (Bodhi Piija), have become popular in a short time. But other (quasi-magical) rites and patterns of popular thinking that were in no way in the mind of the innovator have found their way into the rite.L8 This development has taken place within some twenty-five years. Similarly, Christian Asian religious can offer new perspectives. Most p~:obably, in the Eucharistic prayer of Addai and Mari, there was no narrative of the institution. Would evi-dence of such a liturgical tradition give indication (for the uni-versal church) that the meaning of the liturgical action is in what is done? Asian celebration could give the liturgy an enrich-ment (and sometimes, unfortunately, a deformation). Review for Religious If cultural literacy is an "understanding that follows love and commitment," the liturgy is the celebration that "faith and promise are correlative." The word of God proclaimed to the liturgical assembly is received in faith; its promise is fulfilled today in the midst of the assembly. It is not a question of con-cepts so much as the reality of the commitment. Ever Searching for God The present article considers religious life as a search for God. That search is intense--as intense as the desire of a drown-ing person for air. Growth in the religious life is giving focus and content to that desire in accordance with the Christian tradi-tion (particularly the idiom and grammar of doctrine and litur-gical celebration) and th~ specific charism of the religious institute. The process is within the realm of the ordinary, and the manner is by way of instinct and connaturality. The search occurs in a world permeated by both sin and grace. The vision always involves the death and resurrection of Jesus. In this search, reli-gious in Asia, after identifying the specific contribution they can make, need to make it with courage without jeopardizing com-munion with the universal church. As St. Irenaeus (c. 130-c. 200) wrote, "though languages differ throughout the world, the content of the tradition is one and the same. The churches estab-lished in Germany have no other faith or tradition, nor do those of the Iberians, nor those of the Celts, nor those of the East, of Egypt, of Libya.''19 Yet there has to be a distinct element in the manner in which the faith is lived, celebrated, and expressed as spirituality. As Francig de Sales (1567-1622) has said, "the prac-tice of devotion must differ for the gentleman and the artisan, the servant and the prince, for the widow, young girl, or wife. Further, it must be adapted to their particular strength, cir-cumstances, and duties: . True devotion never causes harm, but rather perfects everything we do."2° Notes ~ It was reported in Newsweek (21 May 2001) that scientists dis-covered in 1981 a humpback whale creating waves with its tail to trap fish. That innovation of a single reported case is now said to have spread to half the humpback whale population. January-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture 2 John Henry Newman, An Essay in Aid of a Grammar of Assent (Garden City: Image Books, 1955), p. 260. Some examples provided by Newman of how this sense of natural inference works are worth recording: "A peasant who is weather wise may yet be simply unable to assign intelligible reasons why he thinks it will be fine tomorrow; and, if he attempts to do so, he may give reasons wide of the mark, but that will not weaken his own confidence in his prediction. His mind does not proceed step-by-step, but he feels all at once and together the force of various combined phenomena though he is not conscious of them. Again, there are physicians who excel in the diagnosis of com-plaints, though it does not follow from this that they could defend their decision in a particular case against a brother physician who dis-puted it. They are guided by natural acuteness and varied experience; they have their own idiosyncratic modes of observing, generalizing, and concluding; when questioned, they can but rest on their own authority, or appeal to the future event" (pp. 261-262). 3 Newman, Grammar, p. 264. Thi~ "feeling" of which Newman speaks is "a feeling in the human mind., allied perhaps to that sense of danger which animals exhibit when placed in the vicinity of natu-ral enemies of their race, and which makes birds cower when the hawk is in the air, and beasts tremble when the tiger is abroad in the desert" (p. 264; read pp. 260-299 for a better understanding of this natural inference and illative sense, as propounded by Newman). 4 See N. Abeyasingha, "The Next Generation of Religious in Asia" in Review for Religious 58, no. 6 (November-December 1999): 621-629. 5 Some years ago I was asked by a boy whom a religious in a lead-ing Catholic school was preparing for First Holy Communion whether it was true that, if he were to bite the host, it would bleed. In fact, he asked me this after he had observed me biting the host at a Mass I cel-ebrated. 6 L'Osservatore Romano (English edition, 16 July 1979), p. 6. 7 "In recent times--particularly during the Second Vatican Council--there have been long discussions whether this relationship is theocentric or anthropocentric. There will never be a satisfactory answer to this question if we continue to consider the two terms sep-arately. In fact, Christianity is anthropocentric precisely because it is theocentric, and simultaneously it is theocentric, thanks to its extraor-dinary anthropocentrism. But it is just the mystery of the incarna-tion which, in itself, explains this relationship" (John Paul II, L'Osservatore Romano, English edition, 7 December 1978, p. 1). 8 I am the only Catholic priest working in a state university that has a large majority of Buddhists among staff and students. Over the years I have had to make certain decisions and adopt certain behav-ior patterns in order to practice a minimum degree of Christian wit-ness. Review for Religious 9 See Gunapala Nanayakkara, Public Administration: The Socio- Cultural Milieu (Study Series: Public Administration 88-2, Jayawardenepura: Postgraduate Institute of Management, 1988), p. 10. 10 Cited in William C. Spohn, "The Need for Roots and Wings: Spirituality and Christian Ethics," Theology Digest 47, no. 4 (Winter 2000): 329. 11 See the Catechism of the Catholic Church, §927. See also Sacramentum Mundi, Vol. 4, p. 394: "In Palestine, for example, in the 6th century, the abbot of a monastery exercised penitential discipline even in regard to capital sins. Sometimes little attention was paid to whether the monk-confessor was a priest or layman (as early as the 5th and 6th centuries), but this drew protest from Pseudo-Dionysius. After the Iconoclast controversy (8th century) only the priest-monks had in practice the right to hear confessions." ,2 See E.D. Hirsch Jr., Cultural Literacy (Boston: Houghton Mifflin, 1987) and The Dictionary of Cultural Literacy (1988). 13 See Dennis C. Smolarski, Liturgical Literacy from Anamnesis to Worship (New York: Paulist Press, 1990). ~4 See Kevin Irwin, "Models of the Eucharist," Origins 31, no. 3 (31 May 2001): 33-44. ~s See Aidan Kavanagh, Elements of Rite: A Handbook of Liturgical Style (Bangalore: NBCLC, 1996); Dennis C. Smolarski, How Not to Say Mass: A Guidebook for All Concerned about Authentic Worship (New York: Paulist Press, 1986). 16 See J.D. Dunning, "The Rite of Christian Initiation of Adults: Model of Adult Growth," Worship 53 (March 1979): 142-156. See N. Abeyasingha, Towards Contextualizing Theology with a CSsR Bias (Bangalore: Joint Secretariats, 1990), pp. 80-95. ~7 There is a precedent for this kind of reading, reflection, and interpretation of the Christian tradition. Very early in the New Testament, there was a Christological interpretation of the Exodus (1 Co 10:1-4). Aphraates (260/275-345), the oldest Syrian father, wrote: "Jesus the son of Nun led the people over to the promised land. Jesus our Savior promised the land of life to all who, passing over the true river Jordan, have believed and are circumcised in their hearts" (Dem 11, 12). The title "physician" is applied to Jesus by Ignatius of Antioch (+ c. 110): "There is one Physician, who is both flesh and spirit, born and not born, who is God in man, true life in death, both from Mary and from God, first able to suffer and then unable to suffer, Jesus Christ our Lord" (Letter to Ephesians 7.2). The early fathers were so rooted in their faith and commitment that their understanding and interpretation of Scripture and doctrine fol-lowed that faith and commitment. Perhaps their interpretation of the January-February 2002 Abeyasingba ¯ Instilling Christian/Religious Culture Scriptures and the tradition may not be endorsed by modern exege-sis, but they still remain a "faith reading in love" of the Scriptures and the Christian tradition. Through narrative, drama, allegory, allit-eration, and other literary devices, they contributed to the faith by evoking it in their fellow believers. It was in this particular and lim-ited way that they contributed to the enrichment of the tradition of other churches. It was a "pedagogy" in the sense that "nothing exists except what God causes to be. "There is nothing, therefore, that is hated by God, nor is there anything hated by the Word. Both are one, both are God" (Instructor of Children 1.8.62.3-4). 18 See Richard Gombrich and Gananath Obeyesekere, Buddhism Transformed: Religious Change in Sri Lanka (Princeton: Princeton University Press, 1988), pp. 348-410. 19 Adversus Haereses 5.20.1. 2o Introduction to the Devout Life, Part 1, chap. 3. "Attentiveness is the natural prayer of the soul" Nicolas de Malebranche A new resident in the yard: pink stars, in clusters, growing in the hollows of the lawn where the old copper beech roots sank. Four-petaled blossoms, a tube, perhaps, slit four ways and splayed to points, each crayoned pale magenta on the vein, centers barely green, white stamens half an eyelash thick, white pollen feet in the air, visible only an inch from the eye. The buds are tight pink dots, slightly gray, sand-grain small. Alone they'd be invisible. They grow in clusters, three or four rising frrom a claw of six petals, green and spiked as cosmos seeds, opening like orange slices around the straight, slightly furred stem. Doretta Cornell RDC Review for Religious KATHLEEN MCALPIN Conversion: A Summons from the Word of God All conversion happens through a summons from the Word of God. There is an intensity about the word summons ("called with authority or urgency"l) that heightens it beyond a simple call. It poises us to respond. In this instance the summons calls us to a journey of conversion. God's Word comes to us in special moments and in ordinary and unlikely places. The word of God comes in Scripture. It summons us as a personal and communal call to encounter the Mystery of God. The gospel readings abound in calls to deeper faith and more confident hope and to ever effective love of God, neighbor, and all creation. The word of God is God's self-communication, God's love.2 The ultimate word of God's self-communication is the paschal mystery--the life, death, and resurrection of Jesus Christ--a mystery that remains in God's ongoing self-communication. The Letter to the Romans assures us that God's love is poured forth in our hearts (Rm 5:5). We know this mystery as grace, a pers6nal encounter with God. Grace is the word of God, the self-gift of God, telling us of a God with us and3'br us.3 Kathleen McAlpin RSlVl works with theological students at Regis College in its integration-for-ministry and spiritual-direction programs: Regis College; 15 St. Mary Street; Toronto, Ontario; M4Y 2R5 Canada. January-February 2002 conversion process . 40 McAlpin ¯ Conversion The Word of God in Ordinary Places How does the word of God have its origin in natural events and forces? The movie Chocolat offers a good example of how conversion comes in ordinary and unlikely places. For the inhabitants of a storybook town in France, conversion comes in the form of the stranger who opens a chocolate shop. This myth is set in a sleepy but rigidly conservative village in southern France in 1959. Vianne, a young woman of multiethnic background (Latin American and French) arrives in town, her young daughter in tow, hoping to establish a chocolate shop using some secret Mayan chocolate recipes with strange mystical properties, recipes handed down to her by her mother. Vianne has a great compassion for people and a capacity to listen to them. She becomes a catalyst for change. For some in the village, she becomes a healing presence. In others' eyes, however, because she does not share in the Jansenistic spirituality of the Catholic community, she appears scandalous and represents temptation. The word of God has summoned Vi~nne to conversion--in her relationships with the townspeople, through her involvement in the joys and sorrows of the lives about her, and through love. For Vianne also finds love and support in Roux, yet another stranger, whose arrival in town is a further catalyst for conversion not only for Vianne but also for the townspeople. The word of God comes from love. It calls people to love. The word of God came to me in a similar way. At a liturgy at Romero House, a center for refugees in Toronto, I met a refugee couple from Uzbekistan, a country of the former Soviet Union, near Afghanistan. They left because of the extreme religious and political persecution they suffered. Circumstances forced them to leave their two teenage daughters behind. They hoped to bring them to North America soon after their own arrival, but were unaware of all the protocols involved. They now realize they may have to wait for more than a year--if the plan works at all. The deep empathy I felt was a call to be in prayerful solidarity and close community with this couple as they wait in their political dark night. As we prayed at Mass, their presence, their story, haunted me. I united with them as whispers of translation occurred between them during the liturgy. The word of God comes to us in the everyday world of our relationships, in society, and in the mystery called church. The Review for Religious summons to conversion comes in the word of God: from a friend asking for prayers during struggles, in the news of family grief, in the snow falling on cedars, in the call to be patient with an irritating person, in delight at the sun breaking through darkness, in the efforts of racial reconciliation, in the call to reuse and recycle, inthe faith exerted in a trial of doubt, in the hopeful efforts of a community trying to respond to the reign of God. The summons is God's self-communication that reveals what we love. The summons to conversion is a call to find God in all things, and to fall forever in love. "Nothing is more practical than finding God, that is, than falling in love in a quite absolute, final way.''4 In finding God, in falling in love, our lives hope to be changed in a permanent way. In times of doubt and anxiety, we may have many questions about the darkness or seeming nothingness of the world, and the powerlessness of our lives. In times of hope and joy, we often find it simple to seek and to know the living God and discern our response to God with full hearts. In other words, "what you are in love with, what seizes your imagination will affect everything. It will decide what will get you out of bed in the morning, what you will do with your evening, how you will spend your weekends, what you read, who you know, what breaks your heart, and what amazes you with joy and gratitude. Fall in love, stay in love, and it will decide everything." s What or whom do we love? What seizes our imagination as women and men, as religious, in the church, in the world? What gives us hope in our relationships and in our decisions? Falling in love is more about relationships than it is about issues or agendas. We are seekers of God on a mission. Our God is a living, loving God. Our mission is the dream of God, the reign of God. Our very lives reveal what we have found and with whom we have fallen in love. In grace, a living and loving God is present with us when our hearts are encouraged to respond in trusting relationships. God is with us when our hearts are broken over the unending wars and disasters that envelop our world, the universal suffering of women and children, the oppression of the Our mission is the dream of God, the reign of God. January-February 2002 McAlpin ¯ Conversion earth, and the prejudice regarding those who are "other" by race or culture, poverty or status. God is with us and for us as we endure personal grief with our families and friends. Grace abounds in sorrow and in the amazement of love. God embraces us as we embrace others and our own conversion in the unfolding events of our daily life. Conversion in the Experience of Religious Life The history and the wisdom of our Christian tradition have led us to believe that the only reason for religious life is the experience of God. This experience can come through other forms of life, and ~o there is wisdom in being mutually supportive in our search for the living God. We search for this mystery explicitly in relationships with associates and partners in ministry. This can be done only with oil in our lamps. In her recent book Finding the Treasure, Sandra Schneiders reminds us that religious life is about our quest for God. Our life is about the "one thing necessary":6 being in a loving relationship with God, living our sorrows and joys in the embrace symbolized by the religious vows. As I understand it, the early vow formulas of religious were simpler. Women and men dedicated their lives to the love of God and neighbor and professed this love in one vow. For almost a thousand years, the vow for this self-donation-in- love was "ongoing conversion of life." This vow was a deepening of the first call to conversion, baptism. .Religious life has always been influenced by developments in the world community. By the high Middle Ages, the centuries-old practice of special dedication to God as hermits or cenobites was being carefully studied by Scholastic theologians. They focused especially on three principal practices that had long been identified with that special dedication: celibacy or chastity, poverty or unpossessiveness, and obedience or consciously seeking God's will in one's life. Some of this study went into much detail, sometimes enough to distract people from the original intent of their dedication, namely, seeking God exclusively or following Christ closely. Consecrated life itself came to be thought of and ceremonialized as the life of the (three) vows. For almost eight hundred years now, most orders and congregations have expressed their consecration in terms of those vows. In the early history of Review for Religious the Sisters of Mercy, a fourth vow, service, was included--a vow to care for the poor, the sick, and the uneducated. Similar modifications have occurred in other congregations. Over time the idea of the ongoing conversion of life was lost in some communities of religious life. Or was it? Ongoing Conversion Religious life is an ongoing drama of individual and communal experiences of conversion. Most religious have had numerous experiences summoning them to conversion. They have known the limitations and graces of ministry, personal prayer, friendships, deaths in families and communities, political struggles, retreat experiences, natural disasters, personal and community griefs and joys. In communal conversion they have known the power of the whole gracing them with more ene.rgy than any individual could have imagined. They have experienced a call to a deeper awareness of the connection between Christ and the cosmos. They have known chapters calling for renewed faith in the paschal mystery. They have experienced charisma and resistance in this continuing mystery. Each event summons a response to new life. The life, death, and resurrection moments of our lives continue to reveal the life, death, and resurrection of Jesus, the Christ. An early example of my particular experience of this mystery was the use of the word justice in our community. It was quite a political term in the 1960s and early 1970s; born of revolutionary stands, it was quite controversial. At a 1975 prechapter meeting, a vote was taken on the issue. By the grace of God, the acceptance of justice as a topic slipped through by a narrow margin. It was a resurrection moment: the chapter document was ritled "Mercy Looks at Justice." More than twenty-five years later, we gathered to reimagine a new justice structure. It is clear now that justice is not a peripheral issue, but rather the heart of the matter for us. Justice is the very term for the slow, developmental process of conversion in our life of faith. The paschal mystery is interwoven with the conversion of the community. Our current chapter is calling us, as women of the church, to ongoing conversion at the very roots of the spirituality of .~anuary-February 2002 McAlpin ¯ Conversion religious life. We are called to our own conversion as we face the concerns of the earth: multiculturalism, racism, solidarity with the poor. This call comes from no other source but the Source of life, of wisdom, of sophia. Our response connects us with all the religious figures who have gone before us; through them we seek courage and grace. The Spirit of God desires integrity of word and deed even more than we do. We are called and graced--and we are limited by our own weakness--to renew the very structures of our community with the wisdom of justice. Conversion is initiated by God and given as gift. A gift presumes a giver, and for persons of faith the giver is ultimately God. The initiative, the invitation, the summons to conversion is with God. Simply stated, conversion is the movement away from evil and toward good or from one good to a greater good. We trust that through discernment we will learn how to move away from such evils as racism and consumerism and grow in appreciation of all creation and of other cultures, grow in compassionate and just relationships in society and with creation. Three images found in theologies of conversion are helpful when reflecting on a desire for conversion: conversion as God's flooding of hearts through the Holy Spirit, conversion as the awakening of the gifts of the Spirit, and conversion as the loving, compassionate life of Jesus. All three images lead to radical religious conversion of Christian conscience, which ultimately leads us to the loving compassion of the life of Jesus. 44 God Flooding Our Hearts Bernard Lonergan uses the image of God's love flooding our hearts through the Holy Spirit given us in Christ (Rm 5:5).7 He considers conversion as the heart of the Christian life. Conversion, through the work of the Spirit, enables persons to make new judgments and decisions and to .move beyond established horizons into new horizons of knowing, valuing, and acting. Conversion transforms and affects all relationships. "It is not merely a change or even a development; rather, it is a radical transformation on which follows, on all levels of living,~ an interlocked series of changes and developments. What hitherto was unnoticed becomes vivid and present. What had been of no concern is a matter of high import. So great a change in one's Review for Religious apprehensions and one's values accompanies no less a change in oneself, in one's relations to other persons, and in one's relations to God." 8 These changes can be dramatic or slow, intimate but never solitary, concrete and communal, dynamic and ongoing.9 This is consistent with our experience as a community of faith and of the reflections of many of the people encountered in ministry. Conversion "can happen to many, and they can form a community to sustain one another in their self-transformation, [to] help one another in working out the implications and in fulfilling the promise of their new life. Finally, what can become communal can become historical. It can pass from gen-eration to generation. It can pass from one cultural milieu to another. It can adapt to changing new situations, survive into a different age, flourish in another period or epoch." 10 This conviction about conversion engenders hope in current experiences of communal conversion--as a community, among our associates, and with our collaborators. We trust that this grace influences all those in relationship with us from one generation to another. Conversion is initiated by God and given as gift. Awakening to God The second image of conversion is the awakening of gifts of the Spirit that challenge relationships to be mutual and courageous. Awakening is the empowerment of the Spirit of Wisdom. Sophia releases the capabilities of giftedness in the individual and in the communal experience of conversion. Elizabeth Johnson places empowerment and relationships central to her understanding of conversion: "A permanent process of both turning away and turning inward--turning away from all that intellectually, morally, and spiritually keeps one mired in abusive relationships characterized by domination, inti~nidation, fear, or dishonesty and turning toward the unlimited grace of God ever calling us to relationships characterized by mutuality, respect, courage, and truthfulness." ~ January-February 2002 McAlpin ¯ Conversion In this image, conversion is empowerment and affirmation of one's strength and responsibility. It is rooted in women's experience of an excess of self-denial in following the call to conversion. Conversion is the movement toward the discovery and appropriation of the potential gifts within an individual, group, or society. As women of the church, we are summoned to discover the gifts necessary to be converted in solidarity with the poor, to value multiculturalism, to eliminate racism, and to act in harmony with all of creation. Our summons is a word of God calling us to appropriate our gifts in the name of Christ for the sake of the reign of God. The Loving, Compassionate Life of Jesus From the conversion experience of Thomas Merton, it is clear that Christian conversion reorients a person's whole life to the truth, value, love, and experience of God as brought to us in Christ. The fruit of conversion in the life of Merton was a transformation of conscience to loving compassion. As Walter Conn says, "the personal measure of Christian living, therefore, is the conscience which has experienced a Christian conversion at once cognitive, affective, moral, and religious. Only a person thus converted is fully and concretely sensitive to the loving life of Jesus. In Merton's life we discovered again the fundamental gospel truth that lies at the heart of Christian tradition: The radical religious conversion of Christian conscience finds its fullest realization in loving compassion--the self-transcending perfection of human empathy and justice. In its total surrender such religious conversion radically relativizes the moral autonomy of Christian conscience." 12 As followers of the gospel, we are summoned to a life of self-transcendence lived in a life of empathy and justice. In the life of Merton, we see that contemplation liberates the conscience for conversibn. Self-transcending love is found to be at the heart of the holistic development of the converted Christian. The fruit of conversion is compassion born of reflection on the life of Jesus. In community we hear of many who are willing to surrender to the needs of the others and thus be a part of the struggle for world freedom. The mystery of Christ is seen through contemplation of suffering and through reflection on the cross Review for Religious and the resurrection of Christ. Though we retain the freedom to refuse God's summons, any movement toward conversion is already the movement of God's grace within us. As I listen to stories in ministry, I frequently hear of how people are changed through events not of their own making, through persons and situations that were beyond their control. Conversion is grace. Conversion as Grace In Sacred Scripture we see grace offered in the prophetic calls to repentance and intimate love. John the Baptist made such calls, and, of course, Jesus did too. In Mark the first words of Jesus are a proclamation of the good news and a call to conversion: "The time is fulfilled and the reign of God has come near. Be converted and believe in the good news" (Mk 1:15). Matthew speaks of "seeking" God, or the reign of God, as the beginning of conversion. Jesus may have sought this experience at his baptism: "Jesus was not renouncing his sinfulness, but was taking his place with all those in. Israel who were saying: 'We are ready, Lord; please make this the moment of your Messianic salvation.'" ,3 In this, Jesus may have been responding to a call to a kind of conversion: "Jesus' experience at his baptism, so far as it can be recovered from the gospel records, seems in many respects akin to the effects of a sudden conversion. There was a sudden and intense personal experience of God. There was a new awareness of personal status with God, a call to a new way of life and acceptance of that call. There was, in fact, a reorientation of his whole personality.''14 Such an experience of God can have a transforming effect on a person's life.'5 While contemplating his baptism, Jesus heard the Spirit of God assuring him, "You are my Son, the Beloved; with whom I am well pleased" (Lk 3:22). Through this prayer, Jesus experienced an unconditional acceptance of God. Grounded in this religious experience, Jesus reorganized his life for the sake of Matthew speaks of "seeking" God, or the reign of God, as the beginning of conversion. January-February 2002 McAlpin ¯ Conversion the .reign of God. He moved from one way of living to another: "He gave up an earlier aiad long-standing way of life as no longer satisfactory, in order to take~ up a new and perilous way of life that now seemed to him imperative.''16 Through the conversion at his baptismal experience, Jesus turned to his mission of public ministry by affirming the reign of God. Elaine Wainwright notes that the reign of God is "the just and righteous purpose of God for all humanity.''~7 She says that after his baptism Jesus continued the mission of announcing this vision of God, which entails hearing, understanding, and doing God's word (Mr 13:23). Jesus enfleshed this vision in his compassionate encounters with those considered least (Mt 25:40).18 Called to a prophetic role, Jesus proclaimed a confidence in God's activity and lived within the reign of God. Jon Sobrino describes his acts and gestures: "His most fundamental gesture is taking sides with human beings in a concrete situation where the existing political religious structure has dehumanized people . Jesus does all he can to concretize and make present real love as the quintessence of the kingdom." 19 The story of the Canaanite woman illustrates a conversion in Jesus' public ministry (Mt 15:21-28). This woman is an ethnic and religious outsider in Israel. She pleads with Jesus for mercy for herself and healing for her daughter. At first Jesus does not respond to her; he understands his mission to be to the Israelites. The disciples, lacking understanding and compassion, want Jesus to get rid of her. Persistent, she continues to appeal to Jesus for help. As he listens to her, he is moved to enter into deeper discussion and uses a familiar parable to oppose her request. He refuses her plea for help with the image of the family's bread not being meant for dogs. Picking up on the image, the woman asks for crumbs from the master's table, thus boldly claiming a share in the reign of God that Jesus proclaims. Jesus is moved by her faith and expands the boundaries of his ministry to include the Gentiles. And so it is that Jesus, through dialogue with an outsider and a woman, sees his God-given mission changed to a greater inclusiveness. This decision of compassionate love comes from a summons through relationship. God is revealed through-others. In relationships we know and experience God. In his relationship with the Canaanite woman, we see Jesus Review for Religious emotionally engaging the spirit of the woman as she challenges his position. He realizes that he has to be responsible to this new interpersonal relationship. His decision is a moral choice within a sociopolitical and religious setting. His discernment is based on a wider understanding of the reign of God. This story gives evidence that even Jesus had a kind of conversion upon receiving a word-of-God summons through someone else's plea for mercy. The Principle of Conversion When we engage in a life of merciful love, when we place ourselves in situations where we work for and develop relationships with others, such relationships begin to include compassion. As this compassion deepens, it leads us to a greater justice. When systems and strategies meet an impasse, we are led into the deeper mystery of Christian love. Conversion to mercy is not primarily about doing specific works. It is an attitude, a horizon of being, or what Jon Sobrino calls a principle. The "principle of mercy is a fundamental attitude at the root of every human interaction," which then "affects all subsequent interactions." The principle of mercy "becomes justice" by engaging all levels of energy: intellectual, religious, scientific, and technological.2° Mercy animates a conversion that leads to changes in relationships, changes in thinking, acting, and believing. Sobrino learned an amazing truth through the martyrdom of his brother Jesuits and the women who worked with them. He now believes that nothing is as "vital in order to live as a human being than to exercise mercy on behalf of cn~cified people, and that nothing is more humanizing than to believe in the God of Jesus.''21 The exercise of mercy becomes a quality of being in all who engage in merciful justice. In discerning mercy as justice, we are summoned to share in the life of the Word of God, to fall in love, and, through ongoing Christian conversion, to live forever. Notes Gage Canadian Dictionary (Toronto: Gage Publishing Co., 1983). Karl Rahner, Foundations, trans. William V. Dych (New York: Seabury Press, 1978), p. 127. January-February 2002 McAl~in ¯ Conversion 3 Karl Rahner, Nature and Grace (New York: Sheed and Ward, 1963), pp. 24-26. 4 Attributed to Pedro Arrupe, superior general of the Jesuits from 1965-1983. s Attributed to Pedro Arrupe. 6 Sandra M. Schneiders, Finding the Treasure (Mahwah: Paulist Press, 2000), pp. 37-39. 7 Bernard J.E Lonergan, Method in Theology (Toronto: University of Toronto Press, 1971), p. 105. 8 Walter E. Conn, Conversion: Perspectives on Personal and Social Transformation (New York: Alba House, 1978), p. 13. 9 Conn, Conversion, p. 45. 10 Conn, Conversion, p. 45. 11 Elizabeth Johnson, She l.Vho Is: The Mystery of God in Feminist Theological Discourse (New York: Crossroad, 1993), p. 64. 12 Walter E. Conn, Christian Conversion: A Developmental Interpretation of Autonomy and Surrender (New York: Paulist Press, 1986), p. 268. 13 Demetrius Dumm, Flowers in the Desert: A Spirituality of the Bible (New York: Paulist Press, 1987), p. 28. ~4 Donald Gray, "Was Jesus a Convert?" Religion in Life 43 (Winter 1974), citing Hugh Montefiore, Awkward Questions on Christian Love (Philadelphia: Westminster Press, 1964), p. 449. ,s Conn, Conversion, p. 215. 16 Gray, "Was Jesus a Convert?". p. 449. ,7 Elaine Wainwright, "The Gospel of Matthew," in Elizabeth Schiissler Fiorenza, ed., Searching the Scriptures: A Feminist Commentary (New York: Crossroad, 1994), p. 636. ~8 Ibid, p. 637. 19jon Sobrino, Christology at the Crossroads (New York: Orbis Books, 1978), p. 92. 20 Donald L. Gelpi SJ, The Turn to Experience in Contentporary Theology (New York: Paulist Press, 1994), p. 134. 21 Jon Sobrino, The Principle of Mercy: Taking the Crucified People from the Cross (New York: Orbis Books, 1994), p. 10. Review for Religious STEVE WLUSEK Seminary Formation and Lonergan's Conversion Theory i~arpe~P diem! Seize the day! Make your lives something ~ remarkable!" With these words Robin Williams's char-acter in the movie Dead Poets' Society begins to inspire his students not to just go through the paces of the educational system, but to make something of their time in school and of their very lives. He evokes their conversion from apathetic docil-ity to active participation in their own education. At turning points such as this, people begin to discover their own identity and mission. Bernard Lonergan's theory of conversions can illu-minate such personal development, anyone's, but here my focus is on seminary formation. Lonergan identifies four main conversions in life: moral, affec-five, critical moral, and religious.1 Each of these conversions opens people to a deeper awareness of their true self and brings about greater self-transcendence, allowing true relationships to develop with other people and especially with God. Lonergan bases his theory of conversions on the concept that everyone is self-cen-tered to some degree and that everyone's growth must begin from that point.2 From my perspective of ministering to many people in both parish and seminary, I have seen a number of degrees of self-centeredness. Steve Wlusek, a diocesan priest, is a faculty member of his diocese's St. Peter's Seminary; 1040 Waterloo Street; London, Ontario; N6A 3Y1 Canada. January-February 2002 Wlusek ¯ Seminary Formation A brief description of these conversions of Lonergan's will, I think, elucidate the validity of his theory for the ministry of seminary formation. Lonergan defines conversion as a fateful call to a dreaded holiness, an about-face by which we move into a radically new horizon, a personal entrance of God into our life and history, a communication of God to us.3 A person's con-version does not just happen; rather, it is a fundamental choice: "Conversion is a change of direction and, indeed, a change for the better. One frees oneself from the unauthentic. Harmful, dangerous, misleading satisfactions are dropped. Values are apprehended where before they were overlooked. Scales of pref-erence shift."4 Moral conversion is "choosing value as the criterion of one's life.''s In undergoing this form of conversion, one realizes that there is more than oneself that needs to be protected and respected. One's sensitivity is changed from wanting one's own life to be fair, to wanting justice for others and realizing that one has an obligation to work toward providing that justice. Moral conversion, therefore, is an impetus to move outside of oneself, which stretches that self to becoming other-conscious. Lonergan likens affective conversion to falling in love. Whereas moral con-version moves a person to be concerned for the well-being of others, affective conversion arouses one to be so moved regard-ing the other's well-being that one's entire orientation shifts to a concern which is expressed in action. Affective conversion involves not only the possibility of committing oneself to a course of active servi~e of another, but also the ability to execute that decision over the long haul.6 Lonergan identifies critical moral conversion as changing one's standard for personal orientation. Those who undergo this conversion come to a healthy sense of the sacred within themselves. They do not need to look somewhere else beyond themselves to discover what is real or valuable; they accept the validity of their own judgment. During the gradual process of their personal development and their prudently increasing autonomy, they reach a crucial point. They discover that their own judging and deciding affect them no less than the objects of their judgments and decisions. They realize that they are respon-sible for what they make of themselves, and that their choices are crucial in the process of becoming authentic persons.7 Review for Religious Through religious conversion, one falls in love with God and surrenders oneself completely to God. This conversion moves one to live with this attitude: "Whatever you want for me, God, I want it too." Lonergan portrays the one who has been trans-formed through this religious conversion as being "a subject in love, a subject held, grasped, possessed, owned through a total and so an other-worldly love.''8 Religious conversion creates a basic consciousness that enables one to appreciate all as gift from God. This consciousness impacts how one views oneself, one's situation, and one's role in the human condition.9 In mov-ing out of oneself to embrace God in religious conversion, then, one also lovingly em-braces other people, sensing their Beloved dwelling therein. Lonergan's theory of con-versions can have constantly renewed application, for the Christian life is one of ongoing conversion, with people's lives seldom following his theory once and for all, neatly, step-by-step. Ongoing conversions, relevant as they are for people in general, are relevant also for seminar-ians and those who assist in their discernments on their path toward the priesthood. Using composite portraits of three sem-inarians, I hope to show how Lonergan's theory may be of help. The first of these three, John, had a sense of conversion at around the age of twelve. He had for several years been a server at parish Masses and had a deep admiration for his parish priest. John saw in him a man of Eindness and deep faith and love for God. As John served at the altar with this priest, and watched him minister, he came to a growing awareness that he wanted to be a priest just like his pastor, dedicating his life to serving God. His parents were eager about the prospect of their son becom-ing a priest. John entered the minor seminary at age thirteen. John has completed his college studies and is now studying the-ology in the major seminary. Although John is ardent in his prayer and during liturgies, he seems deficient in some of his relationships. He comes late for class and other formation group Lonergan identifies critical moral conversion as changing one's standard for personal orientation. January-February 2002 Wlusek ¯ Seminary Formation events, and he shows little respect for his peers. He and a friend from his hometown talk exclusively to each other at meals, ignoring the other seminarians nearby. Lonergan's theory reveals that John may have experienced a moral conversion, which set him on the path to serving God as a priest, but he still seems to need an affective conversion so as to have much more respect and compassion for others. Peter, another seminarian, was very much involved in his parish before entering the seminary. He experienced conver-sion through youth retreat weekends, which seemed to change his life. Since these weekends, he has served in many ways through his parish youth ministry: visiting nursing homes, vol-unteering at a soup kitchen, and packing boxes in his local food bank. In his seminary activities he does tremendous service at his field-education placement. His supervisor reports that he is looked up to by everyone at the center and that the physically challenged people he works with look forward to his visits with them. Although all of this is true and highly commendable, Peter's behavior in the seminary community is less than could be desired. He forgets his duties to read or serve at Eucharist, he gives people who disagree with him the silent treatment, and he snubs those who are not in his select group of friends. Peter seems to have undergone moral and affective conversions: he has been moved to work for the care of others and for justice towards them. Peter, however, has compartmentalized this awareness; it pertains only to those outside his immediate com-munity. He is eager to go out of the building to do outreach, yet he fails to recognize opportunities for outreach right in the hall-way where he lives. The third seminarian, Mark, entered the seminary after graduating from university and working in a respected career for several years. While engaged in this career, which involved help-ing others, he came to a realization that what he was doing was not enough. Even though he was helping pgople, he felt he could help them only materially. He came to understand deeply that God was calling him to use his intelligence and ability to help people not only materially but spiritually. Currently, in the seminary, Mark quietly serves others and looks after the needs of sick seminarians and those overly stressed by their studies. He does so in a quiet manner, seeking no recognition or praise. He Review for Religious goes to his parish field-education placement eagerly, seeing an opportunity for the kind of service to which he feels God is calling him. While others complain around the meal table about the food or about the workload they are under, never is "heard a discouraging word" from Mark. He has lived on his own and has done plenty of work in his former career. In the chapel he is often found in prayer or reading books from the spiritual masters. Mark is a man of self-assuredness, maturity, and desire for God. He seems to have undergone moral, affective, and crit-ical- moral conversions. I believe that Mark and the other semi-narians mentioned have experienced different degrees of religious conversion as well. All of them, however, still need further growth toward a complete yes to God (as we all do). Understanding the level to which seminarians have under-gone these conversions is crucial in the role of seminary for-mation. Part of the role of seminary formators is to discern, with other faculty members, candidates' readiness to progress further in the formation program. Lonergan's theory of con-versions can help tremendously in this work. Awareness is the first step towards action. By being more aware of the levels of seminarians' conversion, we will be able to identify areas in which we can help them grow. The saying that "faith is caught and not taught" is good to remember when reflecting on our seminarians' conversions. It is not simply the teaching of the-ology that will evoke a personal about-face. We need to foster various circumstances wherein conversion may be experienced: in supportive and nurturing encounters of spiritual direction, in open and mutually respectful formation-group dialogues, in teaching filled with dynamism and conviction, in field education and theological reflection which help students reflect on the needs of people in their community, in experiences of working with the poor, and in celebrations of liturgies that are inspiring and affectively moving. The teacher in Dead Poets' Society took seriously his respon-sibility to motivate his students to make their lives remarkable. Through the insight gained from Bernard Lonergan's theory of conversions, we can appre.ciate in a new way our role in priestly formation to discern the status of candidates' conversion life and to present them with opportunities for deeper conver-sion, so they can make of their lives what they were made for. January-February 2002 Wlusek ¯ Seminary Formation Through these experiences of faith, nurture, and co~nmunity, seminarians will be able not only to come to deeper conver-sion, but to embrace more fully their true identities in union with God. Notes 1 Bernard Lonergan, Method in Theology (Toronto: University of Toronto Press, 1990), p. 238. 2 Walter E. Conn, The Desiring Self(New York: Paulist Press, 1998), p. 67. 3 Lonergan, p. 113. 4 Lonergan, p. 52. s Conn, p. 118. 6 Conn, p. 121. 7 Mary Kay Kinberger MSC, Lonergan on Conversion: Applications for Religious Formation (New York: Peter Lang, 1992), p. 38. 8 Lonergan, p. 240. 9 Kinberger, p. 46. January January blizzards on the heels of Christmas. Winter grips the snow-encrusted land with the iron determination Grandma whipped egg whites into stiff miniature Alpine peaks. The time of rushing has passed. No birds sing joyously. Nor do dogs bark with gusto. Last year's wild roses have long gone into seed. It is a season for me to listen: maybe to a heartbeat, an old man fingering his worn beads. Or, in my moments of stillness, hear the whisper of the Epiphany Child inviting me go out into the cold and visit those who are old, grieving, sick, and forgotten. Richard Heatley Review for Religious PATRICIA ANN LAMOUREUX AND PAUL ZILONKA The Workers in the Vineyard: Insights for the Moral Life Bracelets with the letters WWJD are popular these days. They are meant to remind the wearer and others to keep asking What Would Jesus Do? This practice assumes that we can fairly quickly see or reason to what Jesus would do in response to the moral dilemmas of life in 2 lst-century America. It ought not surprise us that these bracelets are promoted more by evangelical groups than by those who take more seriously the challenge of modern biblical exegesis and hermeneutics. In light of the Second Vatican Council's call to develop moral theology in accordance with the biblical vision, Catholic moral theologians have given the relationship of Scripture and ethics increased scholarly attention.1 Increased knowledge, however, has led to greater appreciation for the complexity of the task. Although constructive proposals for relating Scripture and ethics are still only being tested, many people nowadays are better prepared to avoid facile answers and improve inadequate ones. In this essay we try to discern ethical implications of the parable about the workers in the vineyard (Mt moral insight Patricia Ann Lamoureux teaches moral theology and Paul Zilonka CP teaches Scripture at St. Mary's Seminary and University; 5400 Roland Avenue; Baltimore, Maryland 21210. ~tanuary-February 2002 Lamoureux and Zilonka ¯ The Workers in the Vineyard In Galilee at that time, there were three types of relationship pertaining to work: patronage, exploitation, or cooperation. 20:1-16). The story disconcerts many people's sense of jusfce. We undertake this task with recognition of the danger of selecting one text from "a rich symphony of literary forms . . composed of a chorus of voices speaking out of a variety of historical and cultural contexts and a number of theological perspectives and addressing a broad spectrum of moral questions.''2 While focusing on the vineyard parable, we are not attempting to reduce this "rich orchestration" to a "simple melody line.''3 Nor are we suggesting that this story somehow contains all that Scripture has to say about morality in general or justice in particular. We approach the parable in three steps: (1) investigating the original set-ting and meaning of the parable (the exegetical task); (2) assessing how to appropriately employ this parable within the various levels of moral reflection (the methodological task); (3) interpreting the meaning of the parable for our contemporary situation (hermeneutical task).4 Let us begin with the parable: For the kingdom of heaven is like a landowner who went out early in the morning to hire laborers for his vineyard. After agreeing with the laborers for the usual daily wage, he sent them into his vineyard. When he went out about nine o'clock, he saw others standing idle in the marketplace, and he said to them, "You also go into the vineyard, and I will pay you whatever is just." So they went off. When he went out again about noon and about three o'clock, he did the same. And about five o'clock he went out and found others standing around, and he said to them, "Why are you standing here idle all day?" They said to him, "Because no one has hired us." He said to them, "You also go into my vineyard." When evening came, the owner of the vineyard said to his foreman, "Call the laborers and give them their pay, beginning with the last and then going to the first." When those hired about five o'clock Review for Religious came, each of them received the usual daily wage. Now when the first came they thought they would receive more, but each of them also received the usual daily wage. And when they received it, they grumbled against the landowner, saying, "These last worked only one hour, and you have made them equal to us who have borne the burden of the day and the scorching heat." But he replied to one of them, "Friend, I am doing you no wrong; did you not agree with me for the usual daily wage? Take what belongs to you and go; I choose to give to this last the same as I give to you. Am I not allowed to do what I choose with what belongs to me? Or are you envious because I am generous? So the last will be first, and the first will be last." (Mt 20:1-16) Exegetical Task In this section we explore what the parable meant to the people who first heard or read it. It is possible and even likely that Jesus' original audience, and Matthew's community too, included people of the social class of the vineyard .owner (landholders, merchants, entrepreneurs) as well as employed and unemployed workers. In lst-century Galilee, harvest time in a vineyard was fraught with tension. When the crop was ready, there could be no delay. All hands were needed to bring in the fruit at the peak of maturity. Also, the condition of day labor in the Hellenistic-Roman world was dreadful. The employer of the ancient world was master of his money; he could do with it as he chose. Commonly, employers looked in the marketplace of the city for unemployed men hoping to be hired. The agreement with those called at dawn was for "the usual daily wage" in that agrarian context. These men worked for whatever the employer was willing to pay, usually subsistence wages at the lowest level for a day's work. As the day went on, more laborers were needed. Thus we can understand the repeated excursions of the owner of the vineyard back to the town square seeking extra workers, even as the day waned. These others were promised what was "just," but the amount remained unspecified.5 In Galilee at that time, there were three types of relationship pertaining to work: patronage, exploitation, or cooperation. The January-February 2002 Lamoureux and Zilonka ¯ The Workers in the Vineyard latter would seem to explain the parable in regard to the workers of the first hour and those of the subsequent hours too. They agree to cooperate in doing the work for a stipulated amount, "the daily wage" for the first group and "what is just" for the latter groups. They are day workers rather than those enjoying the pati'onage relationship, which has a more permanent quality. Nor are they being exploited as slaves.6 Yet they grumble when workers hired at the 'end of the day receive the full daily wage. Over the years many people have been upset by the logic of the landowner, startled by what seems to be his "unbusinesslike" behavior. Those hired in the last moments of the workday could hardly have hoped for more than a small fraction of what the first would receive. After all, they had worked so little. The vineyard owner's payments take

Issue 58.4 of the Review for Religious, July/August 1999. ; Review for Religious is a forum for shared reflection on the lived experience of all who ~nd that the church's rich heritages of spirituality support their personal and apostolic Christian lives, The articles in the journal are meant to be informative, practical; historical, or inspirational, written from a theological or spiritual or sometimes canonical point of view. Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: foppema@slu.edu Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP P.O. Box 29260; YVashington, D.C. 20017 POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©1999 Review for Re!igious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission ~nust bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. for religious Editor Associate Editors Canonical Counsel Editor Editorial Staff Adviso.ry Board David L. Fleming sJ Clare Boehmer ASC Philip C. Fischer sJ Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm James and Joan Felling Kathryn Richards FSP Joel Rippinger OSB Bishop Carlos A. Sevilla $3 David Werthmann CSSR Patricia Wittberg SC Christian Heritages and Contemporary Living JULY-AUGUST1999 ¯ VOLUME58 ¯ NUMBER4 contents 342 feature U.S. Catholic Re!igious and Slavery: A Seldom Told Story James Fitz SM examines the significant 19th-century issue of social justice and human transformation, the story of slavery, and how relig!ous in the United States were involved. 364 372 witness Edith Stein: St. Teresa Benedicta of the Cross OCD Rita E. Goldman reviews the life of Edith Stein and points out ways she models a contemporary holy life. At Home by the S~a: ' Isabel Green SCN and the House of Prayer Experience C. Walker Golla~ PhD tells the story of Sister Isabel SCN and her influence in the development .of the Hou~se of Prayer movement for spiritual renewal. 384 393 consecrated life Vita Consecrata and the Anthropology of the Vows Dennis J. Billy CSSR develops five basic anthropological dimensions of human existence for a more thorough understanding of the vows of chastity, poverty, and obedience. Authority among Religious in South Asia Nihal Abeyasingha CSSR explores some of the issues dealing with the religious tradition of authority and obedience within different cultural contexts. 403 424 discerning Becoming a Nun: A General Model of Entering Religious Life Barbara Zajac proposes from her sociological research that personal contact and visibility are key elements in fostering vocations to consecrated life. Discerning Community Leadership Mary Benet McKinney OSB presents the advantages and the difficulties that are involved in a community's use of the discernment process. departments 340 Prisms 429 Canonical Counsel: Admission to an Institute of Consecrated Life 435 Book Reviews July-August 1999 prisms In this year dedicated to God the Father, we would do well to bring into sharper focus to whom we pray. For the sake of our prayer life, we might examine how our praying is shaped by Jesus' teaching the Our Father. What are the ordinary elements that we as Christ's disciples appropriately bring to our day-to-day way of l~raying? Our Father Our prayer begins with our, not my, "hello" to One who has loved us into life, the One we call upon as the "God of our life," "Giver of all good gifts," "Abba" (Jesus' love word). who art in heaven One so close, so totally present to us, and yet not in the world of our control--beyond the sphere of limitation and death. hallowed be thy name You are holy--totally other than us; you are God, and we are not. It is your world; we are your creation. Awe-filled, we say "Holy your name!" thy kingdom come For us and for the world, we want what you want. Why? because it is out of love you create and you act and you seek out. thy will be done on earth as it is in heaven May your desires become our desires and so let us act with you--as ones who love. give us this day our daily brei~d Daily let us be with you and work with you for all that sustains our life with Review for Religious and forgive us our trespasses as we forgive those who trespass against us There are times we pay no heed to you; we become so caught up in our own way of finding life and in our own way of seeking love. Forgive us for receiving your love so awkwardly, sometimes so grudgingly. Help us to act like you in offering forgiveness to others who hurt us in any way. and lead us not into temptation You know our limits; please be gentle with us in your unquenchable love. Even more we ask you to be strong within us as together we face the things that might make us less than the human persons you call us to be. but deliver us from evil We know that you are always a saving God, and we stand always in your presence as ones who need saving--so we believe, so we trust, so we love. Moved by Christ's Spirit, our praying may take shape in any and all of these reflections of Jesus' way of teaching us to pray. So we pray in Jesus' name. There are some changes within the Review for Religious staffing that I would like all of you, our readers, to know about. Miss Jean Read is retiring after serving some twenty-three years after her first "retirement" from a variety of Jesuit works. Sister Regina Siegfried ASC is returning to full-time teaching and student counseling after six years on our editorial staff. We remain grate-ful for their lasting contributions. We welcome Sister Clare Boehmer ASC to the editorial staff, who assumes special care for the Reviews department. David L. Fleming sJ P.S. To honor Jean Read, who has shouldered a major respon-sibility for the publishing of all the books in the Best of the Review series, we are publishing a new book, Life through a Poet's Eyes, The Best of the Review - 6. See the insert page at the end of this issue. L___2,4.1__ JAMES FITZ U.S. Catholic Religious and Slavery: A Seldom Told Story feature For religious of the United States, actions for social jus-tice and human transformation have become a signifi-cant aspect of our mission since the promulgation of Gaudium et spes at the conclusion of the Second Vatican Council. "The joys and the hopes, the griefs and anxi-eties of the people of- this age, especially those who are poor or in any way afflicted, these are the joys and the hopes, the griefs and anxieties of the followers of Christ" (§1). The (all to social justice and human transforma-tion was notably addressed to religious in a 1981 docu-ment from the Sacred Congregation for Religious and Secular Institutes (SCRIS) titled "Religious and Human Advancement" (Le scelte evangdiche). l This call was reaf-firmed most recently by the Synod on Consecrated Life in 1994 and the postsynodal apostolic exhortation Vita consecrata (see §82) in 1996. In June 1997 Representative Tony Hall, Democrat from Dayton, Ohio, and a bipartisan group of eleven members of the United States House of Representatives introduced a one-sentence resolution that the U.S. Congress apologize to African Americans, "whose ances-tors suffered as slaves under the Constitution and laws of the United States until 1865:."2 Thi~ resolution, a James Fitz SM returns to our pages after a busy twelve-year absence. His address is Office of Campus Ministry; University of Dayton; 300 College Park; Dayton, Ohio 45469. Review for Religious response to President Clinton's initiative to heal racial division in this country, began a national debate over whether a national ~apol-ogy for slavery is necessary or useful. The recent movie Amistad has heightened awareness of this issue. In this article I examine this significant 19th-century issue of social justice and human transformation, the story of slavery, and how religious in the U.S.A. were involved in and responded to this critical issue in our American social history. This story is sel-dom told. Hardly one of the glorious moments in the history of American religious life, this story can give us religious a perspec-tive and context for understanding present-day events and can teach us multiple ways of bringing our Christian commitment and tradition to contemporary issues. Also, as history has a way of doing, it witnesses to "development of doctrine," with implica-tions for new issues facing the church today. History challenges its students to remember so they will not repeat mistakes of the past. As Elie Wiesel (Jewish scholar, sur-vivor of the Holocaust, and Nobel Prize winner) has pointed out many times, remembering is important. From remembering and pondering the American practice and eventual proscription of slav-ery, what can we religious learn? In the history of the United States, the Civil War (1861-1865) was a profound trial and test of liberty and equality. As President Abraham Lincoln said at Gettysburg, the "nation was "engaged in a great civil war, testing whether that nation, or any nation so con-ceived and so dedicated, can long endure." This struggle split the country. Among the various causes of the war, the different approaches to slavery in the North and the South were clearly one, and the abolition of slavery was one of the social transfor-mations that resulted from the war. This article examines how religious in the United States responded to the "peculiar institution" of slavery and to its trans-formation. 3 First, how did the overall U.S. Catholic Church respond to slavery? Second, what was the involvement of religious with slaves and with ministry to slaves? Third, what was the atti-tude of religious toward slaves and the institution of slavery? Lastly, what tentative conclusions can be drawn fo~ religious living in today's world? Besides some primary ~ources, there are significant studies (by Jesuits and Vincentians, for example) on the involvement of their particular religious orders with slavery.4 Many religious commu- July-August 1999 Fitz ¯ U.S. Catholic Religious and Slavery nities either have not written or are in the process of writing or rewriting histories of their foundations in this country. Once com-pleted, these congregational histories will be valuable in nuanc-ing any conclusions drawn from the information now available. A thorough study of the archives of religious orders and congrega-tions throughout the country could reveal some significant details and interesting historical anecdotes to complete the picture. The information already available, however, is enough for an overview of the response of U.S. religious to slavery. Attitude toward Slavery in the Catholic Church of the United States I suspect that for most American religious of the 20th cen-tury, the ownership of sla~es by their forebears in religion is dis-turbing. For religious formed since Vatican Council II, this fact might seem incomprehensible. That council places slavery among the crimes against the dignity of the human person and calls the church to work to eliminate all forms of slavery: The varieties of crime are numerous:., all offenses against human dignity, such as subhuman living conditions, arbi-trary imprisonment, deportation, slavery, prostitution, the selling of women and children, degrading working condi-tions where people are treated as mere tools for profit rathe.r than free and responsible persons: all these and the like are criminal; they poison civilization; and they debase the per-petrators more than the victims and militate against the honor of the creator . Human institutions, both private and public, must labor to minister to the dignity and purpose of the human person. At the same time let them put up a stubborn fight against any kind of slavery, whether social or political, and safeguard the basic rights of the human person under every political system. (GS §§27, 29) In the Catholic Church of the early 19th century, no formal and absolute condemnation of slavery as an institution existed. Although recognizing abuses in the system, the ch~arch did not see slavery as a moral evil in itself, but as a result of original sin, Christians found no condemnation of slavery in the Scriptures or in the writings of early church theologians. "From Genesis to Philemon one could find no condemnation of the practice. Jesus did not utter one word of censure against slavery even though it was in full existence-in,his day. St. Paul, who claimed to have met Review for Religious the resurrected Christ, did nothing to abolish it--in fact, he did just the opposite when he said, 'Slaves, be obedient to your masters.'" Although slavery per se was not condemned, Pope Pius II in 1482 and Pope Urban viii in 1639 had condemned the slave trade. Pope Benedict XlV condemned the continued enslavement of native peoples in 1741.5 By the end of the 18th century, abolition movements began in various countries and in some of the states of the United States. In 1839 Pope Gregory Xvi issued an apostolic letter again calling for the elimination of the African slave trade.6 Voices opposing slavery began to arise among Catholics in European countries.7 Catholics in the United States, how-ever, did not take a lead in the aboli-tionist movement. Of the few significant Catholic voices, the most prominent came from outside the United States--the Irish leader Daniel O'Connell. His voice did not, however, receive a warm welcome in the United States) Catholic leaders consistently tended to identify the abolitionists with anti-Catholic and In the Catholic Church of the early 19th century, no formal and absolute condemnation of slavery as an institution existed. nativist sentiments. The Know-Nothing party platform of 1855, which combined anti-slavery, nativist, and anti-Catholic concerns, did nothing to win Catholic converts to the antislavery movement.9 Catholics leaders tended to avoid the slavery issue, which divided the nation. In their 1859 provincial council meeting in Baltimore, the bishops of the United States avoided taking a stand on the issues. Although Catholic leaders admitted that human bondage was not an ideal system, they differed on the gravity of the evil and the practicality of proposals to end the system. The only element upon which they agreed was that the principles and methods of the abolitionists were a threat to the safety of the country2° At time of the Civil War, northern church leaders generally supported the position of the union, and southern church leaders generally supported the confederacy. In 1862 Orestes Brownson, a prominent American Catholic layman and thinker, wrote that in the mind of Catholics the preservation of the union took prece-dence over the abolition of slavery. As a northerner he wrote that it was his impression that the majority of Catholics opposed the July-August 1999 Fit~ * U.S. C~tbolic Religious and Slavery abolitionists, but were neither in favor of slavery nor opposed to gradual emancipation. At the time he himself supported emanci-pation as a political and military necessity.1~ In his manual of moral theology written in the early 1840s, Francis Patrick Kenrick, bishop of Philadelphia and later archbishop of Baltimore, regretted the institution of slavery as it was practiced in the United States, but generally acquiesced in the prevailing conditions in the country. Although especially concerned about the restrictions on the edu-cation of slaves and on the slaves' freedom to practice religion, he nevertheless opposed violation of laws controlling slavery. He encouraged slaves to be obedient and masters to be just and kind. Though he considered the original seizure of slaves to be immoral, he argued that the descendants of those who originally purchased the slaves should not be held accountable.~2 Kenrick represented Catholic opinion in the United States, which generally supported the status quo. Those Catholics who saw slavery as an evil were generally for gradual, not forced, emancipation. Southern Catholic Church leaders defended slavery, although some, like Bishop Augustin Verot of St. Augustine, Florida, also pointed out that many southern masters had abused slaves, and that the war might be God's punishment for this. Among the abuses Verot listed were masters separating families, masters taking advan-tage of female slaves, and masters providing neither religious instruction nor proper clothing, food, and dwellings for slaves.~3 Like many of their fellow Americans, many Catholics also had racist attitudes toward the slaves. Although Catholics recognized slaves as human persons, they did not necessarily accept them as equals. Reflecting this belief, Orestes Brownson could write, "We recognize in the Negro a man, and assert for him in their plenitude the natural rights of man, but we do not believe him the equal of the white man, and we would not give him in society with white men equality of respect to those rights derived not immediately from manhood, but mediately from political and civil society, and in this we express, we apprehend, the general sentiment of the Catholic population of this country." 14 Religious Involvement with Slaves In his first report to the prefect of the Congregation de Propaganda Fide, Father John Carroll, superior of the priests in the missions of Maryland (and later the first American bishop), sent the Review for Religious statistics concerning Catholics in the United States. African slaves were a significant part of the Catholic Church in Maryland, about twenty percent of the Catholic population.~s Catholics owned most of these slaves. In the period before the Civil War, some American religious, like their American compatriots and fellow Catholics, owned slaves, Most early American Catholics lived in Maryland and Kentucky, states that permitted slavery. The owning of slaves was an adaptation religious made to living in America. Records document that both men and women religious owned slaves. The Jesuits were major slave owners. Lord Baltimore had granted them extensive lands. They owned four large estates in Maryland in Prince Georges, Charles, and St. Mary's counties and two smaller plan-tations on the Eastern Shore. They also had two farms in eastern Pennsylvania. At first they relied upon indentured servants, a practice they never completely aban-doned. "As this form of labor became increasingly difficult to secure and retain in Maryland, the Jesuit missionaries, like their secular fellow planters, turned to slave labor." The first explicit reference to slaves is from 1711, although they probably had slaves before then. By 1765 they had 192 slaves.~6 The Jesuits also owned slaves in the Louisiana Territory, in both St. Louis and New Orleans27 Two congregations of men came to America to establish sem-inaries: the Sulpicians and the Vincentians (Congregation of the Mission). Because the Sulpicians were not large landowners, they did not own 'a large number of slaves. Individual Sulpicians in Emmitsburg and Louisville (Bardstown) owned slaves28 At the invitation of William DuBourg, apostolic administrator of the Louisiana territory, the Vincentians staffed St. Mary's Seminary in Perry County, Missouri, beginning in 1818. DuBourg provided them slaves. The first Vincentian superior of the American mission, Father Felix DeAndreis, hesitated to accept them, but did so because there were no lay brothers who could do the manual labor. In fact, DeAndreis considered the possibility of.enlisting free blacks and mulattoes into the Vincentian community, but discarded the idea because he was convinced, probably rightly at the time, that no white men would enter the community. The introduction of slaves was considered a necessary adaptation to the American sit- The owning of slaves was an adaptation religious made to living in America. Jtdy-August 1999 Fitz ¯ U.S. Catholic Religious and Slavery uation. A'major concern of the Vincentian superiors in Rome was that a woman was admitted to the kitchen and thus within the com-munity living quarters. There was no comment about the fact that she was a slave. In 1830 the seminary had twenty-seven slaves; this appears to be the highest number at any one time.~9 Of the first eight permanent communities of women religious founded within the original boundaries of the United States, six had Slaves: three in Maryland (the Carmelites of Port Tobacco, the Visitation Sisters of Georgetown, the Sisters of Charity of Emmitsburg) and three in Kentucky (the Sisters of Loretto, the Sisters of Charity of Nazareth, and 'the Dominican Sisters of St. Catherine). The annals and traditions of these six communities refer to "Negro" or "colored" servants" brought by some women as part of their down. For example, at the Carmelite convent, where the slaves numbered thirty by 1829, they lived "comfort-ably" outside the cloister and did the farm work.2° Of the first eight congregations, the Oblate Sisters of Divine Providence (an order of African American religious in Baltimore) and the Sisters of Our Lady of Mercy (Charleston, South Carolina) were the two con-gregations that did not have slaves. The other major grouping of religious during the time of slav-ery were those who came to the Louisiana Territory, which became part of the United States in 1803. Most of these religious were French-speaking congregations, although Spanish religious served during the time of Spanish control. In the Louisiana Territory, the Capuchins owned slaves to work their plantations. Mready mentioned was the Jesuit ownership of slaves in the territory.2! Among the communities of women, French-speaking Ursulines were the first to come to New Orleans in 1727. They had slaves provided as part of their contract with the Company of the Indies.22 Although at first reluctant to purchase a slave, Mother Hyacinth, of the Daughters of the Cross (Cocoville, Louisiana), accepted the recommendation of the bishop and purchased a slave.23 The Madames (Religious) of the Sacred Heart had slaves at Grand Coteau, Louisiana, and in Missouri.24 There is correspondence from St. Philippine Duchesne requesting a slave from the Vincentians. The Sisters of Loretto of Bethlehem convent across the road from the Vincentians in Perry County, Missouri, also owned slaves.25 The owning of slaves led consequently to the involvement of religious in the purchase and sale of slaves. For the Sisters of Review for Religious Charity of Nazareth, the purchase of slaves in 1840 was an eco-nomic decision: "The Council decided it was better to buy ser-vants for the farm, and so forth, than pay so much for hire and then often get bad ones."26 When the Carmelites left Charles County for Baltimore in 1831, the disposal of their slaves was one of their difficulties. According to the Carmelite centennial histo-rian, the slaves became a source of anxiety because the sisters did not have the resources to grant them their freedom, so they gave them permission to seek their own masters. The sisters received whatever price the new master gave. Older slaves were left to the care of competent persons, and the sisters provided for their neces-sities until their deaths.27 The involvement in the sale of slaves by the Vincentians is documented in the previously mentioned study. The ownership of slaves led the Vincentians to become involved in the sale and purchase of slaves. There was an attempt t9 be faithful to church law. In a letter addressed to the Vincentian general in 1840, the American provincial, Father John Timon, explained that the"pur-pose of the increased buying of slaves was to bring families together. The Vincentians slowly phased out slaveholding during the 1850s and 1860s. Although personally opposed to slavery, Timon justified the decision to sell the slaves in terms of economic and political rather than moral factors. Freeing the slaves was not considered.28 The sale of the Jesuit slaves in Maryland caused great con-troversy. Some Jesuits sought to free the slaves and, in the pro-cess, change the labor force running their farms from slave to free. When the Jesuits were restored in 1814, the civil corpora-tion made a resolution to this effect in that same year; it was, however, never carried out. The Jesuits became embroiled in a dispute with Ambrose Marechal, the new archbishop of Baltimore, who had initiated claims against the Jesuit estates, arguing that they were meant to support the entire church in Maryland, not just the Jesuits.29 Any sales were delayed until the dispute could be settled. By the 1830s the new group of younger Jesuits was becoming uncomfortable with the estates and their status as slave owners. By this time, however, the climate in the country had changed and the policy of deferred emancipation became more difficult to fol-low. Older Jesuits, mostly Europeans, supported keeping the estates. Younger Jesuits, mostly Americans, wanted to sell them July-Augl~St 1999 Fitz ¯ U.S. Catholic Religious and Slavery and the slaves and concentrate on education. The older Jesuits argued that the slaves were a patrimony. Father Francis Dzierozynski wrote, "I consider the blacks under this respect only, that they are our sons, whose care and salvation have been entrusted to us by Divine Providence and who are always happy under our Fathers." For Dzierozynski and~others, the bond between the slaves and the Jesuits was not to be broken for finan-cial reasons. They argued that selling the slaves would lead to the slaves' physical and moral ruin and would give great scandal.3° In October 1836 the superior general approved the sale of the slaves with the condition that their religious needs must be met, families must not be separated (especially spouses), and the money must be invested for the support of Jesuits in training.31 In June, Father Thomas Mulledy, the provincial, sold the slaves to Henry Johnson of Louisiana. The main group of the slaves was sent to Louisiana in November 1838. Mulledy was denounced to the supe-rior general because some of the slave families were separated, and Mulledy was subsequently replaced. The change to tenant farming ended the Jesuit history as slaveholders. Clearly the young Jesuits who advocated sale of the slaves perceived correctly that owning slaves was scandalous. Their manner of handling the sale clearly violated the principles of the church concerning the sale and treatment of slaves, and they did not provide for their even-tual emancipation. This too wa~ a scandal. ~ In general, how did religious treat their slaves? In his study on American Catholics and slavery, Kenneth Zanca notes "that reli-gious orders treated their slaves more humanely than other slave holders and generally saw to their religious education--even in the defiance of state laws. To be a 'priest's slave' or a 'nun's slave' was considered a fortunate circumstance for a slave.''32 Although the slaves of religious may have been treated more humanely than other, slaves, problems persisted. Father Adam Marshall, the Jesuit charged with overseeing the plantations for the corporation, described the dwellings for the slaves as "almost universally unfit for human beings to live in." When possible, Jesuit brothers were given charge of the farms. Father .Peter Kenney, an Irish Jesuit, sent by the Jesuit superior general as a special visitor to evaluate the American mission in 1819, took exception to the arbitrary treatment of the slaves by the brothers. He found general disaffection among the slaves and particular abuses (for example, whipping pregnant women). He also found the Review for Religious behavior of the slaves scandalous and their practice of religion vir-tually nonexistent. Because of the poor financial condition of the Jesuits in general in the early 1820s, the living conditions of the slaves on most of the plantations were less than adequate. However, with new management the material conditions of the slaves seemed to improve by the 1830s. At St. Inigoes, the most thriving of the plantations, Father Joseph Carberry instituted a system of incentives for the slaves, which led to their economic improvement. Concerning their moral and spiritual condition, despite catech-esis and required attendance at Mass, Kenney found the slaves' lives to be a "moral wasteland and scandalous reproach to the Society" of Jesus. "Some Jesuits attributed the moral anarchy to the Society's own failure to discipline the slaves." 3 3 Some accounts about slaves owned by religious report a general affection by the slaves for their religious owners. At St. Catherine, Kentucky, this is how the ~rs~a~e laws. relationship between the Dominican sis-ters and their slaves is reported.34 When the sisters wanted to build a new chapel, some of the slaves who had come to the sisters as part of a dowry voluntarily offered to do without new clothes for a year so that the money might be donated to the chapel fund. Some slaves gave their earnings toward the project. Even after emancipation, some slaves remained with the sisters until their deaths.3s A report about the slaves owned by the Religious of the Sacred Heart indicates that they were "happy as possible in their snug little cabins" and were converted to the Catholic faith and the "love of the Sacred Heart that was the reason for Grand Coteau's existence.''36 An historian of the earlier Jesuit mission in the United States claims that dur-ing the Revolutionary War the slaves of the Jesuits could have abandoned the Jesuit plantations when British ships raided the plantations. The priests' slaves, unlike neighboring slaves, did not do so. The historian takes this as a sign of the slaves' devotion to their masters.37 There are, however, no accounts from the slaves themselves to confirm these impressions. Religious orders treated their slaves more humanely than other slave holders and generally saw to their religious education-- even in the defiance Ju~-dugltst 1999 Fitz * U.S. Catholic Religious and Slaver~ Ministry by Religious to Slaves Before the Civil War the Catholic Church in the South was small, poor, and understaffed. "Catholicism, in short, could not ade-quately minister to either the slave or the free blacks in the South ([whether] Catholic or non-Catholic), nor could Catholicism prac-tically enforce its own teaching on the proper treatment of slaves."3s The church was hesitant and ambivalent in most of its efforts to work among African Americans, whether slave or free.39 John Carroll was concerned about "a general lack of care in instructing their children and especially the Negro slaves in their religion.''4° Although local parish records indicate a high rate of baptisms among slaves throughout the antebellum period, "there is little evidence of high rates of slave identification with Catholicism in terms of attendance at Mass, marriage in the church, or other signs of Catholic activity and devotion.''4~ Despite this general lack of ade, quate ministry, religious provided some ministry to slaves. Most commonly, it was religious-order priests who provided for the slaves the celebration of the Sunday and holy day Eucharists and the celebration of baptism and marriage. The Vincentians and Capuchins ministered to slaves on the plantations in the Louisiana Territory.42 As noted earlier, the Jesuits provided sacramental min-istry for their slaves, both in Louisiana and Maryland, and for the slaves of Catholic masters in Maryland.43 A Jesuit mission band giving revivals on southern Maryland farms in the Jubilee Year 1851 also served slaves.44 Some religious priests tried to protect slaves from abuse. In 1791, for example, Capuchin Father Joaquin de Portillo ordered slaves to stop working on a holy day of obligation and reported the incident to the Louisiana Eovernor because work on a holy day was a violation of the slave code in the colony.~s In general, religious catechized their slaves and sometimes provided them basic education. As mentioned earlier, the Jesuits taught catechism to their slaves. Religious women catechized and educated black slaves, especially children.In a letter of 1856, Mother Hyacinth indicates that they educated their slave named Simon.46 There is evidence that the Visitation Sisters educated free black girls, and this tradition may have "its origins in the instruction given to their slaves.''47 Bishop England founded the Sisters of Our Lady of Mercy in Charleston, South Carolina, for the purpose of establishing a school for "free colored girls, and to give religious instruction to female slaves.''~s A letter of St. Elizabeth Ann Seton provides evidence of catechetical work among African American children.49 The Daughters of Charity organized classes to teach religion to their slaves,s° The Ursulines in New Orleans also catechized slaves,s| Two religious orders of African American women were founded to educate and catechize African American children. "To work for the Christian education of colored children," four Haitian refugees founded the Oblate Sisters of Divine Providence, "a Religious Society of virgins and widows of color." They provided education for African American children who had no other possi-bilities. Some children they educated may have been slave chil-dren, although that is not clear from the sources,s2 Supported at first by the Sulpicians in the person of Father James Joubert and later by the Redemptorists under the direction of Father Thaddeus Anwander, who was influenced by Father John Neumann, the sis-ters went about their mission under difficult circumstances includ-ing years of neglect and hardship. They continued a school in Baltimore that several of the sisters had started before ~their orga-nization as a religious congregation in 1829. The other religious community of African American sisters, the Sisters of the Holy Family, was founded in New Orleans for the purpose of serving and educating the poor. Before she founded the community, Henriette DeLille had entered into the work of teaching religion to slaves,s3 Although much of their educational work and service ministry was with poor free African Americans, they also did catechetical work among the slaves,s4 Care of slaves was also part of the outreach ministry of women religious. The Sisters of the Holy Family, prompted by the wretched condition of old, abandoned slaves; opened a home for the aged.ss The Hotel Dieu, run by the Daughters of Charity in New Orleans, had a slave department that had special rates and "superior advantages" for members of this class,s6 Attitude of Religious toward the Institution of Slavery and toward Slaves Slavery The attitude of religious in the United States toward slavery tended to mirror the attitude of United States Catholics in general. No religious and no Catholic occupied the' forefront of the aboli-tionist movement. ~uly-August 1999 Fitz ¯ U.S. Catholic Religious and Slavery There are, however, records of individual religious who were opposed to slavery. A Sulpician, Father Louis-Regis Deluol, and a Vincentian, Father John Timon, are two examples. In a letter to Charles Carroll's granddaughter, Deluol wrote that his feelings were most violently opposed to slavery. In the same letter, though, he indicated that he did not see slavery as opposed to divine or ecclesiastical law.57 Timon, the Vincentian superior of the American mission who was responsible for ending Vincentian involvement in slavery, accepted the bishopric of Buffalo, New York, because he feared he might be named coadjutor of Bardstown. Timon "would have intensely disliked that appointment because Negro slavery obtains in the state of Kentucky."58 Opposition to slavery did not, in general, lead religious to participate in the abolitionist move-ment or to the manumission of slaves. There were religious who supported slavery. Father John Ryder SJ, of Georgetown University, addressing an audience in Richmond in 183 5, defended slavery "as a positive benefit to the slav.e, while arguing that abolitionism was incompatible with Catholicism."59 One of the most prominent Catholic figures of the 19th cen-tury was Isaac Thomas Hecker, a convert to Roman Catholicism, a religious, and the founder of the Paulists. Oversimplifying, one can say that Hecker saw as his task the adaptation of the Roman Catholic Church to America, "proving to Catholics that their coun-try was not Protestant at its ideological roots, .and to Protestants that Catholics were not inherendy anti-democratic." Like his men-tor Orestes Brownson, Hecker saw Roman Catholic natural-law theory as a stronger grounding for democracy than Protestantism or Lockean liberalism. Hecker's dream of America's conversion to Catholicism never materialized.6° At the time of the Civil War, Hecker was laying the founda-tions of the Paulist community. In his writings and letters he hardly mentions the raging political issues of slavery and expansion.6~ In a sermon written in April 1861 b~t apparently never delivered, Hecker was convinced that the "root of the problem between the states was a lack of common religion.62 In a series of articles before the war, Hecker had written that the Catholic Church was friend of both master and slave. He had cohtrasted the Catholic Church, which supported union and reconciliation, with the fanatic and divisive Protestant abolitionists. I-Iecker saw the war as a perfect example of how the Catholic Church would have prevented hos- Review for Religious tility. "Slavery, under the benign influence of Catholic principles and legislation, voluntarily and insensibly disappears, just as serf-dom was made to give way to modern society without violence or bloodshed." Hecker hoped that the Civil War would lead the coun-try to see the value of Catholicism.63 On the issue of slavery itself, Hecker held views conventional for a Roman Catholic of his day. There is evidence of his views in correspondence with Jane Sedgwick, a convert and friend in Stockbridge, Massachusetts, in the spring of 1861. Hecker's letter to Sedgwick no longer exists, but her response indicates her dis-agreement with his defense of servitude under certain conditions. We have no record of Hecker's response to her questions and argu-ments. "Once the war came, Hecker told friends he had always been opposed to slavery; he even told Bishop Lynch of Charleston that he regarded the war as a punishment of the South for its evils.''64 One of his biographers, David O'Brien, quotes a passage from a letter of September 1861 : The sentiment of loyal Americans whether Catholic or not is getting always [more] and more strong and united every day against slavery and without any change of principle. We have always taken the ground that it is an evil and a disgrace which might be tolerated for a time, but ought to be grad-ually abolished. The Constitutional rights of the states for-bade, however, any direct meddling and made it our duty to protect the institution of slavery against unjust aggression. Now, however, since slavery is so destructive of national prosperity, and the South by its rebellion has forfeited all claim to the forbearance of the North, we think the time will soon come to expel slavery from our entire country.65 Slaves Attitudes toward slaves among religious are similar to those held by other white Catholic Americans. Although some English Protestants held the view that Negroes were incapable of baptism because they were not strictly human, Catholics did baptize slaves when the occasion presented itself, especially when the slaves were their own.6. Father George Hunter, a Jesuit, reminded masters of their duty to treat slaves with charity. "As they are members of Jesus Christ, redeemed by his precious blood, they are to be dealt with in a charitable, Christian, paternal manner; which is at the same time a great means to bring them to do their duty to God, and therefore to gain their souls.".7 Although seen as human, slaves were often treated and described in condescending and paternal- July-August 1999 Fitz * U.S. Catholic Religious and Slavery istic terms. The treatment of slaves as property (moving them from one place to another) manifests the failure of religious to treat slaves as fully human. The language of religious also por-trayed their condescending attitudes toward slaves. Father Joseph Mosley SJ, who came to Maryland at the time of the Jesuit sup-pression in 1773, wrote to his sister the following year: "They ['the Negroes'] are naturally inclined to thieving, lying, and much lechery. I believe want [poverty] makes them worse thieves and liars, and the innate heat .of the climate of Africa and their natu-ral temper of constitution gives them a bent to lechery.''6s Another Jesuit, Brother Mobberly, who managed St. Inigoes from 1806 to 1820, felt that a lack of discipline was the root of the slaves' prob-lems. He developed a racial theory of African subservience.69 Mobberly wrote in his diary: "The better a Negro is treated, the worse he becomes." With this attitude, there is little wonder that Mobberly was removed a month after the visit of Father Kenney in 1820.70 Against the background of slavery, Vincentian lay brothers felt and caused some difficulty within their congregation. "The broth-ers resented the implicit identification of their work with that of slaves and were increasingly reluctant to do certain types of labor, perhaps under the influence of American attitudes." Like many white laborers, the lay brothers disliked doing the kind of work slaves did, considering it degradation. Father Rosati, one of the Vincentian superiors, struggled with the duplicity he saw in the lay brothers: they did not want slaves, but refused to do the work that the slaves were hired or bought to do.71 Some religious felt compassion for the slaves, although this compassion did not always lead to action. Mother Theodore Guerin, who founded the Sisters of Providence of Saint Mary-of-the-Woods in Indiana, wrote the following in her journal about her trip to New Orleans: The most painful sight I saw in New Orleans was the selling of slaves. Every day in the streets at appointed places, Negroes and Negresses in holiday attire are exposed for this shameful traffic, like the meanest of animals at our fairs. This spectacle oppressed my heart. Lo! I said to myself, these Americans, so proud of their liberty, thus make game of the liberty of others. Poor Negroes! I would have wished to buy them all that I might say to them, "Go! Bless Providence. You are free." But such feelings must be concealed from the Louisianians, as this is a point on which they are very sensio tire.72 Review for Religious The Vincentian Father DeAndreis also felt compassion toward the slaves. In a letter of 1819 to the Vincentian community at Monte Citoria, he wrote: .With regard to the situation of the blacks and mulattoes, these are for the most part slaves, who are condemned to eat the bread of sorrow and to bear pondus diei et aestus [the burden of the day and the scorching heat (Mt 20:12)] and, what is worse, in their harsh condition to serve the passions of others and to be in the moral impossibility of knowing and practicing religion. They are commonly forbidden to contract marriage because of the loss that their masters would suffer as a result, something that exposes them to a thou-sand dangers. For the rest these natives of Africa are for the most part simple and disposed to profit by the labors that are undertaken for their salvation. They are moved at seeing a white priest interested in them since they are regarded as the offscouring and refuse of the human race. How many subjects of consolation do not these poor creatures offer me! They are instructed, they make their first communion, and then they frequent the sacraments.73 DeAndreis's writing flowed from personal experience. After arriving in St. Louis in 1818, he made the African Americans of the city an object of his special ministry. His friend Joseph Rosati, who became the first bishop of St. Louis, recollected that people were astonished at seeing a scholar applying himself to this min-istry with special ardor and dedication.74 Conclusion Several general trends can be drawn from this study of American religious and slavery. Like their fellow Catholics, some American religious owned and sold slaves and became entangled in the control and supervision of slaves. Although some commenta-tors indicate that, in general, religious treated their slaves better than .other slave masters, there are few slave witnesses to verify this perception. Religious provided sacramental ministry and edu-cation (mostly catechetical) to their slaves and to the slaves of other Catholic masters. Religious also provided limited social ser-vices to slaves. With regard to the institution of slavery, American religious mirrored American Catholics in general. They did not see slav-ery as intrinsically wrong. If they opposed slavery, they were for gradual emancipation. Although they saw slaves as human, slaves 3%dy-August 1999 Fitz ¯ U.S. Catholic Religious and Slavery were often described in condescending and racist terms. Some compassion was shown, but this did not often lead to action or a desire to eliminate the institution. As an historical account, this article could end at this point. But should more be said? Is there anything we, as religious living near the end of the 20th century, might learn from our forebears in the faith as we grapple with social-justice and social-transformation issues in the world today? There are several important lessons. A first lesson might be a challenge for us as religious to exam-ine more critically our relationship to culture. As religious, we are called to be prophetic. Hopefully, our words, actions, and lives will perform at least two prophetic functions: criticize the existing sinful and unjust social consciousness and energize the world by embodying an alternative way to live that brings hope.7s This prophetic witness can be greatly compromised if we live com-pletely apart from the culture. Conversely, if we are so immersed in the culture that we do not see injustices, and in fact participate in them, our actions become a source of scandal. American reli-gious quickly adapted to the American experience of slavery. Was this an example of being too immersed in the culture to be truly prophetic to it? Were some religious so much outsiders (for exam-ple, Catholic, French extraction, unmarried women) that criticism was muted in order not too offend? The experience of slavery of American religious in the 19th century can challenge religious today to look at our present culture. Are there structures in which we are so immersed that we fail to see injustice present? Are there unjust structures that we are afraid to challenge because the chal-lenge might cost us personally or communally? Are we alert and attentive to the structures of culture that may need prophetic chal-lenge and a witness to :an alternative way? For international institutes, these same questions may be asked concerning new implantations in other cultures. What aspects of the new culture should be accepted as compatible with and expres~ sive of gospel values? What aspects are unjust and need to be opposed? As the first religious in America quickly adapted to the institution of slavery, are there aspects of other cultures to which we are easily adapting without critical thought? These are not easy questions, but they are important if we are to be faithful to our prophetic witness. Second, the slavery issue can be a lesson in listening to and evaluating the message of another. Catholics, including religious, Review for Religqous did not listen to the abolitionists because a significant group of abolitionists was anti-Catholic as well (though this was not true of all of them). Although abolitionists may have been wrong in their anti,Catholicism, they were prophetic in their respect for the dignity of African Americans. In our own day the truth may be proclaimed by someone with whom we have little in common or with whom we disagree on significant issues. Truth can come from anywhere, and we need to hear the truth whether it comes from friend or foe, compan-ion or opponent. Are we today open to the truth, from whatever source? Have we stopped listening to some group where the truth may be present, even in the midst of error? A third lesson concerns the development of doctrine in the history of the Catholic Church. In the area of social justice and trans-formation, there are significant examples of this development. The institution of slavery, once considered a moral way to treat individuals, is now considered immoral. Reflection over the years has helped the church come to a new understanding of the implications of the reign of God as Jesus proclaimed it. As the early church struggled with the issue of accepting Gentiles into the church, so American Christians of the 19th century grappled with the implications of the gospel in terms of slavery. Statements made by bishops over a hun-dred and fifty years ago have been reversed by bishops in our own day. What was once considered not intrinsically wrong is now con-sidered a crime against human dignity. This development of doc-trine, therefore, can be a source of hope as we grapple with new justice issues today. As we deal with right-to-life issues (think of abortion and capital punishment), dignity-of-women issues, and other such issues, what appears as a small glimmer of light (even a light from outside the church) may be the source of new insight and a new living of the reign of God in future generations. A call for change, for which there may be little'support now, may gain considerable support as time passes. Religious in the United States have been called by the church to commit themselves to social justice and social transformation. We have chosen to commit ourselves to these values. Although the story of American religious involvement in and response to Are there structures in which we are so immersed that we fail to see injustice present ? ~uly-August 1999 Fitz * U.S. Catholic Religious and Slavery the institution of slavery in this country is not one of the glorious moments in our history, we can hope that the experience of our forebears in dealing with this issue may bring light and insight to our present-day struggle to discern the call of the Spirit in our world. Notes ~ I am using Austin Flannery's translation of the tide of this document, which has elsewhere been called "Religious and Human Promotion." The document was issued by the congregation in January 1981. See Origins 10, no. 34 (5 February 1981): 529-541. 2 House Concurrent Resolution 96, Congressional Record, 1997, H3890-3891. 3 A term I have borrowed from Kenneth M. Stamp, The Peculiar Institution: Slavery in the Ante-Bellum South (New York: Vintage Books, 1956). 4 R. Emmett Curran, "'Splendid Poverty': Jesuit Slaveholding in Maryland, 1805-1838," in Randall M. Miller and John L. Wakelyn, eds., Catholics in the Old South: Essays on Church and Culture (Macon, Georgia: Mercer University Press, 1983); Stafford Poole CM and Douglas J. Slawson CM, Church and Slave in Perry Country, Missouri, 1818-1865 (Lewistown, New York: Edwin Mellen Press, 1986). s Kenneth J. Zanca, ed., Amen'can Catholics and Slavery, 1789-1866: An Anthology of Primary Documents (Latham, Maryland: University Press of America, 1994), pp. xxxi and 37-39. 6 Madeleine Hooke Rice, American Catholic Opinion in the Slavery Controversy (Gloucester: Peter Smith, 1964), p. 21. 7 John Francis Maxwell, Slavery and the Catholic Church: The History of Catholic Teaching concerning the Moral Legitimacy of the Institution of Slavery (London: Barry Rose Publishers, 1975), pp. 101-110. 8 David J. O'Brien, Public Catholicism, 2nd ed. (Maryknoll: Orbis Books, 1996), p. 65. See also Rice, American Catholic Opinion, pp. 80-85. 90'Brien, Public Catholicism, p. 53. ,0 Rice, American Catholic Opinion, p. 85. ii Zanca, American Catholics, pp. 134-139. This is an article from Brownson 's Quarterly Review. 12 Zanca, American Catholics, p. 200. See also Joseph D. Brokhage, Francis Patrick Kenrick's Opinion on Slavery (Washington, D.C.: Catholic University of America Press, 1955), pp. 122-124. 13 Zanca, American Catholics, pp. 201-209. This is a sermon preached by Verot in 1861. ~ Zanca, American Catholics, p. 136. ts Cyprian Davis, The History of Black Catholics in the United States (New York: Crossroad, 1990), p. 35. Review for Religious ,6 Curran, "Splendid Poverty," p. 126. 17 Poole and Slawson, Church and Slave, pp. 180-181. ~8 Christopher J. Kauffmar~, Tradition and Transformation in Catholic Culture: The Priests of Saint Sulpice in the United States from 1791 to the Present (New York: Macmillan Publishing Company, 1988), p. 146. See also Poole and Slawson, Church and Slave, p. 143. 19 Poole and Slawson, Church and Slave, pp. 144-158 and 162. 20 Barbara Misner, Highly Respectable and Accomplished Ladies: Catholic Women Religious in America, 1790-18~0, Vol. 22 of The Heritage of American Catholicism, ed. Timothy Walch (New York: Garland Publishing, 1988), pp. 75 and 76. See also Mary Ewens OP, "The Role of the Nun in Nineteenth-Century America: Variations on the International Theme" (Doctoral diss., University of Minnesota, 1971), p. 38. 2t Roger Baudier, The Catholic Church in Louisiana (New Orleans, 1939), pp. 89, 108-109, 115-116, 131-132,139, 202. 22 Sister Frances Jerome Woods, "Congregations of Religious Women in the Old South," in Catholics in the Old South: Essays on Church and Culture, ed. Randall M. Miller and Jon L. Wakelyn (Macon, Georgia: Mercer University Press, 1983), p. 112. 23 Woods, "Congregations,,' p. 113. See also Ewens, "Role of the Nun," p. 22. 24 Woods, "Congregations," p. 114. See also Ewens, p. 64, and Davis, History, p. 39. 2s Poole and Slawson, Church andSlave, pp. 171 and 172. 26Misner, Highly Respectable, p. 82, quoting from an archival record. 27Misner, Highly Respectable, p. 77. 28Poole and Slawson, Church and Slave, pp. 186-189. 29Curran, "Splendid Poverty," pp. 134-135. 30Curran, "Splendid Poverty," pp. 138, 140, 141. ~ Curran, "Splendid Poverty," p. 142. 32 Zanca, American Catholics, p. 111. ~3 Curran, "Splendid Poverty," pp. 129, 130, 132. 34 V~Zoods, "Congregations," p. 114. ~5 Misner, Highly Respectable, p. 84, and Woods, "Congregations," p. 114. The two authors seem to be using a common source, Commemorative booklet for American Bicentennial (St. Catherine, 1976). 36 Woods, "Congregations," p. 114, quoting from Margaret Williams, Second Sowing: The Life of Mary Aloysia Hardey (New York, 1942), p. 103. 37 Thomas Hughes SJ, History of the Society of ffesus in North America, Colonial and Federak Text, From 164Y till 1773, Vol. 2 (London: Longmans, Green, and Co., 1917), p. 565. ~8 Michael McNally, "A Minority of a Minority: The Witness of Black July-August 1999 Fitz ¯ U.S. Catholic Religious ~nd Slavery Women Religious in the Antebellum South," Review for Religious 40, no. 2 (March 1981): 261. 39 Margaret Susan Thompson, "Philemon's Dilemma: Nuns and the Black Community in Nineteenth-Century America: Some Findings," in The American Catholic Religious Life: Selected Historical Essays, ed. Joseph M. White (New York: Garland Publishing, 1988), p. 83. 40 John Carroll, "The First American Report to Propaganda on Catholicism in the United States, March 1, 1785," in Documents of American Catholic History, Vol. 1, 1493 to 186~, ed. John Tracy Ellis (Wilmington: Michael Glazier, 1987), p. 149. 4~ Randall M. Miller, "The Failed Mission: The Catholic Church and Black Catholics in the Old South," in Miller and Wakelyn, Catholics in the Old South, p. 152. 42 Baudier, Catholic Church, pp. 76-77. 43 Baudier, Catholic Church, pp. 139, 161. The Capuchins provided ministry to slaves in Louisiana. A dispute arouse between the Jesuits and the Capuchins over whether the Jesuits, who were assigned to the Indian missions, had jurisdiction and could minister to their own slaves (see Baudier, pp. 115-116). ~4 Edward E Beckett SJ, "Listening to Our History: Inculturation and Jesuit Slaveholding," Studies in the Spirituality of Jesuits 28, no. 5 (November 1996): 15. 4s Baudier, p. 213. 4~ Woods, "Congregations," p. 113. 47 Misner, Highly Respectable, p. 203 48 Misner, Highly Respectable, pp. 204-205. 49 Zanca, American Catholics, p. 143. ' 50 Woods, "Congregations," p. 112. s~ Baudier, Catholic Church, p. 183. 52 Sister M. Reginald Gerdes OSP, "To Educate and Evangelize: Black Catholic Schools of the Oblate Sisters of Providence (1828-1880)," U.S. Catholic Historian 7, nos. 2 and 3 (Spring/Summer 1988): 183-199. s3 Woods, "Congregations," p. 115. 54 Davis, History, pp. 105-I10. See also Woods, "Congregations," p. 116, and Baudier, Catholic Church, p. 397. 55 McNally, "Minority," p. 264. ~6 Woods, "Congregations," p. 113, and Baudier, p. 396. Baudier is quoting from the silver-jubilee booklet of the Hotel Dieu School of Nursing in 1927. 57Kauffman, Tradition and Transfomnation, p. 146. 58 Poole and Slawson, Church and Slave, p. 179. 59 Beckett, "Listening to Our History," p. 45, fn. 186. 60 Edward J. Langlois, "Isaac Hecker's Political Thought," in Hecker Review for Religions Studies: Essays on the Thought of Isaac Hecker, ed. John Farina (New York: Paulist Press, 1983), pp. 51 and 66. 6, David J. O'Brien, Isaac Hecker: An American Catholic (New York: Paulist Press, 1992), p. 191. 62 Langlois, "Isaac Hecker's Political Thought," p. 68. See also p. 85, fn. 36. 63 Hecker's sermon, quoted in Langlois, p. 69. 64 O'Brien, lsaac Hecker, p. 192. 6s O'Brien, Isaac Hecko; p. 192. 66Zanca, American Catholics, p. 113 67Hughes,.History, Vol. 2, p. 559. 68Zanca, American Catholics, pp. 1 I3-114. 69Beckett, "Listening to Our History," p. 2 I. 70Curran, "Splendid Poverty," p. 133. 7~ Poole and Slawson, Church and Slave, pp. 156-157. 72 Zanca, American Catholics, p. 117. 73Poole and Slawson, Church and Slave, pp. 145-146. ~4 Poole and Slawson, Church and Slave, p. 147. 75 For further development of the concept of religious life as acted prophecy, see my article "Religious Life as~Acted Prophecy," Review for Religious 41, no. 6 (November-December 1982): 923-927. I Will I will survive even though I have doubts and fears, I will survive when my eyes are full of tears, I will go on with faith in God's hands I will trust my Jesus for I know he understands. Janice Barham July-August 1999 RITA E. GOLDMAN Edith Stein: St. Teresa Benedicta of the Cross OCD witness We might begin by asking ourselves, who is Edith Stein? First and foremost, she is a woman, a Jewish woman, student, nurse, scholar/philosopher, teacher, Carmelite nun, and confessor/martyr saint. She was inscribed in the calendar of saints on 11 October 1998, having been beatified at Cologne, Germany, on 1 May 1987. On the last few pages of her work On the Problem of Empathy, she has left us a short biographic sketch. She writes: "I, Edith Stein, was born on 12 October 1891 in Breslau, the daughter of the deceased merchant Siegfried Stein and his wife, Auguste, n~e Courant. I am a Prussian citizen and Jewish." She tells us that, in the year she was born, 12 October was the greatest Jewish holy day, Yom Kippur, the Day of Atonement. Her mother, a devout Jew, always considered this a great blessing, having her last child on the Day of Atonement. Edith was the youngest of eleven children, of whom only seven sur-vived. Her mother was widowed twenty-one months after Edith was born. She tells of where she went to school and then of beginning the study of philosophy, to be interrupted in 1916 when she served with the Red Cross during the Rita E. Goldman wrote "Frances Cabrini: A Woman for Today" for our November-December 1996 issue, Her address is 3041 North Country Club Road, Apartment 220; Tucson, Arizona 85716. Revie~v for Religious First World War. After the war she became a teacher at a girls' secondary school in Breslau. Later she began work on her doc-torate in phenomenology, becoming an assistant to Edmund Husserl. In 1917 she was asked by the widow of her former teacher Adolf Reinach, who had died at the front, to help put her hus-band's papers in order. Frau Reinach was a devout Christian; and it was from her influence that Edith began to move toward the Christian faith. In the summer of 1921 she read the autobiography of St. Teresa of Avila, the great Carmelite mystic of the 16th cen-tury. "This," she concluded, "is the truth." She was baptized on New Year's Day 1922. After her baptism Edith spent the next eight years teaching German and literature at St. Magdalena's, a teacher training insti-tute run by the Dominican Sisters at Speyer. During this time she continued her philosophic interests, writing a two-volume study of the philosophy of St. Thomas Aquinas. She tried to obtain a pro-fessorship at Freiburg, but was refused because she was a woman. Though she was later to be barred from publishing and lecturing because of being Jewish, at this time she traveled extensively to give lectures in places as varied as Munich, Vienna, Prague, Juvisy (near Paris), and Zurich. In 1932 she accepted a teaching post at the German Institute for Scientific Pedagogy in MOnster. The following year she was denied her lectureship under a Nazi decree aimed at Jews. In October 1933, on the Feast of St. Teresa of Avila, Edith entered the Carmel at Cologne. When the situation in Germany became very bad for Jews, Edith was transferred to the Carmel at Echt, in Holland. But this move did not save her, and in August 1942 she and her sister Rosa were arrested and deported. She died at Auschwitz, on or near 9 August 1942. What I have said above is a general outline of Edith Stein's life, but I think we are more concerned with her thought, what led her to become a Catholic, what called her to become a Carmelite nun, than with the externals of her life. At the age of fifteen, Edith decided she did not believe in God. When she was twenty-four, during her study of phenomenology, a flicker of faith began to catch her ey.e. Then came her contact with Frau Reinach and her reading of the life of St. Teresa of Avila. In St. Teresa's response to Christ's love, Edith found the answer she had sought. She decided to follow Christ's invitation and enter July-Augtlst 1999 GoMman ¯ Edith Stein the Catholic Church. (Even at that time Edith was strongly aware that an attraction to live out her baptismal commitment as a mem-ber of the Discalced Carmelite Order and as a daughter of St. Teresa was inseparable from her resolve to enter the church.) Edith bought a catechism and a missal, studied them thor-oughly, then went to her first Mass in the parish church of Bergzabern, celebrated by the pastor, Monsignor Breitling. Finding that she had no difficulty in following the Mass, she approached Monsignor Breitling afterwards and asked for baptism. The sur-prised pastor told her that there is usually an extended period of preparation before someone is received into the church. But Edith would not relent and asked that he examine her right then on the truths of the faith. The "examination" went so well that her bap-tism was set for the coming New Year's Day. Edith began attend-ing Mass daily--it became the center of her spiritual life. During the years she taught at St. Magdalena's, she was remembered as a teacher who was "modest and unassuming., she went about her work pretty much unseen and unheard, always friendly and ready to be of help." As one student wrote of her rec-ollections of Edith Stein: "Actually, she gave us everything. Though we were all very young at the time, none of us has ever been able to forget the spell that her personality exerted. Her manner alone made her a model for us at that critical time. There's not a single remark of hers that I can repeat--and it isn't that her comments were not memorable, but that she was a quiet, untalkative person who could influence us simply by who she was." These words reflect what Edith herself said of her teaching. She regarded edu-cation as a form of apostolate and generously devoted herself to all the needs of her students. When in 1932-1933 Edith could no longer teach or publish because of the situation in Germany, she at last received permis-sion to enter the Cologne Carmel. This was something she had wanted to do since the day she was baptized, and now it was to be fulfilled. From 16 July to 15 August 1933, she lived in the extern guest quarters at the C.ologne convent while getting acquainted with the sisters. After" that she spent several months in Breslau doing all she could to make her leave-taking easier on her family before her entrance into Carmel on 15 October, the feast of St. Teresa. For six months she was a postulant, being admitted to the novitiate on 15 April 1934. At this time she received her name in religion, Sister Teresa .Benedicta of the Cross. She had taken the Review for Religious name of Teresa at the time of her baptism and took the name Benedicta of the Cross--blessed by the cross--which was her great devotion. She took the name Benedicta also in honor of St. Benedict, since she had been the spiritual child of Archabbot Walzer, who was the abbot at Beuron, the monastery where she had spent much time. In 1935 on Easter Sunday she pronounced her first vows of poverty, chastity, and obedience and three years later, on 21 April 1938, she made her final solemn profession. Life in the monastery was for Edith very different from what she had experienced in the world. She was forty-two years old, and the other novices were in their twenties. She was not accus-tomed to housework and made all kinds of mistakes. The novice mistress had been a bit worried at first when she heard she would have to teach a scholar, but Edith was so amiable and eager to learn that the novice mistress forgot her nervousness. Another thing, her time was not her own--and was very much regulated by bells. After the novitiate, however, much of her assigned work was of an intellectual nature. She revised some of the things she had written while at Speyer. Some of her writings during this period are published in The Hidden Life. At times she also served as receptionist (at the "turn" and on the telephone) and as infirmarian. On 31 December 1938 she was driven across the border to the Carmelite monastery at Echt in Holland. Since Kristallnacht (8 November 1938), Edith had thought it best not to endanger the Cologne Carmel any longer with her presence. Sister Teresa Benedicta spent only a little over three years in the Echt Carmel. During this time she suffered greatly, not know-ing what was happening to her family. Some of her brothers and sisters were able to emigrate to America, but several were not per-mitted to go. Her sister Rosa was with her, having become a Catholic after the death of their mother in 1936. Edith's letters at this time express a central theme: Do everything you can to give joy to others; let God guide you without resistance; fill up She had taken the name of Teresa at the time of her baptism and took the name Benedicta of the Cross-blessed by the cross - which was her great devotion. July-Augv~st 1999 Goldman ¯ Edith Stein the emptiness of your heart with love of God and neighbor. In 1939 she composed her final testament. It reveals more than anything else her conscious acceptance of her particular mis-sion. I quote from the concluding lines: I joyfully accept in advance the death God has appointed for me, in perfect submission to his most holy will. May the Lord accept my life and death for the honor and glory of his name, for the needs of his holy Church (especially the preservation, sanctification, and final perfecting, of our holy order, and in particular for the Carmels of Cologne and Echt), for the Jewish people, that the Lord may be received by his own and his kingdom come in glory, for the deliverance of Germany and peace throughout the world, and finally for all my relatives living and dead and all whom God has given me: may none of them be lost. In late July 1942 the Dutch bishops issued a pastoral letter that was read in all the Catholic parishes of the Netherlands con-demning the deportation of Jews. One week after the bishops' pas-toral letter, on 2 August 1942, the Nazis in a single sweeping operation rounded up all Jewish Catholics, among them Edith and Rosa Stein. On 6 August Edith and Rosa and many other Jewish Catholics were at Westerbork awaiting deportation to the "east." The destination was Auschwitz, where it is believed both Edith and Rosa were executed on 9 August. When the church canonizes someone, it is in essence saying that it is safe to imitate this person. In putting its final approval on Edith Stein by declaring her a saint, the church says to us that we cannot go wrong if we incorporate into our lives the ideals that she professed. Edith Stein gave much to our world by her life and death, and now that she is ranked among the saints in heaven, she is still able to give to us by her example and prayers. I think Edith Stein could easily be the patron saint of academics, school teach-ers, and certainly single people living in the world, since this was her life before she entered Carmel. We may not be called upon to give our lives for our faith, but there are endless possibilities of our practicing virtue as exemplified in Edith Stein's life. First of all, she was a modern woman, one who lived in the world, made her living, and when time permitted spent many hours at home with her family--remember she came from a large fam-ily and her mother died in her eighty-seventh year in 1936. She is a 20th-century woman, one who had a deep regard for the voca-tion of women in our world. I point out her book on woman, Review for Religions where she brings out the vocation of women, their education and professionalism, their life not only in the church, but in civic and national life as well. She had experienced exclusion from a pro-fessorship because she was a'woman--Edith Stein could easily be the patron saint of the feminist movement of our day. Edith Stein is a model for our prayer life. Even from the time before her baptism, daily Mass was on her agenda, and she was very familiar with the other official prayer of the church, the Divine Office, the Breviary, now called the Liturgy of the Hours. She often went to the Benedictine abbey at Beuron and participated in the choral praying of the Liturgy of the Hours. Being there for Holy Week services was something she anticipated yearly. Besides Mass and Office, she was accustomed to spending several hours daily in private prayer before the Blessed Sacrament. She had a great familiarity with Scripture and quotes it often in her letters. Before she entered Carmel, she would accompany her mother to the synagogue and pray the psalms in Latin that her mother was praying in Hebrew. Even in her busy life of teaching, writing, counseling students, giving lectures, and so forth~ she always found time for prayer. I hope that this brief sketch provides some insight into this new saint of ours, one who is very aware of our times. Edith Stein is being proclaimed a martyr and a confessor. At the homily of her beatification, Pope John Paul II declared: "In the extermina-tion camp She died as a daughter of Israel 'for the glory of the Most Holy Name' and, at the same time, as Sister Teresa Benedicta of the Cross, literally, 'blessed b~ the cross.'" The "cause" of her martyrdom, the pope said, was the Dutch bishops' letter of protest against the deportation 6f the Jews. But, he added, because of her great desire to unite with the sufferings of Christ on the cross, she "offered herself to God as a 'sacrifice for genuine peace' and above all for her threatened and humiliated Jewish people." Prudently he left unmentioned her desire to atone for Jewish "unbelief." To many Jewish people the canonization of Edith Stein is an affront. What about the six million Jews who were exterminated and are not saints in the Catholic sense? In my opinion Edith Stein is a Catholic saint who iust happened to have Jewish origins, some-thing she was especially proud of after she came into the church. Edith Stein is a model for our prayer life. July-August 1999 Goldman ¯ Edith Stein Perhaps it is also a mystery. In my own life, being Jewish and Catholic has been a great grace. I have always said that I did not really convert, but just kept going on. Judaism is the beginnings of Christianity, and my own beginnings have been fulfilled in my life. I am sure Edith Stein looked at this in the same way. I close this brief essay with the prayer from the Mass of St. Edith Stein, whose feast will be celebrated.on 9 August: Lord God of our ancestors, you brought St. Teresa Benedicta to the fullness of the science of the cro~s at the hour of her martyrdom. Fill us with that same knowledge; and, through her intercession, allow us always to seek after you, the supreme truth, and to remain faithftil until death to the covenant of love ratified in the blood of your Son for the salvation of all. Grant this through Christ our Lord. Amen. Select Bibliography Works by Edith Stein: Collected Works of Edith Stein. Washington, D.C.: ICS Publications¯ Vol. I: Life in a Jewish Family. Trans. Josephihe Koeppel OCD. Vol. 2: Essays on Woman. Trans. Freda M. Oben PhD. Vol. 3: The Problem of Empathy. Tians. Waltraut Stein PhD. Vol. 4: The Hidden Life. Trans. Waltraut Stein PhD Vol. 5: Self-Portrait in Letters 1916-1942. Trans. Josephine Koeppel OCD. Edith Stein: Selected Writings, ed. Susanne M. Batzdorff. Springfield, Illinois: Templegate Publishers, 1990. On the Problem of Empathy (Zum Problem der Einfiihlung). Trans¯ Waltraut Stein. The Hague: M. Nijhoff, 1964. The Science of the Cross (Kreuzewissenschaf~). Trans. Hilda Graef. Chicago: Regnery, 1960. "Ways to Know God" (Wege der Gotteserkenntnis). Trans. M. Rudolf Mlers. The Thomist, July 1946. Works about Edith Stein: Batzdorff, Susanne M. Aunt Edith: The Jewish Heritage of a Catholic Saint. ~Springfield, Illinois: Templegate Publishers, 1998. Graef, Hilda. Writings of Edith Stein. Westminster, Maryland: Newman Press, 1956. Herbstrith, Waltraud. Edith Stein: A Biography. San Francisco: Harper and Row, 1985¯ ¯ Never Forget¯ Washington, D.C.: ICS Publications, 1998. Oben, Freda Mary, PhD. Edith Stein: Scholar, Feminist, Saint¯ Staten Island: Review for Religious Alba House, 1988). Oesterreicher, John M. Walls Are Crumbling. London: Hollis and Carter, 1953. Pp. 288-329. Woodward, Kenneth L. Making Saints: How the Catholic Church Determines Who Becomes a Saint, Who Doesn't, and Why. New York: Simon and Schuster, 1990. Pp. 135-144. Also articles in various periodicals such as America, London Tablet, Spiritual Life, and Carmelite Digest. In Passing In the morning when Jesus walked with the disciples by his side, he encountered the wildflowers, the grains of wheat caught by the breeze, and the songbirds that greeted him with their unending hosannas. Now as I stroll past the flowers , their colors brightening my path and the trees 'beckoning to me to partake of the lilting songs of birds hidden in their branches, I recall all Jesus said and did as he walked the roads of this life, and I try to keep his great love, compassion and zest for life in the tabernacle of my heart. Neil C. Fitzgerald ~dy-August 1999 C. WALKER GOLLAR At Home by the Sea: Isabel Green SCN and the House of Prayer Experience Teponymous hero of Richard Bach's 1970 book Jonathan ingston Seagull at one point employs a rare maneuver in order to test two other seagulls that caught his eye. Jonathan pre-viously has been obsessed with speed, but, upon seeing these two unusual birds, Jonathan "twisted his wings land] .slowed to a sin-gle mile per hour above stall, [but then, much to his surprise, the] two radiant birds slowed with him, smoothly, locked in position. They knew about slow flying.''1 Like Jonathan Livingston Seagull, the Catholic female reli-gious orders of the 1940s and '50s could demonstrate great skill along with an increasing level of professionalism. As institutions they flew at top speeds, even though their abundance of ritual, order, and bureaucracy often seemed to stray far from their sim-ple beginnings. In the 1960s the Second Vatican Council chal-lenged communities of religious not only to get in touch with their roots, but also to recultivate the equivalent of slow flying, that is, prayer and contemplation. One directive that accompanied this challenge called for the creation of houses of prayer. Several men, including Bernard H~iring, Thomas Merton, and David Steindl- Rast, promoted the idea, but religious women effectively saw to its realization. The House of Prayer Movement grew, not out of a set of theological concepts, but rather out of the very real efforts C. Walker Gollar, an assistant professor of church history, writes from the Department of Theology; Xavier University; 3800 Victory Parkway; Cincinnati, Ohio 45207. Review for Religious of women looking to be regrafted onto their ministry's spiritual roots. The progress made by one woman will illustrate how this prayer initiative enriched not only her life, but also the lives of thousands of other religious women heeding the call of the Second Vatican Council. Eleanor Isabel Green was born on 19 June 1921 in Lebanon, Kentucky, the third child and first daughter of Nell Churchill Putnam Green. Nell's husband, a local dentist named William Spalding Green, died in 1926 of a rare heart condition at the age of forty-three, when Isabel was only five. Isabel's mother never remarried; she raised her five children largely by herself. On Sunday evening, 3 November 1935, when only fourteen, Isabel was in a car accident that resulted in the amputation of her right leg below the knee. By all accounts she quickly accepted this hand-icap as part of God's plan and then got on with her life. She grad-uated from St. Augustine High School in Lebanon in June 1938 and then enrolled at Nazareth College, nineteen miles away, at the Motherhouse of the Sisters of Charity of Nazareth, Kentucky, just north of Bardstown. Sister Catherine Spalding After her second year, the school's chaplain, Father James McGee, persuaded Isabel to become a novice with the Sisters of Charity of Nazareth. She professed vows on 19 July 1941. Her ancestors included the Spalding family of old Kentucky. Archbishop Martin John Spalding of Baltimore and Bishop John Lancaster Spalding of Peoria, Illinois, were her uncles from two different generations. Because of these connections, Isabel was the first sister in the order allowed to assume the name of their foundress, Mother Catherine Spalding, a cousin of Archbishop Spalding. As Sister Catherine Spalding, Isabel immediately fell into the busyness of religious life. Heeding an older nun's advice that "it's better to wear out than to rust out," over the next quar-ter of a century Isabel served the college as registrar, treasurer, dean, financial-aid advisor, director of admissions, and alumnae and public-relations director.2 She recalled that all these skills, and many others as well, were learned "on the.job.''3 During these years, by her own account, she "worked with and dealt with all kinds of people in all kinds of situations--young and old, reli-gious and lay, foreigners and American, black, white, yellow, and July-August 1999 Gollar ¯ /It Home by the Sea red, rich and poor, socially elite and simple, professionals, etc.''4 Into the 1960s she served, in effect, as president of the college even though she did not hold the title. As tireless service to others began to take its toll on Isabel, she listened intently to the admonitions of her neighbor, the Trappist monk Thomas Merton of Gethsemani, which is located just a few miles from Nazareth. "We have to learn to commune with our-selves," he explained, "before we can communicate with other men [and women] and with God.''s At the same time, however, Merton insisted that we become our true selves only through identification with God as the reason and fulfillment of our exis-tence. This identification emerged out of what Merton called "active contemplation."6 Like countless other religious women at this time, Isabel had become highly professional; to use Merton's terminology, she gained her identity primarily through the actions of her external or false self. She soon came to realize, as Merton had written, that there are "times when in order to keep ourselves in existence at all we simply have to sit back for a while and do nothing.''7 As did many though certainly not all religious, Isabel wel-comed the directives of the Second Vatican Council (1961-1965), which called not only for adaptation to the times; but also for fundamental renewal in the religious life. The Decree on the Appropriate Renewal of the Religious Life (Perfectae caritatis) indi-cated that religious should be thoroughly prepared for their min-istry and also be afforded the opportunity and time for ongoing spiritual, doctrinal, and professional development. Such growth must include a "continuous return to the sources of all Christian life," including Scripture and the Eucharist. As Merton had already argued~ this decree likewise maintained that religious communi-ties should make a genuine commitment not only to apostolic love, but also to contemplation aimed at an "intimate union" with Jesus Christ.8 In response to this conciliar exhortation, theologian Bernard Hiiring CSSR suggested that female orders set aside specific places at each convent that would be devoted to prayer. He had been inspired by Isaiah 56:7: "I will make them joyful in my house of prayer." On 12 March 1967 Marie Goldstein RSHM and Ruth Caspar OP convened a spontaneous workshop at Notre Dame University in order to discuss the feasibility of establishing houses of prayer. Several other sisters, two priests, and one layman Review for Religious attended. The group suggested that these houses should seek to balance the pervasive "thrust towards hyperactivism" with "a cor-responding thrust towards radical prayer." Each house should become a center for the study of mysticism and ascetic theology, including the practice of Yoga and Zen. The spirit of poverty and simplicity should reign, with the houses providing a place for divine energy and peace as well as psychological serenity. With these aims, houses of prayer could constitute, the group said, "one of the greatest hopes for an authentic understanding of church renewal." In the September 1967 issue of Review for Religious, the group published under H~iring's name a report on their meet-ing. H~iring had not attended the gathering at Notre Dame, though he was supportive of the proceedings. His name certainly added weight to the report.9 A New Apostolate Thomas Merton's death at Bangkok on 10 December 1968 accelerated Isabel's own movement away from the convent into a house of prayer. Almost exactly one year earlier, Isabel's mother had passed away. With a heavy heart Isabel attended Merton's funeral in Kentucky, then~reevaluated the course of her own life. After twenty-three years of service to the college, Isabel concluded that she had given all she wan~ed to give to the field of'education. Following the directives of Merton, she asked her community for time to pray. In her late forties, she was overworked and, as she said, was "tired." She knew that the college was going to close anyway, but.also sensed a growing need to care for her own spirit. Completely of her own accord she resigned from the position at Nazareth College in Januai'y 1969. The school closed two years later. ~0 From January to June she lived with a group of Sisters of Charity of Nazareth at the Cardinal Cushing Hospital in Brockton, Massachusetts, where, besides praying, she studied what some were calling HOPE, which stood for House of Prayer Experience. At the end of this time she spent seven weeks in a House of Prayer program sponsored by the Sisters of the Immaculate Heart of Mary in Monroe, Michigan. Under the direction of Margaret Brennan and Ann Chester, the IHM sisters had taken the lead in this move-ment. The seven-week program, called HOPE '69, terminated with a retreat under Bernard H~iring. He considered his presence at July-Augv~st 1999 Gollar ¯ At Home by the Sea the end to be providential. After the 136 participants had been living in fourteen different locations for seven weeks, H~iring cel-ebrated the fact that these women had brought to life houses of prayer on their own. During the concluding retreat, one woman suggested that a priest should h'ave been part of each house. To this, H~iring emphatically answered: No-o-o. You are too prone to rely on a priest. This House of Prayer is your charism. Use your own ingenuity to develop it. The best way to produce something new is to trust the charism of those involved, as they are open to the Spirit and to one another. The Holy Spirit does not work through inflexible people.'ll Some men did get involved in the movement, certainly~contributed excellent work, and provided important insights. Ann Chester nonetheless contended "that the leadership in the movement and the main development have been the work of women religious."12 After the experience in Monroe, Isabel ct)nvinced the' Sisters of Charity of Nazareth to offer their support. The 1969 chapter commissioned her to introduce, over six months beginning in September, the House of Prayer Movement to all 110 communi-ties in the order. She stirred up great interest and then, from February to June 1970, while residing back at St. Joseph's Infirmary in Louisville, continued extensive planning. That sum-mer she coordinated the running of~ fourteen houses of. prayer open to various religious communities in the Archdiocese of Louisville. In September 1970 she accepted a two-year grant from the Center for Spiritual Studies at Mount Saviour Benedictine Monastery in Elmira, New York, to assist Brother David Steindl- Rast in the House of Prayer Movement. She lived at the monastery for three months. Gloucester During this time Isabel and Brother David searched for a suit-able place0.for another house of prayer that might s.erve a range of active orders beyond the Sisters of Charity. Since 1957 'the Jesuits had offered high school retreats for boys at Gonzaga, a revamped turn-of-the-century stone mansion that overlooked Brace Cove and the Atlantic Ocean at Eastern Point: in Gloucester, Massachusetts. Next to the retreat house Isabel and Brother David spied a five-bedroom servants' outbuilding that had stood virtually Review for Religious unused for many years. In December 1970 they secured permission from the Jesuits to rent this space for a house of prayer. Isabel and Brother David invited two religious women not of the Sisters of Charity, a Catholic layman, and a Jewish expert in Hatha Yoga, Ravi Baumann, to be a part of the first core group. Over the next few months this team gradually established prayerful routines, while they also cleaned and rearranged the house. Then in late May 1971 Isabel bade adieu to Brother David and the initial core team, which by this time not only had readied the place for its first real guests, but also had begun to discuss what the permanent thrust of the house should be. They had agreed that the door would be open to anyone who wished to come anytime throughout the year, though special emphasis would be placed on the summer, when presum-ably more people could get away from their jobs. Individuals who could stay for up to a year might be asked to become part of new core teams that would take special responsibility for run-ning the house. No 'set fees were charged, though guests would be invited to make donations to help cover operating expenses. In the summer of 1971, for the first time at Gloucester, Isabel sponsored two five-week summer experiences. Seven sisters from at least four different orders con-stituted the first group; several religious men joined other sisters during the second session. They came from all over North America. After this time Isabel decided upon the four essential aspects of her house: simplicity, silence, prayer, and hospitality. Isabel decided upon the four essential aspects of her house: simplicity, silence, prayer, and hospitality. Essential Aspects of the House of Prayer Simplicity was apparent in the furnishing and the free atmo-sphere. The house had no frills, no bedspreads, and no curtains other than fishnet draped across curtain rods. Lobster traps served as tables, while carpet samples donated by a local store decorated the floors of the upstairg hallway and chapel. Since many of the guests who would visit over the next fifteen years left incredibly busy schedules to come to Gloucester, Isabel tried her best to ~u~-August1999 Gollar * At Home by the Sea uncomplicate things for them. "Of intent purpose," she once explained, "not much 'busyness' or 'business' goes on here.''~3 Freed from their jobs and left without much to do, many guests eventually discovered new freedom. Sisters, brothers, priests, and an increasing number of laypersons often found their inner selves again at Gloucester. One woman wrote, "For the first time in my life, I feel free--free to be me.''~4 The simplicity of Gloucester encouraged persons to uncover their true selves in an environ-ment that sanctioned doing nothing. Beyond the simple environment, for Isabel the key to the House of Prayer was the pervasiveness of what she called "life-giv-ing silence." ~s This was not, as a core member once explained, a matter of waiting for what was going to happen next, but rather "a happening in itself."'6 Such silence was rarely found in bustling convents, even though in Isabel's mind silence constituted every-one's "birthright." Conversation at the House of Prayer was lim-ited to the noon meal, while TVs and typewriters were nowhere to be found. One telephone was available, though out of sight in a closet underneath the main stairwell. "If you're going to talk to God," Isabel insisted, "then it's easier when you're not talking to someone else at the same time." ~v The house provided quiet space and time for theological reflection and prayerful discernment, so that visitors might, in Isabel's words, "look at and attempt to answer the questions we all are asking ourselves.''~8 Silence at Gloucester effectively b~came a means to communication both with yourself and with others. One priest, for example, while at the House of Prayer faced for the first time what he called his "shat-tered self." Out on the rocks he discovered "that I was deeply afraid of death and very angry at a 'god' who took my parents in the prime of their lives." He voiced this anger, then in faith began to see that death was not the end he had so desperately feared?9 Other guests often emerged out of their silence, needing to talk to Isabel, and she gladly lent her ear. The group conversations at the noon meal were especially enriching. The Eastern Point House of Prayer never had a name, though, after reading Trina Paulus's Hope for the Flowers,. Isabel once considered calling the place the "Cocoon House.'! Many visitors left Gloucester like beautiful butterflies, reinvigorated and sometimes transformed. Temporary retreat from life's incessant demands encouraged more spirit-filled worldly work.2° In a simple and silent environment, the Eastern Point House Review for Religious of Prayer became, in Isabel's words, primarily "a community of praying people who live in praise of the Lord all day, every day.''2~ In contrast to the complicated, impersonal rote prayers of the con-vent, Isabel encouraged simple encounters with God. Brother David had helped her distinguish between the "prayers" that often get in the way of prayer, and "prayer" as the "total confrontation of the human heart with God.''22 During her months of prepara-tion, Isabel had searched the Hebrew and Christian Scriptures for every name that could be attributed to Jesus and then arranged these titles with a Hare Krishna chant used by Eastern yogis. At Gloucester, with the gong of a melodious bowl, Isabel called guests to gather in the chapel to greet the sunrise, bless the water, and invite God into their hearts with the chanting of this Jesus prayer. This ritual was repeated at noon and often at compline around the living-room fireplace. Each session of prayer ended with the chant "Om shanti," a cry for peace. One core member spoke for many others when she explained that, before her year at Gloucester, prayer "was something I had to do and did, but it seemed never to mean much." After her visit the Jesus prayer became a vital part of her life.23 Many religious traditions met at Gloucester. A small menorah burned in the chapel during Hanukkah, while yoga was adapted to Christianity in order to enrich experiences of prayer. Isabel explained that yoga could be practiced by anyone regardless of his or her faith, for yoga simply encourages relaxation and emotional integration. At this time a Congregational minister and frequent visitor to the House of Prayer, R. Cameron Borton from nearby Rockport, Massachusetts, was happy to note that, while many young persons were leaving Christianity in pursuit of Eastern reli-gions, the House of Prayer demonstrated a way in which both tra-ditions could be integrated. Catholic liturgies were celebrated on most afternoons; these liturgies were, in Isabel's words. "really different.''24 A small group of participants gathered on pillows around a squared piece of drift-wood used as the altar. Gifts from~the sea, as well as a portrait of Robert Kennedy, decorated the walls. The celebrant, wearing only minimal vestments, encouraged everyone to participate especially in the shared homilies. Openly expressing individual concerns kept participants in touch with the larger world community. During these services Reverend Borton witnessed what he called "the Catholic Church in a way free from the overpowering structures, July-August 1999 Gollar ¯ At Home by the Sea massive institudonalism, and impersonalism I had come to associate with the Catholic Church." He saw the House of Prayer as "a very crucial ecumenical bridge for these reasons.''2s To foster reconciliation within the Catholic community, Isabel still insisted that the Eucharist be available for perpetual adoration. For the alarming number of Catholics who had grown alienated from the church during or after the Second Vatican Council, the Eastern Point House of Prayer was a safe place to come. Broken individuals, as well as those simply searching for something more, came to Gloucester. Often, in the chapel before the Eucharist, new direction was found among sisters who might otherwise have lost their vocation, lay people whose only thread of contact with the church was provided at the House of Prayer, and priests in search of the contemplative roots of their ministry. Everyone was welcome at Gloucester. Rooted in Isaiah 55, -Ish_.bel extended her hospitality: "Oh, come to the water, all you who are thirsty; though you have no money, come!. Listen, lis-ten to me, and you will have good things to eat and rich food to enjoy. Pay attention, come to me; listen, and your soul will live." A wide range of persons visited the House of Prayer, including, according to Isabel's ~ecollection, "blacks, Jews, orientals, hus-bands and wives, [the divorced, widowed, and alcoholic], children, married deacons, ministers (both men and women), priests, reli-gious, [seminarians, Pax Christi groups, and Catholic Worker peo-ple].'' 26 As one outsider observed, coming to Eastern Point seemed easy--it was the leaving that was hard.27 Most visitors agreed with one woman who remarked that at Gloucester "I was home.''2~ Wider Significance , With this spirit of simplicity, silence, prayer, and hospitality, the Eastdrn Point House of Prayer quickly became known all .around the country. Brother David had gone on to inspire many other houses of prayer, yet still acclaimed Gloucester as "one of the most successful realizations of the House of Prayer idea.''29 Like most observers, Brother D~vid attributed much of the success of Eastern Point to Isabel's own unique gifts. She was able to inspire many persons who had ~received their "basic training" at Gloucester to start other houses of prayer across the United States and in Canada, Chile, and Ireland as well. Though the House of Prayer Movement lost some steam by the early 1980s, with many houses Review for Relig'ious closing or changing focus, Isabel reported to the Jesuits that over the years very little had changed at Gloucester. She had always been able to maintain the original purpose of the house. The House of Prayer breathed new life into the Jesuit Retreat House next door and also supported other communities like the Wellspring House, started in Gloucester in 1981 by several persons including lay theologian Rosemary Haughton. Occasionally Wellspring did not have enough room to put up some homeless men. Wellspring's director, Nancy Schworer, asked Isabel to help out; Despite her suspi-cion that the Jesuits would not approve, Isabel told Schworer to bring them over, but to cut her lights when she pulled up to the House of Prayer. "I did," Schworer said.3° The Jesuits still grew suspicious of Isabel. Over the years the Jesuits periodically challenged Isabel's use of the property, but despite some battles her days at Eastern Point remained vibrant until she was diag-nosed with terminal cancer in 1985. That summer her family brought her back to Kentucky, to the Nazareth Home in Louisville, where she spent her last days. Once the Jesuits realized she would never return to Gloucester, they began to reno-vate the House of Prayer, eventually mak-ing it an extension of the retreat house, which is what it remains to this day. The Jesuits defended this readaptation, explaining that no one could replace Isabel. Still, the decision to close the House of Prayer must have been linked to periodic suspicions regarding the creative community that existed on their property but was effectively out of their control. Because of its radical openness to God, the House of Prayer invited renewal in ways that undoubt-edly seemed threatening to certain entrenched church str~ctures. Isabel passed away on Wednesday, 15 January 1986. Order was restored at Gloucester, but a certain creativity was lost. In his 1977 novel, Illusions, Richard Bach tells of a creature that dared to let go of the twigs and rocks on the river bottom to which all other creatures previously had clung. The current lifted him free. Thomas Merton, Bernard H~ring, David Steindl-Rast, and the fathers of the Second Vatican Council called for change, To foster reconciliation within the Catholic community, Isabel insisted that the Eucharist be available for perpetual adoration. July-August 1999 Gollar ¯ At Home by the Sea but people in houses of prayer, especially women like Isabel Green, realized the anticipated renewal. Many guests let go of their busy-ness, put behind the patriarchal structures of the past, and tran-scended traditional Catholic boundaries in search of deeper knowledge of themselves. Visitors to houses of prayer replaced detached, regulated prayers with intimate encounters with God, and with all of creation too, especially those who were struggling for personal and social integrity. In. so doing these guests discov-ered new possibilities for their ministries. Like Richard, Bach's courageous river creature, Isabel Green sounded the good news of the Second Vatican Council when, in the silence of the. Eastern Point House of Prayer, she announced: "The [water] delights to lift us free, if only we dare let go.''3~ Notes ~ Richard Bach, Jonathan Livingston Seagull, A Story (New York: Macmillan, 1970), p. 46. 2 Isabel Green papers (hereafter IGP), Isabel Green to Katie Pumam, 10 February 1948, Nazareth, Kentucky. Isabel Green is the aunt of the author of this article; he inherited her papers. 3 IGP, Talk to Jesuits, 7 February 1983 (hereafter Talk), p. 1. 4 IGP, 1974 Resum~ for Brian Duffy SJ, p. 1. 5 Thomas Merton, No Man Is an Island (New York: Harcourt, Brace, and World, 1955), p. 120. 6 Thomas Merton, Woods, Shore, Desert: A Notebook, May 1960 (Santa Fe: Museum of New Mexico Press, 1982), 6 May, p. 10. 7 Thomas Merton, No Man lsan Island, p. 122. 8 Decree on the Appropriate Renewal of the Religious Life (Perfectae caritatis), §§2 and 8. 9 Bernard H~iring, "A Contemplative House: Notes from a Discussion Held at Notre Dame," Review for Religious 26, no. 5 (September 1967): 772; and H~iring, Acting on the Word: The Challenge to Religious Communities in an Age of Renewal (New York: Farrar, Straus, and Giroux, 1968), p. 204. H~ring's book reprinted part of the article and added a few new insights. 10 IGP, Talk, p. 1. " Quoted in Ann Chester, My Journey in the House of Prayer (Monroe, Michigan: Pathways Press, 1991), p. 42. ~2 Chester, MyJourney~ p. 16. ~3 IGP, Open letter of solicitation for "testimonials," by Isabel Green SCN, November 1973, Gloucester, Massachusetts. Review for Religious ~4 IGP, Ann to Isabel Green SCN, 22 January 1975, no place. ~3 IGP, General Statement by Isabel Green SCN directed to Sisters of Charity of Nazareth, 26 February 1984 (hereafter General Statement). ~6 IGP, Michael van der Peer SCJ to Isabel Green SCN, 7 January 1975, Milwaukee, Wisconsin. ~7 Quoted in Gloucester Community News, "Nuns Rise at Dawn for Daily Yoga," 21 November 1975. ~8 IGP, General Statement. 19 IGP, Sister Darlene Kern to Isabel Green SCN, 3 January 1975, St. Pius X Convent, Billings, Montana. 20 IGP, Michael Guimon OSM to Isabel Green SCN, 20 January 1975, Detroit, Michigan. 2~ IGP, Janet L. SSJ to Isabel Green SCN, 11 January 1975, Providence, Rhode Island. 22 IGP, Janine to Isabel Green SCN, undated (c. 1 January 1975). 23 Isabel Green, "Eastern Shoreside House of Prayer," SCNews (April 1973), p. 4; Tina Paulus, Hope for the Flowers (New York: Paulist Press, 1972). 24 IGP, Talk, p. 4 zs Steindl-Rast, "Prayer in the Twenty-first Century," Audiotape by Credence Cassettes, AA2566, 1992. 26 IGP, Jean Kilvin to Isabel Green SCN, 2 February 1975, Halifax, Nova Scotia. 27 IGP, Talk, p. 8. 2.8 IGP, Reverend R. Camer~)n Borton to Isabel Green SCN, 20 January 1975, Rockport, Massachusetts. 29 IGP, Talk, p. 9. Some well-known theologians including Avery Dulles visited the Eastern Point House of Prayer. 30 "At Home by the Sea: Intercommunity Prayer, Often Interfaith Too," Crux of Prayer, February 1976. 3~ IGP, Sheila Ford SCN to Isabel GreenSCN, January 1975, Eastern Point House of Prayer, Gloucester. 32 IGP, David Steindl-Ra~t OSB to Isabel G~'een SCN, 5 January 1975, West Tremont, Maine. 33 Phone interview with Nancy Schworer, 3 March 1998. 34 Richard Bach, Illusions: The Adventures of a Reluctant Messiah (New York: Dell Publishing Co., 1977), p. 17. 57uly-August 1999 consecrated lile DENNIS J. BILLY Vita Consecrata and the Anthropology of the Vows In Vita consecrata (1996), his postsynodal apostolic exhor-tatioff on the consecrated life, Pope John Paul II writes of "the profound anthropological significance of the coun-sels" (§87). He does so while treating the prophetic stance of the consecrated life before some of the difficult chal-lenges facing the church today. This explicit statement of the intricate connection between the theology of the counsels and the character of human existence makes the phrase one of the most important in the entire docu-ment. In it the pope bids us to note not only how the vows relate to our self-understanding, but also how, through them, human understanding itself can be transz formed. My purpose in this essay is to draw out some of the implications of this key anthropological statement. The Right Question What we think about the vows and how we live them tells us something about how we view ourselves and the world we live in. This has always been the case, even long ago in the church's .past when philosophical and theological justifications of the counsels thrived that now seem somewhat dubious and even embarrassing. At one Dennis J. Billy CSSR, a frequent contributor, writes again from Rome, where his address is Accademia Alfonsiana; C.P. 2458; 00100 Roma, Italy. Review for Religio us time, for example, the counsels were seen as a way of rising above the material dimension of human existence and escaping the bonds that the physical world placed on us--including our own sexuality. Lives of perfect chastity, poverty, and obedience were thought to lead religious to a higher plane of existence where they could over-come'bodily passions and be free of attachments to family, pos-sessions, and self-will. Such a conception of the counsels was supported by an ethi-cal dualism in the church's understanding of human existence that manifested itself in a deep distrust of the body and bodily pas-sions. This deep-seated suspicion predated but was galvanized by Augustine's doctrine of original sin, which affirmed its orthodoxy, on the one hand, by condemning the Gnostic equation of matter with evil and Gnostic ascetic rigor and, on the other, by main-taining a close association between sin and sexual intercourse. Traces of this pessimistic estimation of the body and bodily passion (what Augustine called "concupiscence") have filtered through the church's historical memory and continue to exert a subtle influence on our reception and understanding of the counsels. This is so even though many of the anthropological assumptions that presently guide our theological understanding of the vows (and of the doctrine of original sin) are decidedly different. We lack the space to go into any of these assumptions in detail. My point, however, is very simple. In the church's past, every the-ology of the counsels has made certain anthropological assump-tions. The more we are aware of them, the better we can examine them and discern whether they are appropriate expressions of our own self-understanding. The counsels have had and will always have a deep anthropological significance. The question we need to pose is: Which anthropology and what significance? We need to ask these questions today. Vita Consecrata In his apostolic exhortation, the pope describes the anthro-pological significance of the vows in this way: The decision to follow the counsels, far from involving an impoverishment o~ truly human values, leads instead to their transformation. The evangelical counsels should not be considered as a denial of the values inherent in sexual° ity, in the legitimate desire to possess material goods or July-August 1999 Billy * Vita Consecrata and the Anthropology of the Vows to make decisions for oneself. Insofar as these inclinations are based on nature, they are good in themselves. Human beings, however, weakened as they are by original sin, run the risk of acting on them in a way which transgresses the moral norms. The profession of chastity, poverty, and obe-dience is a warning not to underestimate the wound of original sin and, while affirming the value of created goods, it relativizes them by pointing to God as the absolute good. Thus, while those who follow the evangelical counsels seek holiness for themselves, they propose, so to speak, a spir-itual "therapy" for humanity, because they reject the idol-atry of anything created and in a certain way they make visible the living God. The consecrated life, especially in difficult times, is a blessing for human life and for the life of the church. (§87) In this passage John Paul affirms the fundamental goodness of human sexuality, material possessions, and human freedom. At the same time he recognizes the capacity each of us has by reason of our weakened state to abuse these basic human goods and even to idolize them. VChat the evangelical counsels do.is "cut them down to size" by referring them to God, the absolute good of human life, and thus diminishing the exaggerated worth we may be tempted to place in them. This process offers humanity a "spiritual therapy" which, through the operation of grace, promises to heal its wounds and bring about the transformation of all human values. Unfortunately, the pope does not go into detail about how this treatment or ther-apy might function. Nor does he tell us the extent to which this rel-ativizing process takes place. By invoking God as the absolute good to which the counsels point, he simply reminds us that human existence is not an end in itself, but is actually oriented beyond itself. It is precisely by looking beyond itself that humanity is able to discover its truest, deepest meaning. In this presentation of the counsels, the pope affirms (1) the fundamental goodness of all creation, (2) the weakness (and not total corruption) of human nature due to original sin, (3) the abso-lute goodness of God, who alone is worthy of our praise and ado-ration, (4) the eschatological orientation of the vows, which relativize human existence by pointing beyond it and by empha-sizing its inherent creaturely status, and (5) the specific anthro-pological orientation of the vows by virtue of their therapeutic (that is, healing) and transformative (that is, elevating) effect on Review for Religious people's lives. Each of these affirmations is both theological and anthropological in orientation. Together they draw the parame-ters within which the counsels are to be understood and assimilated in our lives. Together they remind us that we are wounded crea-tures capable of being healed and elevated by the grace of a truly plentiful redemption. Within this context the pope speaks about three major chal-lenges facing the church today and how the consecrated life has a prophetic role to play in responding to each of them. The first challenge is "that of a hedonistic culture which separates sexuality from all objective norms, often treating it as a mere diversion and a consumer good and, with the complicity of the means of social communication, justifying a kind of idolatry of the sexual instinct" (§88). Consecrated persons, he states, respond to such values by showing through their lives of chastity that it is possible "to love God with all one's heart, putting him above every other love, and thus to love every creature with the freedom of God" (§88). The second challenge is "that of a materialism which cravespos-sessions, heedless of the needs and sufferings of the weakest, and lacking any concern for the balance of natural resources" (§89). Here again, consecrated persons respond by a life of evangelical poverty, which attests "that God is the true wealth of the human heart" and which "forcefully challenges the idolatry of money, making a prophetic appeal as it were to society, which in so many parts of the developed world risks losing the sense of proportion and the very meaning of things" (§90). The third challenge "comes from those notions of freedom which separate this fundamental human good from its essential relationship to the truth and to moral norms" (§91). To this, con-secrated persons respond th.rough a life which "reproposes the obedience of Christ to the Father and., testifies that there is no contradiction between obedience and freedom" (§91). Consecrated per-sons, in other words, respond to the challenges facing the church in today's world through lives dedicated to the evangelical coun-sels. They do so not alone, but through life in community. This is especially important, since community is "the particular sign, before church and society, of the bond which comes from the same call and the common desire--notwithstanding differences of race and origin, language and culture--to be obedient to that call" (§92). Life in community is nbt only an aid to living the counsels, but also a sign of that toward which both church and July-August 1999 Billy ¯ Vita Consecrata and the Anthropology of the Vows society are tending. It forges the vows into an eschatological sign of the kingdom that is, at one and the same time, already here and yet to come. Further Integration Although the pope provides many fine insights into the anthro-pological dimensions of the consecrated life and the prophetic response it makes to the challenges facing the church today, I can-not help feeling that even further development of his fundamen-tal insights is possible and even necessary for a more thorough understanding of the vows. I would see this development taking place in five basic anthropological dimensions of human existence: the physical, the emotional, the mental, the spiritual, and the social. The Physical. The counsels make sense only if they have a con-crete, physical expression in the world. If they do not, then con-secrated persons need to ask themselves if they are only pretending to lead lives of chastity, poverty, and obedience. It is very easy to talk about the counsels. It is much more difficult to live them and to insure that they have repercussions in the concrete circum-stances of one's life. I am not going into what these concrete expressions might be. They are probably clearer for some counsels (chastity) than others (poverty and obedience)--although not nec-essarily. My point is that we need to take the physical, bodily expressions of the vows seriously. Consecrated persons are called to be chaste, to be poor, to be obedient; and this should be obvi-ous to other people by the lives we lead. We need to be careful not to fall into the trap of self-deception. It is easy for us to ratio-nalize the compromises we make with the counsels. If we are not careful, we can end up being chaste, poor, and obedient in name only. We are called to much more than that. The Emotional. The physical expression of the counsels, how-ever, would be cold and void of meaning if our hearts were not in it. The emotional side of human existence is very complex and, to many, extremely threatening. It too needs to be integrated in a life dedicated to the counsels. If it is not, then there is a strong possibility that we will end up leading double lives, where our out-ward actions do not correspond with our deepest feelings and emo-tions. Integrating our emotions is a lifelong process. One of the mistakes that institutes of consecrated life have made in the past and which, sad to say, some continue to make is to repress or (per- Review for Religious haps worse) completely ignore this dimension of human existence. Like others, consecrated persons need to be taught how to deal with their emotions--those which help them deepen their com-mitment, as well as those which could weaken it--and integrate them into their life commitments. If they are not taught this, they run the risk of just going through the motions or perhaps not even bothering with them. Consecrated persons who have not learned how to integrate their emotions with the rest of their lives are usually very unhappy people who do a good job of making other people unhappy. They can be difficult to get along with in community. The Intellectual. It is important also that we reflect on the counsels regularly--both individually and as a group. Consecrated persons need to keep abreast of the latest developments in the psychological and social sciences with a view to understand-ing more profoundly their own charism within the church. The theology of the counsels has undergone a great deal of change down through the years, especially since the end of the Second Vatican Council. It shall continue to change. If we fail to reflect upon the meaning the counsels have for us, if we fail to read what theologians and spiritual writers are saying about them, if we fail to talk about them among ourselves, then we run the risk of isolating our vowed commitments from the rest of life. When this happens, we can easily get stuck in old patterns of expression that do not help us meet the challenges of the day. Consecrated persons need to be creative in the way they give witness in the world through the counsels. Theological reading, reflection, and conversation are ways of insuring that such ideas will come to us and find expression in our lives and ministry. It is a mistake to think, for example, that religious learn everything they need to know about the vows during the novitiate. In these matters there needs to be lifelong growth; the intellectual component of that growth should not be overlooked. The Spiritual. Consecrated persons also need to be still and let their spirits yearn for God. It is in the deepest dimension of the self that the Spirit of God communes with consecrated persons' own spirits; it is there that they can find strength for living their Consecrated persons need to be creative in the way they give witness in the world through the counsels. ~uly-August 1999 Billy ¯ Vita Consecrata and the Anthropology of the Vows We are social beings by nature. We become who we are called to be through our interaction with others. vowed life. By professing the evangelical counsels, consecrated per-sons seek to follow in the footsteps of Jesus. This life of imitation is not meant to be a cold, external effort.'We are much too weak for that. Rather, it involves an intimate relationship with the Spirit of Jesus, which propels us to live the way he did and to do so with all our heart, mind, soul, and strength. For this to happen, conse-crated people need to be men and women of contemplation. Surely there are many forms of prayer; both as individuals and as communities, we favor certain ones. Among these forms we should not forget the contemplative dimension of our lives. On the contrary, we should give it priority of place. If we do not allow ourselves to be still and to listen, if we do not know how to allow our spirits to yearn, to groan, to breathe, then we are overlooking in our prayer a tremendous help in living the counsels. It is through contemplation that we gradually tame, and integrate into the rest of our lives, the deep, inordi-nate passions that affect us by reason of our weakened state. Through contemplation our spirits gradually become chaste, poor, and obedient to the movements of the Holy Spirit in our lives. Without it, it will become all the more difficult for us to live "in the Spirit" and to see how our vows fit into such a life. The Social. We live the vows individually, but also in community. Consecrated persons cannot go it alone. They need the support of others to help them along. They should be encouraged to have close, intimate friends with whom they feel free and secure enough to share their problems and difficulties. They also need the support of a wider circle of friends and acquaintances. Most of all, they need community. We are social beings by nature. We learn about ourselves and we become who we are called to be through our interaction with others. It is through our interaction with others that we learn the meaning of the counsels and receive help to live them. Consecrated persons are oriented toward community life because the counsels themselves are rooted in a communal under-standing of human existence. If we overlook the social dimensions of our lives as consecrated persons, it is almost certain that we will be overlooking in our lives some aspect of what it means to be chaste, poor, and obedient. Living the counsels and living in com-munity are closely tied. This holds true even for the hermit, who Review for Religious lives alone, but whose life and actions lie hidden in the contem-plative heart of the church. These dimensions are important for living the counsels. That is not to say, however, that they will be understood and incorpo-rated in the same degree in every life dedicated to living them. Differences in personality, family background, and cultural prove-nance all come into play, as do such other factors as level of edu-cation, religious training, and long-standing community traditions. The goal for consecrated persons should be to try to integrate all of these elements into their lives, adverting to them and giving them appropriate expression. To overlook some of them or, worse, simply to refuse to take them into account reveals a severe defi-ciency in living the life of the counsels. Counsels and Challenges All of this helps us to view John Paul's emphasis on the anthro-pological dimensions of the counsels and the challenges facing the church today in a slightly different light. For one thing, it helps us to see the challenge beneath the challenges that face consecrated persons in the church today. The counsels must penetrate every part of our lives, not simply those we find most convenient or accommodating to our needs. We will not be able to give a true prophetic response to the hedonism, materialism, and individual-ism in the world today if we exclude the counsels from any of the dimensions I have mentioned--the physical, the emotional, the intellectual, the spiritual, and the social. If we do, we compart-mentalize the counsels, allowing them to take shape in one or more areas of our lives, but not in all of them. When this hap-pens, we wind up with only a halfhearted commitment to the life of chastity, poverty, and obedience. The result is a diminution of our prophetic call. People will refuse to take us seriously because we do not take ourselves seriously. They will only half-believe the words we say, because they will be convinced that we only half-believe them ourselves. John Paul's reflection on the anthropological significance of the counsels can be applied in a reflective and consistent manner to each of these five dimensions. When this is done, an even deeper sense of the anthropological (ignificance of the counsels results. The goodness of creation, foi" example, extends not only to our physical well-being but to the emotional, the intellectual, the spir- July-August 1999 Billy ¯ Vita Consecrata and the Anthropology of the Vows itual, and the social as well. All of these dimensions, though they are weakened by the results of humanity's primordial fall and seem insignificant in comparison with God the Absolute Good, never-theless have an eschatological significance and hold promise of being both healed and elevated by God's plentiful redeeming grace. It is in these contexts that the counsels deepen our understand-ing of human existence and help us see the whole of life as radically dependent on God. This is what consecrated persons give witness to, live their lives for, and die for. Tidal Wave - Papua New Guinea 7 July 1998 Deadly as a cobra, hooded wide The tidal wave lifts ten meters And sweeps across the Bay Swallowing tall pandanus palms, Crossed timbers of the villages, Once the necklace of the North. Midst the flotsam and jetsam A woman, one foot torn away, grasps a tree top And suddenly gives birth. A scream. And a small brown babe Is lifted above the swirl. "Oh God[ Where are You?" and the wood replies: "He has known the waves of sin His feet were spiked with pain And He, too, died upon a tree." Mary O'Neil RSM Review for Religious NIHAL ABEYASINGHA Authority among Religious in South Asia T[superior general of a male international religious con-gation, after visiting several units of the insftute in South Asia, said he found it difficult to understand the defiance of author-ity and the backbiting that go on in this area. He added that his lack of understanding of this phenomenon was perhaps due to his own foreign cultural perspective. Such an observation from a man of wide experience should at least pose a question to Asian religious. Every culture functions on certain assumptions. They are sel-dom clearly articulated, but they are real and they are operative. For example, in a culture that links equality with freedom, there is a growing awareness that men have, in fact, been afforded greater freedom than women. In order to repair the imbalance, people seek to equalize the position of the sexes by using equality as their criterion. It is not difficult to generate enthusiasm in the public forum for a movement towards equality. Another culture, however, could work from a different assumption. It could consider women to be worthy of much esteem as members of society because of their special role to give birth to and nurture new life in that society. This culture would express that esteem by providing the security of a stable mar-riage and home and by linking this to a limited set of achieve-ments expected of every woman. VChat we tend to forget is that Nihal Abeyasingha CSSR wrote about an approach to refounding in our July-August 1998 issue. Hi

Issue 52.3 of the Review for Religious, May/June 1993. ; frOe i g,i ous Christian Heritages and Contempora~ Living MAY-JUNE 1993 ¯ VOLUME 52 ¯ NUMBER 3 Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University. by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-535-3048 ¯ FAX: 314-535-0601 Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ 5001 Eastern Avenue ¯ P.O. Box 29260 Washington, D.C. 20017. POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ¯ Duluth, MN 55806. Second-class postage paid at St. Louis, Missouri, and additional mailing offices. SUBSCRIPTION RATES Single copy $5 includes surface mailing costs. One-year subscription $15 plus mailing costs. Two-year subscription $28 plus mailing costs. See inside back cover for more subscription information and mailing costs. ©1993 Review for Religious for religious Editor Associate Editors Canonical Counsel Editor Assistant Editors Advisory Board David L. Fleming SJ Philip C. Fischer SJ Michael G. Harter SJ Elizabeth McDonough OP Jean Read Mary Ann Foppe Joann Wolsld Conn PhD Mary Margaret Johanning SSND Iris Ann Ledden SSND Edmundo Rodriguez SJ Se~n Sammon FMS Wendy Wright PhD Suzanne Zuercher OSB Christian Heritages and Contemporary Living MAY-JUNE 1993 * VOLUME 52 ¯ NUMBER 3 contents 326 feature Prophecy or Restorationism in Religious Life Gerald A. Arbuckle SM describes the effects of the prophetic and the restorationist movements on religious life. 340 350 witnessing Would That All Were Prophets~ Dianne Bergant CSA examines the 'meaning of prophecy in the life of religious congregations. Committed Christian Secularity Paul J. Philibert OP explores some areas of development for those called to the life of the secular institute. prayer and direction 364 Liturgy of the Hours: A Reflection Suzanne Zuercher OSB finds that the ritual praying of the Liturgy of the Hours manifests what monastic life is and needs to remain. 371 380 Get Serious! The Monastic Condemnation of Laughter Kenneth C. Russell suggests some ways for us to understand and give modern application to the monastic attitude towards laughter. A Mystical Moment: Spiritual Direction and the Adolescent Fred Herron highlights aspects of spiritual direction in the con-text of adolescent development. 322 Review for Religious 39O 418 428 432 446 454 religious leadership Religious-Leadership Competencies David Nygren CM and Miriam Ukeritis CSJ report on skills and characteristics which mark superior performance for contemporary religious leaders. Some Ruminations on the Identity of Religious David F. O'Connor ST reviews the current identity issues around religious life. An Identity Dilemma: Standing with the Poor Patricia McCann RSM focuses the question about a gap between the espoused ideal and the reality of standing with the poor in religious life and ministry. ~ living gospel values Poverty as the Embrace of Insecurity Richard J. De Maria CFC stresses that the insecurity of poverty in some form remains essential to religious life. Men Vowed and Sexual: Conversations about Celibate Chastity Selin D. Sammon ~MS and Judith Ann Zielinski OSF describe a project sponsored by the Conference of Major Superiors of Men to enhance the living of celibate chaste life by vowed men. A Story of Addiction and Co-Addiction William F. Kraft tells a story of how the problems of addiction and co-addiction can be signs of contradiction that lead to new and better living departments 324 Prisms 462 Canonical Counsel: Common Life and Houses 469 Book Reviews May-.~une 1993 323 prisms ~edo not talk much about "working at the virtuous life." Perhaps the Pelagian inference--that "working at it" is enough, all by itself---keeps us suspi-cious of such talk. Maybe we are reluctant to admit explic-itly that virtue is on our list of outmoded things. There is also the possibility, even the likelihood, that some people strong in virtue have offended us in some way. "Nice" people may be easier to live with and less offensive than people imbued with courage or fired up for justice' sake. But Jesus demands more of his followers than that they be nice. Christians in every age need to work at the vir-tuous life. Recently in North America the news media have made much of various accusations or admissions of sexual mis-conduct by bishops, priests, and religious. The result is that the leadership in the local church and in religious congregations has had the painful, but necessary, task of coming to terms with a difficult and disturbing situation. What becomes evident to those living the consecrated life is that celibate chastity is not only something which we can "lose," but also something to be worked at: that only through a lifetime effort does one grow in chastity and love. Various programs like Marriage Encounter and the Christian Family Movement and Teams of Our Lady have long stressed how couples need to Work at their marital chastity if they are going to deepen their love and grow to be ever more faithful to each other. In a similar way, through some painful reminders today, both men and 324 Review for Religious women in celibate commitment are being called to make the effort they need to make if they are to grow as loving celibate people. In the scholastic theology of St. Thomas Aquinas we are taught the meaning of the virtues of the Christian life through his masterly explanation of habit. It would be interpreting Thomas fairly to bring our commonsense thinking about acquiring a habit to our understanding of his insight into acquiring--"working at"--virtue. Without denying the primacy of grace, especially experienced in the theological virtues of faith, hope, and charity, we need to put forth the human effort to make those qualities more deeply our own. Theological developments since Vatican II have stressed that, just as conversion is continual in a Christian's life, so too growth in virtue is never finished--nor can either of these occur in iso-lation; they demand the presence of the faith community. Similarly, we now see even more clearly that virtue, like conver-sion, is never a private matter but impacts the public and social sphere. Our very working at virtue gives force to our evangeliz-ing efforts in our families, communi.ties, and workplaces. As a case in point, then, there are recent efforts being made to ~work at celibate chastity within a community setting and not in isolation. As married people have discovered in their various Christian family organizations, it is within the faith community that growth in virtue finds its support and that marriage and fam-ily values are witnessed to and witnessed. "'Men Vowed and Sexual," a project sponsored by the U.S. Conference of Major Superiors of Men and reported on in this issue, is one way to achieve a com-munity setting of support and understanding for the celibate chaste development of individuals. In another effort to assist those who are committed to the tasks of spiritual formation, the Christian Institute for the Study of Human Sexuality has been announced by the staff of theJesuit Educational Center for Human Development. Along 0¢ith the primacy of the grace of God and continuing individual effort, such community projects point the way for all of us to "work at" virtue today. David L. Fleming SJ May-June 1993 325 feature GERALD A. ARBUCKLE Prophecy or Restorationism in Religious Life "Turmoil is going to break out among your tribes." --Hosea 10:14 Anthropologically a tribe is a gathering "of bands., hav-ing a feeling of unity deriving from numerous similarities in culture, frequent friendly contacts, and a certain com-munity of interest.''1 By this definition religious life before Vatican II was one tribe consisting of many bands or clans (congregations) bound together despite their individual differences by a common belief in the nature and purpose of religious life. Now this tribal oneness no longer exists. Today, instead of clans within one tribe, we have many dif-ferent tribes that do not share a common vision of reli-gious life. Even within the same congregation there can be several different tribes, each claiming that it alone is authentically interpreting religious life and the original founding congregational vision. Communication across the boundaries of these reli-gious- life tribes may be poor, as is commonly the case between different ethnic groups at any time in human society. Each tribe, says anthropologist Edward Hall, usu-ally takes the position of "thinking and feeling that any-one whose behavior is not predictable or is peculiar in any way is slightly out of his mind, improperly brought up, irresponsible, psychopathic, politically motivated to a point Gerald A. Arbuckle SM continues to write, lecture, and con-duct workshops on the refounding of religious life. His address is Refounding and Pastoral Development Unit; 1 Mary Street; Hunters Hill; Sydney, N.S.W. 2110; Australia. 326 Review for Religious beyond redemption, or just plan inferior.''2 This rather blunt (but generally accurate) statement of tribal ethnocentrism describes the strong prejudice-founded belief that my tribe is the center of everything, and all other groups or tribes are scaled and rated with reference to it. Unfortunately, the way some religious tribes within contemporary religious life at times view other groups-- with hostility and self-righteous intolerance--is not unlike Hall's description. Sometimes. religious-life tribes agree to co-exist side-by- side with apparent harmony; peace is maintained because they agree at least tacitly not to raise their significant differences over the m~aning of religious life. They deny or suppress the differ-ences lest exhausting tensions erupt openly. Dialogue, which demands an op.enness to the other and to the possibility of change, is difficult in these circumstances--even impossible. This article has a twofold function: first, to summarize why one religious-life tribe has fragmented into many different tribes or quasi-ethnic groups since Vatican II; and second, to describe the significant qualities of these tribal groups. From Tribe to Tribes in Religious Life Religious Life: Founding Myth Undermined. The founding myth .of religious life historically evolved wheri people began to gather together to live the radical values of the gospel, to devote, them-selves totally to the person of Christ and his kingdom values. The major mo;vements (monastic, conventual, and apostolic) were prophetic reactions to abuses or corruption of power within the church and society at large. Prophetic action is thus integral to the founding stoW of religious life. Johannes Metz correctly asserts that religious communities must be "a kind of shock therapy" challenging the church to live the fullness of Christ's message. "Against the dangerous accommodations and questionable com-promises that the church . . . can always incline to," he writes, "they press for the uncompromising nature of the gospel and of the imitation of Christ.''3 Myths bind people together with a common vision. They are value-impregnated beliefs and notions, born in sacred time and space, that people live by and live for; at the level of the culture they are primarily unconscious, powerful in their influence, and partic-ularly difficult for people to articulate objectively except in stoW form or by describing the life histories of their culture's heroes or May-a~une 1993 327 Arbuckle ¯ Prophecy or Restorationism: heroines. In reality people adhere to relatively few archetypal myths, of which the conspiratorial enemy and the all-powerful hero-liberator are central kinds. Myths provide a feeling of cer-tainty, direction, and trust rather than the paralysis, fear, or bewil- The council challenged religious to rediscover the prophetic heart of their ministry when it directed them back to the person of Christ, the founding experience of their own congregations,. and the apostolic needs of the world. derment that chaos--the opposite of order or the predictable--brings.* Over time, however, myths can drift away from their original message without people' being quite aware of what is happening. This in fact hap-pened to the founding myth of reli-gious life. In recent centuries religious life has lost its prophetic emphasis within the church and the world and has become based on three pivotal assumptionscontrary to its original founding vision: the world is funda-mentally evil and tobe avoided, reli-gious are the spiritual elite of the church, and their task is to be uncrit-ically supportive of the ecclesiastical and pastoral status quo.~ Vatican II dramatically under-mined these aberrant assumptions and the myth they sustained when it stated that the world is capable of redemption and the church must inter-act with it through a process of exchange/dialogue (that is, incul-turation). 6 Furthermore, all people--not only religiousware called to, and are capable of, holiness.7 Religious asChristians could no longer remove themselves from the concerns of the world, nor could they ever again consider themselves the spiritual elite of the church. Finally, the council challenged religious to rediscover the prophetic heart of their ministry when it directed them back to the person of Christ, the founding experience of their own congregations, and the apostolic needs of the world. The revi-talized founding myth was not neatly put together by the coun-cil and it would be a long time before religious could rediscover with confidence its authentic nature and implications. Reactions to Vatican Ih Conversionist and Restorationist Groups. It is a basic experience of anthropology that any interference with a founding story or myth of a group--even when fully justified (as 328 Review for Religious occurred at Vatican II) and intellectually assented to by the peo-ple involved--is catastrophic or chaotic at the level of identity, belonging, or feeling.8 A satisfying and interiorized myth is never re-created quicHy out of turmoil or chaos. The reaction to a dramatic mythological change, such as hap-pened to religious life at Vatican II, normally follows a fairly pre-dictable pattern. First, there is an effort to control initial unease or anxiety through legislative or structural changes so that an anxiety-reducing order can once again emerge, but political or legislative action alone is ineffective without an attitudinal open-ness to an as yet unformulated new myth. The phase of chaos follows; neither traditional support systems nor mere structural changes provide the needed sense of direction and belonging. Symptoms of depression--such as anger, numbness, "lostness," feuding, denial, sadness, witch-hunting to assign blame for the chaos--emerge within the group or in individuals. As the chaos persists, people are apt to turn to one of two options: either conversionist or escapist movements. Leaders of these movements have the charismatic ability of articulating appropriate visions and strategies to achieve them. Conversionist movements develop when people recognize that the way to change is not by nostalgically and uncritically returning to a former cul-tural stage but by struggling to relate to an entirely different ambience. The building of a new founding myth is painful, demanding courage to let go the past, the willingness to walk in the darkness of uncertainty and ambiguity, waiting, creating and testing new ways of acting adapted to the changing circumstances. No sudden solution to the malaise of the chaos is possible.9 Commonly many people cannot cope with the darkness and uncertainty demanded by the conversionist approach. They seek the escapist option with its fundamentalist and simplistic remedies to the confusion. Fundamentalistic or sect movements are com-mon today within Islam, Judaism, and Christianity and in the arena of politics just as they have always been in times of dra-matic social or cultural changes. They take various forms. For example, some are millenarianl° as they promise a dramatic and imminent appearance of a world of meaning and belonging to their disoriented followers, on condition they commit themselves without question to simplistic and authoritarian-led actions. The popularity of these fundamentalist movements today~ testifies to the extent and depth of the cultural upheaval through- May-3~ne 1993 329 Arbuckle ¯ Prophecy or Restorationism Restorationism is the vigorous effort to return the church uncritically to the pre-Vatican II structures, practices, and attitudes. out the world in reaction to the speed and radicality of contem-porary technological; social, and economic changes. Patrick Arnold's definition of fundamentalism is particularly apt: it is "an aggressive and marginalized religious movement which, in reac-tion to the perceived threat of moder-nity, seeks to return its home religion and nation to traditional orthodox prin-ciples, values, and texts through the co-option of the central executive and legislative power of both the religion itself and the modern national state.''t2 This definition highlights the emphasis that fundamentalists place on the role of civil and religious governments to coerce people to accept their beliefs. James Hunter sees fundamentalist movements as "characterized, to varying degrees, by a quality of organized anger." They aggressively want to make history right again.13 Intellectual arguments will not convert people away from fundamental-ism because fundamentalism is a reaction to a loss of felt belong-ing, not necessarily to inadequate intellectual reasoning. Fundamentalist movements form an increasingly strident, intolerant, and powerful force within the Catholic Church today, indicative of the extent of the chaotic upheaval sparked off by such forces as Vatican II and the opening 0f the church to a world caught up in its own tumultuous change--the revolution of expressive disorder of the 1960s and early 1970s.14 These restora-tionist movements demand that the church return to its pre- Vatican II culture with its patriarchal, dependency, and authoritarian models of leadership. Whoever dares to question what fundamentalists do are branded as contemporary "witches" who are out to undermine in a conspiratorial way what restora-tionists define as orthodoxy. In brief, restorationism is the vig-orous effort to return the church uncritica'lly to the pre-Vatican II structures, practices, and attitudes. (I say "uncritically" because there are some key pre-Vatican II values that need to be revital-iz. ed, for example, a respect for a living tradition.) Restorationism is an abuse of power because key values of Vatican II--for exam-ple, collegiality, the call to inculturate the faith within local 330 Review for Religious churches--are either rejected or undervalued. Like Thomas the Apostle, fundamentalist or restorationist Catholics earnestly seek clear-cut signs of the presence of the Lord: "Unless I can see the holes that the nails made in his hands and can put my finger into the holes they made, and unless I can put my hand into his side, I refuse to believe" (Jn 20:25). Contemporary Religious Life: Tribal Models .With the disintegration of the then prevailing founding myth of religious life, in addition to the other upheavals consequent on Vatican II, religious today are torn between the enticements of fundamentalist or restorationist solutions to the chaos they expe-rience and the painful requirements of the call to radical conver-sion. Those opting for the latter take to heart the words of Christ to Thomas: "Blessed are those who hav~ not seen and yet believe" (Jn 20:29). They recognize that the church (and religious life) is in the liminality stage of a crucial rite of passage--the pre-Vatican II church has yet to be let go and the new to be confidently cre-ated based on Vatican II values. It is a time of pain, lament, and hope. Prophets and prophetic movements are needed to create the "pastoral quantum-leaps" necessary to bring the gospel into interaction with the most.urgent needs of today--secularism and political/economic oppression for example.~s The following tribal models of contemporary religious life fall within what I will call "escapist" or "conversionist" categories. By "escapist" I mean that religious tribes within this category avoid in various ways the struggle to return to the original found-ing myth of religious life--that is, the prophetic challenging of the church and the world. "Conversionist" tribes, however, struggle to live this challenge. My purpose in offering these categories and models is to help clarify an increasingly c.omplex situation within religious life; it is not my aim to judge the subjective moti-vations of individual religious. Finally, a word of warning about the use of models. An anthro-pological model is not a perfect representation of the real world. Rather, a model is very much a necessary research construct to facilitate a better understanding of very complex situations. A model reflects reality to the extent that it highlights certain emphases or trends. For the sake of clarity unnecessary details are omitted. A situation can then be researched to discover just May-J~ne 1993 331 Arbuckle ¯ Prophecy or Restorationism how far it diverges from or conforms to the model. In practice one will rarely find in real life a perfect embodiment of a model; par-ticular qualities of many models will tend to be present, but the characteristics of one model will predominate over others. A model is not a caricature since the latter is a deliberately inaccu-rate representation of reality for comic effect; No one expects a caricature to be modified in the light of reality.~6 Category 1: "Escapist" Religious-Life Tribes The Nativistic Tribal Model. Tribal leaders claim that the unquestioning return to the symbols (for example, religious garb), myths, and rituals of.religious life before Vatican II will in some magical way resolve the loss of meaning or relevance among reli-gious. Fundamentalist and sect-like tribes that approximate to this model fanatically assume "we have the truth and the pope is on our side," yet, like all Catholic fundamentalists, they selectively read ecclesial documents to support their position and rather thoroughly ignore the social teaching of the popes. These com-munities withdraw from the "contaminating world" (which they look upon with considerable doom and gloom), refuse all dia-logue with their opponents, and avoid any critique of restora-tionism in the church. In fact, they are zealous supporters of ecclesiastical restorationism. Prayer is stressed, but only the pre- Vatican II forms that highlight a personal or privatized holiness removed from the world's concerns. They cultivate, as the Puebla document says, "a spirituality of evasion.''~7 Candidates are encouraged to join, but screening and training programs are inadequate for the demands of today's apostolic work. The more who join, the more certain nativistic tribes are that God loves them. In brief, they place the survival of their con-gregation over their commitment to the full mission of the church. The Conservative Tribal Model. In the conservative model, lead-ers are moved by the numerical success of sect-like and restora-tionist lay movements within the contemporary church; they uncritically encourage the return to pre-Vatican II traditions-- for example, quasimonastic structures for apostolic communities, traditional religious habits, and pious customs--but with less fanaticism than nativistic leaders. Souls are to be converted to the Lord, compassion shown to the poor, but the faith/justice 3 3 2 Review for Religious apostolates are to be avoided as irrelevant and dangerous to one's consecrated vocation. Conformist-oriented candidates are encour-aged to join these tribes, particularly if they have above-average needs for security and identity. Dependency and conformity are valued "virtues" in this model as in the previous one. New forms of prayer are allowed--as, for example, in the charismatic movement--provided they do not lead to involve-ment in the social-justice apostolate. Asceticism is an esteemed virtue, but within the narrow limits of the individual's journey to the Lord or as a way of encouraging him or her to submit to authority and the congregational status quo. Liberation theology and inculturation are considered dangerous "leftist" ideologies, and criticism of ecclesiastical restorationism is not considered necessary nor encouraged. The Millenarian Tribal Model. Millenarian movements immi-nently and dramatically expect the miraculous transformation of the world by supernatural methods. In millenarian religious tribal life, all forms of instant-holiness or inner-peace programs are .offered by tribal leaders--for example, encounter-group sessions, bodily relaxing techniques, immediate-union-with-God prayer sessions. Pastoral planning programs are formulated with the assurance that they will automatically lead to an increase in voca-tions. Often, as a sign of one's authentic conversion, in true mil-lenarian style religious indiscriminately discard as "old-fashioned" any reference to the past; thus, for example, the great spiritual traditions of Saints Teresa and John of the Cross are seen as of lit-tle or no value.Is Religious keep searching feverishly from one workshop to another for the "right leader, or spiritual/professional guru, to describe the latest way to inner peace and a firm sense of direc-tion" for themselves personally and their congregations. Try harder, they feel, and the correct miraculous technique will turn up eventually. Leaders and followers are so concerned about inner-peace and identity issues that ecclesiastical restorationism and the apostolic demands of the world are of little concern to them. The Therapeutic or "Me-istic" Tribal Model.19 In the previous tribal model, religious do have concern for the welfare of the group and its future, even though it be in an introverted way. However, group life and concern for its future are of minimal importance to the therapeutic tribal model. Tribal life is marked by individualism, excessive concern for self-fulfillment, and uncrit- May-a~une 1993 333 /trbuckle ¯ Prophecy or Restorationism ical acceptance of secular consumer or material standards. The group andits leaders exist solely to support the narcissistic, indi-vidualistic, and independent aspirations of its members. There is a paradox in this tribe: rampart individualism on the one hand and the desperate need for personal affirmation and support from other tribal members on the other. Individuals may undertake important apostolic work, but it is done with little or no reference to their religious tribal com-mitments or vision. In other words, the links between members and the corporate vision are so weak that the tribe is equivalently a social club; a typical attitude would be: "I remain in touch with my community only as long as it serves my needs." If restora-tionism is criticized, it is only because it is thought to be an obsta-cle to the pursuit of individualism and personal self-fulfillment. The prophetic corporate commitment of religious life within the church and the world has no meaning in this tribal model. The Neo-Conservative T~:ibal Model. Religious gather around leaders who were once fervent advocates of change, but have now become overly fearful of the chaos and the extremes of attempted adaptation programs they see around them. They believe that only slow, measured ox~ predictably safe apostolic adaptation to the world will achieve new expressions of religious life. Orderly pastoral planning becomes an ideology or an end in itself, not a condition for bold creative apostolic action in response to the most urgent pastoral needs of the world. There must be no diver-gences from the pastoral plan lest chaos erupt.2° "Risk is out, order is in" becomes axiomatic. It is assumed that revitalization can occur only if the whole community or congregation moves in response to agreed-to mis-sion statements and strategic pastoral planning. Intra-group ten-sions and conflict are to be avoided at all costs: "Let the province move when all are ready and willing to do so; otherwise no change is to be sanctioned." The sense of belonging to or affiliation with the congregation is viewed as more important than the struggle for the religious community to realize its primary task of prophetically challenging a secularizing world and the church. Creative religious who believe that chaos requires a more rad-ical linking between the gospel and cultures are marginalized or pressured out of the community since they threaten the group's desire for an orderly approach to refounding. The faith/justice apostolate is only lightly supported lest involvement in it disturb 334 Review for Religious the unity of the community. Any critique of restorationism is couched in unchallenging or vague tones for the same reason. The Radical Non-Conversion Tribal Model. These tribes are led by people who have a vision of a radical, social-justice program. However, because the faith values of religious life do not impinge on their consciousness, they see themselves only as social workers, activists, or enablers of others. Their view of the gospel is limited only to the procla-mation of forms of liberation. They do not see that their "contribution to lib-eration is incomplete if [they] neglect to proclaim salvation in Jesus Christ.''2t Tribal life in this model is very fragile; either people withdraw from religious life since it no longer has any meaning for them, or they remain, generally with bitterness against their congregation and the church, living The ultimate identity of religious comes from their faith in the person of Christ and his mission to the world, especially to the marginalized and powerless. highly individualistic lives, refusing any effort to work toward an authentic religious-life vision. There is an un-Gospel-like harsh-ness to their criticism of restorationism within the church. Category 2: Transformative/Refounding Tribal Model Tribes within this, category are transformative or prophetic communities recognizing that the only way out of the chaos is through radically new faith-justice, hope-inspired, corporate action in which the gospel message is directed to the most urgent needs of today. The ultimate identity of these religious tribes comes from their faith in the person of Christ and his mission to the world, especially to the marginalized and powerless. The chaos is seen in biblical and anthropological terms as potentially a graced experience--the chance to rethink the mission of religious life and the tribe's commitment to it. Hence, for exam-ple, these religious tribes struggle to be living witnesses to the radical demands of prayerful asceticism in opposition to the sym-bols of consumerism and "instant spirituality"; living witnesses to the virtue of hope in order to counter symbols that seek to May-ffune 1993 335 Arbuckle ¯ Prophecy or Restorationism negate any redemptive and eschatological power of suffering; liv-ing witnesses to the need to dialogue with the world so as to counter the elitism/sectarianism of restorationist Catholicism; living witnesses through their lifestyle and attitudes to God's mercy, Jesus Christ, in concern for the alienated and the oppressed; living witnesses to vibrant community-life relation-ships founded on interdependence, mutuality, and faith sharing to counter the symbols of excessive individualism, abuse of author-ity/ power in society and in the church; living witnesses to a spir-ituality of involvement with the world, especially the powerless, to counter a spirituality of evasion.22 Through their imaginative, faith-oriented action they create a new founding myth of reli-gious life, a vision in which creative and prophetic action is an integral and primary quality. For these transformative tribes, it is Christ's mission that has priority, not the physical survival of the community. If they dis-cover it is God's will that they are to die, then they accept this as the chance to enter more deeply into the mystery of Christ's suf-fering and resurrection. Consequently, if people do ask to join these tribes, they are accepted only if there are well-founded hopes that these candidates have the demanding qualities of maturity to live and work on the prophetic edge of the church and the world. These communities foster within themselves prophetic or refounding persons who are able to relive within today's context the experience of the original congregational founding people. They are pained to see the void between the gospel and the needs of the world; so, like their original founding members, they move to create pastoral strategies to bridge this gulf. They, together with others in their communities, are dreamers who do. These are rest-less or liminal people in the sense that they are on the edge of what is considered to be the "correct or predictable" way of being reli-gious; they are prepared to critique everything according to gospel values. Not surprisingly, therefore, they and their communities evoke anxiety within tribal groups of category 1; their vision is too threatening so marginalization, tribulation, and suffering are their inevitable lot (as has commonly been the case with founding peo-ple of religious communities over the centuries).23 These apostolically risk-oriented leaders and prophetic tribes maintain their zeal only as long as they prayerfully admit to their own inner powerlessness without the grace of God. Once they allow their own attachment.s to the predicable to go, they repeat- 336 Review for Religious edly rediscover, as did the lamentation psalmists of old, that noth-ing is impossible to them through the mercy and love of the Lord.24 Restorationism is critiqued with a boldness of apostolic faith, love, and compassion because they take to heart the fact that "Christ summons the church., to that continual reforma-tion of which she always has need, insofar as she is an institution of [people] here on earth.''2s Conclusion In the centuries immediately before Vatican II, religious life had become a bastion of the unchanging status quo within the church. We even called it the "religious state." But by its origins it .was never intended to be something static, but an ongoing expe-rience of prophetically becoming in reaction to the ever-changing apostolic needs of the world. Once religious say they "have got it all together," then they have lost their passion for creative gospel life. Today, Paul VI said, the "split between the gospel and culture is without a doubt the drama of our time,''z6 so religious to be true to the original founding myth must be at the cutting edge of the gospel and culture. This is an inescapably agonizing experience, for it means cri-tiquing not just the world but also the church itsel~---a church in which the forces of restorationism are daily more visibly present. Religious life is in the stage that anthropologist Victor Turner terms liminality,27 that is, the betwixt-and-between stage; the unnecessary structural constraints of the former state of religious life have gone, and the reinvigorated founding story of prophetic action has yet to emerge with confidence. It is a stage rich in imaginative apostolic potential for the future. But it is also a dan-gerous phase for those religious who are excessively frightened of the darkness of uncertainty and ambiguity. They are tempted to flee into the false comforts of restorationism and to reengage uncritically the structures of pre-Vatican II religious life, seeing around them "nothing but prevarication and ruin"ZS--the defeatist attitude John XXIII warned us against. When this happens, these religious turn their backs on what is the most exciting and prophetically stimulating period for religious life in centuries. May-~une 1993 337 Arbuckle ¯ Prophecy or Restorationism Notes ' R. Linton, The Study of Man: An Introduction (Appleton-Century- Crofts, 1936), p. 231. 2 Edward Hall, Beyond Culture (New York: Doubleday/Anchor, 1976), p. 43 3 Johannes Metz,F0110wers of Christ: The Religious Life and the Church (Exeter: Burns and Oates/New York: Paulist, 1978), p. 12; see also an analysis of the prophetic nature of religious life by D. O'Murchu, Religious Life: A Prophetic Vision (Notre Dame: Ave Maria, 1991). 4 See G. Arbuckle, Earthing the Gospel: An Inculturation Handbook for the Pastoral Worker (London: Geoffrey Chapman/Maryknoll: Orbis Books, 1990), pp. 26-43; see also M. Eliade, The Myth of the Eternal Return (New York: Bollingen/Pantheon, 1954), chap. 1. s See Arbuckle, Out of Chaos: Refounding Religious Congregations (New York: Paulist/London: Geoffrey Chapman, 1988), pp. 68-77. 6 See "The Church in the Modern World," The Documents of Vatican II, ed. Walter Abbott (London: Geoffrey Chapman, 1966), §44; for expla-nations see Arbuclde, Earthing the Gospel, pp. 15-20. 7 See "The Church," §40f. 8 See M. Douglas, Natural Symbols: Explorations in Cosmology (New York: Pantheon, 1970), p. 38. 9 See Arbuckle, Out of Chaos, pp. 14-28. ,0 See explanations by Norman Cohn, The Pursuit of the Millennium (New York: Oxford Un!versity, 1970). ~l For an overview of world fundamentalism see Concilium, no. 3, 1992. ¯ ,2 "Reemergence of Fundamentalism in the Catholic Church," in The Fundamentalist Phenomenon, ed. N. Cohen (Grand Rapids: William B. Eerdmans, 1990), p. 174. ~3 "Fundamentalism in Its Global Contours," ibid, p. 63. ,4 See overview of Catholic fundamentalism by T. O'Meara, Fundamentalism: A Catholic Perspective (New York: Paulist, 1990), passim, and Patrick Arnold, "The Rise of Catholic Fundamentalism," in America, 11 April 1987, pp. 298-302. *s See Arbuclde, Earthing the Gospel, pp. 187-220. ,6 For an analysis of the nature and usefulness of anthropological mod-els see L.C. Luzbetak, The Church and Cultures (Maryknoll: Orbis Books, 1988), pp. 135-139. ,7 Final Document, Conference of Latin American Bishops, 1979, § 826. ~8 See T. Merton, "Cargo Cults in the South Pacific," in America, vol. 121, no. 5, 1969, p. 96. ,9 See a fuller development by Arbuclde, "Suffocating Religious Life: A New Type Emerges," in The Way Supplement 65 (1989): 26-39. 338 Review for Religious 20 For insights into the dangers of overplanning see R. Stacey, Managing Chaos (London: Kogan Page, 1992), pp. 43f., 208. 2, Evangelii Nuntiandi, 1975, §47. zz See Arbuclde, Strategies for Growth in Religious Life (New York: Alba House, 1986), p. 41. 23 See J. Lozano, Foundresses, Founders, and Their Religious Families (Chicago: Claret, 1983), pp. 65-70. 24 See Arbuclde, Change, Grief and Renewal in the Church OgVestminster, Md.: Christian Classics, 1991), pp. 61-107. 2s "Decree on Ecumenism," Abbott, §6. 26 Ibid, §20. 27 See V. Turner, The Ritual Process: Structure and Anti-Structure (New York: Aldine, 1969), p. 95. For a summary of Turner's insight into limi-nality see Arbuclde, Earthing the Gospel, pp. 74f. 28 "Open!ng Speech to the Council," Abbott, p. 712. Will He? Veils gone, Securities gone, "Respect" gone. Adulation and ~. Convent-mysteries All gone. Can I sing my Song of Songs to Him In the rags of who I really am ? Will He love me still? Without my baubles And my cover-ups, Will He still love me? Crushed in His arms, 0 wonder of it all! I came to know That, in my poverty, He loves me Twice as much! Maxine Inkel SL May-~'ane 1993 339 DIANNE BERGANT Would That All Were Prophets witnessing In 1989 the joint assembly of the Leadership Conference of Women Religious and the Conference of Major Superiors of Men (LCWR/CMSM) drew up ten charac-teristics of the "transformative" religious life of the future. The first of these, prophetic witness, is described as fol-lows: "Being converted by the example of Jesus and the values of the gospel, religious in the year 2010 will serve a prophetic role in church and society. Living this prophetic witness will include critiquing societal and eccle-sial values and structures, calling for systemic change, and being converted by the marginalized with whom we serve." The following reflections have been prompted by this statement. "Behold, I am doing a new tbing" (Is 43:19) Before we discuss prophetic witness, we should briefly consider prophetic insight: Why is prophetic insight needed? Where does it originate? Prophetic insight is born in times of crisis, in its basic Greek meaning of decision and not its popular-usage meaning of misfortune or distress. In a time of crisis, a community is at a turning point and needs some kind of decisive direction--or the community should be at a turning point but, failing to recognize this, needs someone to call it to repentance and reform, to conver- Dianne Bergant CSA presented the substance of this article in a talk to the chapter members of her congregation, the Sisters of St. Agnes. Her address is Catholic Theological Union: 5401 S. Cornell Avenue; Chicago, Illinois 60615. 340 Review for Religious sion, to turning. But, of course, a community is not always at some kind of crossroads; and, if it is relatively faithful to its nature and ideals so that its members encourage and inspire each other, it may not need, for the time being, any distinct and indepen-dent prophetic insight. When prophetic insight is needed, where will it come from? One cannot casually assume it in oneself; not every member of the community is blessed with it. While it is the fruit of a very personal relationship with God, it includes perceptive insight into the reli-gious implications of "the signs of the times," an insight that calls for decision and usually for some kind of change. Prophetic insight is lit by the flame of passionate attachment to the religious tradi-tion. It is critical, not for the sake of being critical, but for the sake of the word of God. Illumined by this word, it perceives either the faithfulness of believers to their religious identity or a lessening or lack of this faith-fulness. It sees clearly what people should embrace within society in order to deepen their commitment to life and to God, and it sees what they should avoid. Prophetic insight assesses the values of contemporary society with eyes of discerning faith, recogniz-ing any distortions and, on the other hand, relating society's authentic values to their divine source. The biblical prophets did not call for change for the sake of change. They spoke out when they were convinced that their communities were in peril. They were often alone as they chal-lenged the institutions and practices that limited and sometimes shattered the lives of their communities. At times the threat fac-ing .their communities was evident to all. For example, King Ahaz was well aware of his predicament when Isaiah warned him against Assyrian entanglement (Is 7), as was King Zedekiah when Jeremiah spoke to him (Jr 27). At other times the threat was more insidi-ous, and the community seemed oblivious of its surrender to seductions that compromised its religious identity. We read that Amos condemned the Israelites for disregarding their covenant responsibilities in favor of material prosperity and that Hosea denounced the people of his day for yielding to the religious prac-tices of the Canaanites. The prophets seem always to have been Prophetic insight is lit by the flame of passionate attachment to the religious tradition. May-June 1993 341 Bergant ¯ IVould That All Were Prophets convinced that the situation had to change because it threatened the community's relationship with God. Prophetic insight and satisfaction with the status quo are seldom compatible. The prophets usually found themselves in conflict with offi-cial leaders. This was not because they disdained authority or authoritative organization, but because the leaders were respon-sible for public policy and for the social and religious structures that supported that policy. Therefore, when those in responsible positions failed to lead as the religious tradition directed them or when the policies and structures themselves created divisions of privilege or marginality, the prophets denounced the status quo and called the community to a new vision. They seldom, if ever, proposed specific new approaches to the problems. They were the visionaries, not the policy makers. They were the ones who called for a new society; others would work to fashion such a society in line with the prophetic insight. We must not confuse prophetic with apocalyptic, which also grows out of a dissatisfaction with the prevailing situation. Prophetic insight, whether it is reassuring people of divine com-passion and care or warning them of God's indignation and jus-tice, is fundamentally positive. It knows that human history with all its possibilities, challenges, and risks is the matrix within which the reign of God takes shape. Down amid social, economic, and political reality, such insight is neither ignorant of nor removed from the needs, aspirations, movements, and accomplishments of society, for it believes that it is within society that God is revealed. A genuine prophetic spirit is fashioned and enlivened by the ener-gies of the day. It is not a spirit of the past or, for that matter, of the future, but of the present. It knows that God is immanent and continually involved in the lives and history of people here and now. No event, no moment in time, is beyond the realm of God's activity. Authentic prophetic i,nsight insists that human beings can indeed influence the course of history and, with divine assistance, can bring .to birth the reign of God. "Apocalyptic" comes from the Greek word for revelation. Since it refers to a divine message about the end of the world, in the minds of many it is associated with prophecy. It maintains that the world and all within it must be purged before it can enjoy that for which God intended it, and it believes that this purgation will be individual, social, and cosmic. For this reason an apocalyptic atti-tude is fundamentally pessimistic. It not only challenges but rejects 342 Review for Religious the prevailing social, economic, and political reality. It does not encourage involvement in the world in order to transform it. Instead, it advocates separation from the world in order to pre-vent contamination. An apocalyptic point of view contends that sinful history is ultimately and exclusively under divine control, and therefore it awaits the defeat of evil and the triumph of good-ness. It believes that only after purgation will the new age appear and God's reign be victorious and unchallenged. While prophetic fervor drives people into the marketplace (for example, Jesus going from village to village proclaiming the reign of God), apocalyptic zeal frequently bids them escape into the desert (for example, the Essenes of Qumr~n waiting for the reign of God to come). At times prophetic insight has been confused with an apostolic spirit, which also calls for decision, repentance, .and reform and is also 6ommitted to the transformation of the world. The word apos-tle comes from the Greek for "send," and it stresses the intimate relationship between t~he sender and the person sent, rather than any message that may be involved. In a veery significant way, the one sent actually represents the sender. "Those who hear you, hear me; and those who reject you, reject me" (Lk 10:16). Paul under-stood his call in this way: "So we are ambassadors for Christ, God making an appeal through us" (2 Cor 5:20). Such an intimate rela-tionship between the apostolic minister and the Lord is more than a matter of personal holiness. It is inextricably li.nked with repre-sentation of the Lord to the world. This is quite different from the situation of the prophet, where the focus is not on the person sent but on the message sent. Belief in the power of the word itself is clearly seen in a passage from Second Isaiah(55:10-11): For just as from the heavens the rain and snow come down And do not return there " till they have watered the earth, making i( fertile and fruitful, Giving seed to those who sow and bread to those who eat, So shall my word be that comes forth from my mouth; It shall not return to me void, but shall do my will, achieving the end for which I sent it. Insisting on these distinctions does not suggest that an apos-tle cannot also be prophetic Or that a prophet may not at times May-June 1993 343 Bergant ¯ Would That All Were Prophets entertain an apocalyptic attitude. Rather, it is to point out that these perspectives are in fact different from each other. "Your sons and your daughters shall prophesy" (J1 3:1) The LCWR/CMSM statement speaks of conversion, critique, and change, language that implies that religious life is indeed at a crossroads. It further claims that "religious in the year 2010 will serve a prophetic role in church and society." Such a claim pre-sumes that an entire body of people will enjoy a kind of insight When the community finds itself at a crossroads, prophetic witness becomes more crucial and even more complex, because there is ambiguity among the members regarding it. that is normally not communal. This prompts us to ask: How can we ascribe prophetic witness to the whole group without compromising the power of unique prophetic insight? In answering this question, we must remember that religious commu-nities are made up of the daughters and sons of foundresses and founders, who critiqued the dominant social and reli-gious cultures of their times and found them wanting and who, as a result, brought new vision and devised new ways of living in the world and in the church. They frequently called for repentance and reform; they always called for decision. Their visions, their insights, became the charisms of their religious families. Because these charisms were always in some way prophetic, fidelity to tMm will always result in a form of prophetic witness. This will be true even when a community does not face a time of crisis, for devoted living out of the founding charism is the fundamental prophetic ideal to which members always commit themselves. Rededication to the ideals of the com-munity does not always call for prophetic insight, but it always demands faithful commitment. However, when the community finds itself at a crossroads, prophetic witness becomes more crucial and even more complex, because there is ambiguity among the members regarding it. It may be that social changes call for a new and contemporary inter-pretation of the founding charism (for example, the early Christian controversy regarding the admission of the Gentiles and the 344 Review for Religqous observance of the Law [Acts 16]). When this is the case, a com-munity faces a serious challenge. It must choose which guidelines to follow in critiquing the social change itself, and it must decide how the integrity of the charism can be guaranteed even as it is reinterpreted. The community as a group must discern how to address this challenge faithfully, and communities do not always achieve consensus on such matters without difficulty. On the other hand, the group may have lost its prophetic edge and may be itself in need of prophetic critique. Such a cri-tique should come from within the community, from an insider who knows the charism intimately and can bring its challenge to bear upon prevailing community understandings that are inade-quate. But who can perceive and articulate the hopes and ideals of the community in such a way as to speak both to it and for it? The community must discern this matter as well. (An example of such a dilemma is the ill-fated clash between the prophets Jeremiah and Hananiah [Jer 28].) Since the charism is to be found within the group and not merely in the intuitions of one individ-ual, the community must be able to recognize itself in the insights of its perceptive member or members. The task of a community at a crossroads is twofold: (1) a crit-ical examination of "the signs of the times" in order to discern the real religious needs of the moment and (2) a thorough anal-ysis of its established religious institutions and practices in order to discover their underlying traditional religious value. Only after such examination and analysis can the community hope to bring to bear on contemporary needs the traditional religious values that flow from its charism. It is not enough to approach this task with faith and commitment. Serious examination, rigorous eval-uation, and faithful yet imaginative reinterpretation are required, all of which call for extensive information, keen insight, and cre-ative visioning on the part of each member and the community as a whole. Not every member will be proficient at each step in this analysis and reinterpretation, but if each member has been formed in the founding charism, everyone will be able to enter into the process in a thoroughly beneficial manner. It is in this way that prophetic witness can be ascribed to the whole group without compromising the power of unique prophetic insight. "Behold, I make all things new" (Rv 21:5) Time and again we have heard it said that we are in the midst of a paradigm shift. May-June 1993 345 Bergant ¯ WouM That All Were Prophets Actually, because of the complexity of today's world, we are under-going the radical shift of m~iny paradigms. The ways in which we understood the world, society, human endeavor, and theology seem no longer adequate to meet and interpret the realities now facing us. The presuppositions of the modern world with its tech-ntlogic~ il achievements and its hierarchical manner 6f manage-ment are being seriously challenged. We ai'e standing on the threshold of the postmodern world, and yet we remain caught in many of the paradigms of the past. For example, we know that the patterns of growth and pros-perity which have provided many of us in the Western world with the benefits of material comfort can no longer be sustained at the same rate or for the same number of people as has been the case till now. One reason for this is that we are depleting our available material resources and are doing little or nothing to replenish them. There are limits to the environment's ability to sustain the kind of lifestyle to which the Western world has grown accus-tomed. Nature may be able to endure a certain amount of imbal-ance, but if its tolerance is exceeded it can no longer be expected to sustain our life. Despite our realization of this fact, we are still caught in a lifestyle that requires an inordinate amount of fuel for heating and for travel, of water for cooling, of paper for com-munication, and so forth. Another reason that we can no longer sustain our present pat-terns of gro.wth and prosperity is that we no~ realize that our privileged lifestyle has often been secured at the expense of the human rights of others. Frequently we are able to procure what we need or what we want at bargain prices only because workers that provide us with these products are paid wages far below what they need in order to live with dignity and hope. We already fight wars over land and the control of natural resources and at the expense of vulnerable people and nations. Still, we continue to live relatively comfortable lives while professing to be in solidar-ity with the disadvantaged. On another issue, we reject any androcentric or misogynist anthropological view that regards women as derivative. We refuse to consider ourselves natural followers rather than leaders, sup-porters rather than directors, dependents rather than providers. We have become sensitized to language and imagery that explic-itly insults, subtly minimizes, or completely disregards women. And yet at times we ourselves employ the very strategies of priv- 346 Review for Religious ilege and control, both among ourselves and with others that we believe relegated us to positions of subservience in the first place. In yet another area we are engaged in ministerial situations that call for a high degree of resilience and include extensive trav-eling. Ours is a kind of itinerant existence which demands that rootedness, a feature that is essential for any sound life, be found somewhere else than in a particular place. Despite this we are often efltangled in concepts of community that are more fitted to a sedentary lifestyle than a peripatetic one. . Finally, we have committed ourselves to the transformation of the world, a world that seems bent on greed and power and on violence in order to preserve privilege. We have taken on min-istries of advocacy; direct social service; ecological, peace, and justice activism; and the influencing of policy on all .levels of gov-ernment, and we carry out these ministries in dangerous circum-stances. We have committed ourselves to uncommon selflessness. All the same, we are often caught in the contemporary preoccu-pation with our own health, both physical and spiritual; the sur-vival of our group and our institutions, even at the price of compromised ideals; and the glorification of personal and pro-fessional accomplishments. None of the above is done hard-heartedly. Rather, things have changed either so rapidly or so imperceptibly that we have had neither the time nor the insight carefully to analyze either the old models that governed us or the new ones that are emerging. Nonetheless, we have already taken upon ourselves the task of fashioning an alternative way of living in the world, and if we are to be faithful to this commitment, we will have to examine seri-ously not only what we do but also how we do it. We will have to learn anew that the reign of God is more a process than~a prod-uct. It is brought to birth not so much in what we do as in the way we do it. Although it is in the world, it is not of the world, and this includes the world's systems and strategies. In order to bring this reign to birth, we must first acknowl-edge that this same world has played an active role in forming us into the people we have become. We possess many of its features (for example, our political and economic values), and we carry the effects of its history (for example, our inherited preferences and prejudices). Although it plays sugh a formative role in our lives, we are not always aware of the ways in which our particu-lar worldview promotes our own well-being and enhances our May-.l~une 1993 347 Bergant ¯ IVould That All 14Zere Prophets lives. It is very easy to take for granted the attitudes and mores into which we have been socialized and to presume that they and only they offer a way of dignified human living. Yet how will we be able to transform the world if we are not even aware of how We must listen to the marginal, not because their way of living and coping is better than ours, but because they help us to see what is wrong with a system that makes people marginal in the first place. much we are embedded in that world and its values, and how much that world and its values are embedded in us? Usually it is only when people feel restricted or in some way diminished (in other words, when they are not members of the dominant or influential group of the culture) that they question the justice of the restriction and then of the underlying rea-sons for it or for the continuation of it. This explains why those who suffer oppression or who are relegated to marginality or invis-ibility within a group are sometimes better critics of that group than are those who are privileged and satisfied. We must listen to the marginal, not because their way of liv-ing and coping is better than ours, but because they help us to see what is wrong with a system that makes people marginal in the first place. But even this may not be enough. We may need someone's prophetic insight to uncover for us our own complicity with such systems and with the world that we hope to transform. We may need to listen to the voices in the world and in the church that offer us insights that, left to our own devices, we may not be able to gain; voices that call for authentic collaboration rather than subtle control, for willing cooperation rather than self-interested competition, for genuine interdependence rather than aloof independence or inappropriate dependence, for gra-cious mutuality rather than uncompromising domination, for uni-versal justice rather than selective exploitation, for unaffected respect rather than veiled disdain, for tender compassion rather than detached indifference, for the reign of God rather than busi-ness as usual. This paper ends where it began, with the challenge of the LCWR/CMSM statement: "Being converted by the example of Jesus and the values of the gospel, religious in the year 2010 will 348 Review for Religious serve a prophetic role in church and society." The task before us appears monumental, but then we are taking on the whole world. Like our predecessors in their own periods of crisis, in many ways we are in uncharted waters, but they did not drown--so why should we expect to? We are being called upon to address urgent human needs that are not only social but also religious in nature. As we work to transform the world, we are bringing to birth the reign of God. Added to this challenge is the task of developing a contemporary theological understanding of who we are and what we are doing. We may still claim meaningful religious traditions that informed us in the past, but our conventional expression of these traditions is not always helpful in the postmodern world that we face. Despite all of this, we believe that we have been called by God and that we are the heirs of a prophetic charism. We are convinced that we must be steadfast in what we do, without being unyielding. We must be bold as we face the unknown, with-out being foolhardy. We must be confident of the pervasive power of God's love, without being presumptuous. We must be creative as we face the future, without being forgetful of the past. In all of this we must be genuinely humble, for after all it is God who promises: "Behold, I make all things new" (Rv 21:5). Letterto a Friend on Her Return from Retreat in a Hermitage Don't be afraid; you bring the forest and the trees back with you. Deer roam the corners of your room; shadows hang upon the curtdins, crouch playfully upon the pane. Healing is not out there; it's within if it's at all. Deep nights and double days, the soft wool throw of quiet. Peace: you carry it with you like persistent pink impatiens in your heart. Ann Maureen Gallagher IHM May-June 1993 349 PAUL J. PHILIBERT Committed Christian Secularity tkniS difficult to profess a Christian lifestyle that is very little own and largely misunderstood, but my hope is that secu-lar institutes will become better known and much more appreci-ated. In this article I argue that the consecrated life of the professed secular Christian is the most vivid example of the ide-als of Christian living in the secular world that were put forward at Vatican Council II. In the light of this council's theology, one would expect church leaders to illustrate the radical meaning of baptism by speaking at every opportunity of'the ideals and prac-tice of members of secular institutes. Yet four years ago, when Pope John Paul II spelled out in his apostolic exhortation Christifideles Laici the "vocation" and "mission" of the lay faithful in the church and in the world, he made only the briefest refer-ence to secular institutes: In the field of a "commonly shared" lay vocation, "spe-cial" lay vocations flourish. In this area we can also recall the spiritual experience of the flourishing of diverse forms of secular institutes that have developed recently in the church. These offer the lay faithful, and even priests, the possibility of professing the evangelical coun-sels of poverty, chastity, and obedience through vows or promises, while fully maintaining one's lay or clerical state.~ Many diocesan bishops in the United States appear to be unaware of the meaning of secular institutes or unconcerned about their development. What, we may ask, does this lacuna in the ordinary teaching of the church actually mean? Paul J. Philibert oP is prior provincial of the Southern Dominican Province. His address is 3407 Napoleon Avenue; New Orleans, Louisiana 70125. 350 Revie'w for Religious One can start the assessment by noting that the present papal administration seems to be distancing itself from some of the reformist orientations of the council. For so long have we been dividing recent church history into two periods called "concil-iar" and "postconciliar" that we have failed to recognize a more complex reality which needs to be named. Like many others, I would divide these years into three periods: 1963-1965, the "con-ciliar" years, during which the council was in session; 1965 until the death of Pope Paul VI in 1978, the "postconciliar" years, dur-ing which the Vatican and most Catholic bishops endeavored to implement the liturgical and pastoral reforms of the council; and, since 1978, a period of "ecclesiastical reassessment" during the pontificate of John Paul II. One of the council fathers, who is now a retired archbishop, has said, "The council rejected triumphalism (the church has all the answers), clericalism (the church is a pyramid), and legalism (church teachings presented as laws). The church is in the mod-ern world as are its ministers. There is no retreating to being people of another world.''2 Yet, to a greater or lesser degree, all three of these orientations--triumphalism, clericalism, and legal-ism-- are creeping back into the attitudes and utterances of some church leaders. Some describe the present tendency of the Vatican as "restoration," that is, an orientation to restore things to the way they were before Vatican II. That may be too extreme a judgment, even though one can understand why some think that way. Different observers account for this retrenchment from the "postconciliar" period in different ways. Some have observed that a significant motivation for this papal administration has been to avoid schism with the Lefebvrites and other ultraconservative Catholics; they say that the Vatican has been bending .over back-wards to avoid alienating those who pretend that Vatican II never happened. Others suggest that some high officials in the Vatican believe that much that came out of the council was mistaken in its orientation and must be replaced with the preconciliar solutions. Probably more accurate is the view that many of the documents of Vatican II are compromise statements that contain the seeds of tension that are now sprouting and bearing the fruit of division and conflict over some basic notions of church. Tlie major orientations of this pontificate that seem to touch on secular institutes are centralization and institutional nostal- May-June 1993 351 Philibert ¯ Committed Christian Secularity The major orientations of this pontificate that seem to touch on secular institutes are centralization and institutional nostalgia. gia. Regarding centralization, it is hard to avoid the conclusion that some heads of Vatican congregations think that incultura-tion and diversity of practice have gotten out of hand. Cardinal Ratzinger is reported as saying that national organizations of bish-ops have gone too far in establishing their independence of Vatican control. Some American bishops, and bishops in Holland and Germany too, have been called on the carpet and chided for statements of theirs. These are examples of what I mean by central-ization. This pontificate does not want anything to be happening in the local churches without consultation with the top. As regards institutional nostalgia, the example of religious comes to mind. The pope personally or through personal del-egates working above the level of the Roman congregations has given prefer-ential treatment to certain new, conser-vative religious institutes like the Society of St. Peter and the Legionaries of Christ as well as to some small traditionalist groups that stayed with the Roman Catholic Church at the time of the excommunication of Archbishop Lefebvre. During the summer of 1992, the Holy See granted approval to a new Council of Major Superiors of Women Religious in the United States at the request of a small number of traditionalist sisters here. (They are fewer than ten percent of the religious women in this country.) This fairly momentous decision was taken by the pope at the behest of an American cardinal arch-bishop without any consultation of the three existing church lead-ership conferences: the National Conference of Catholic Bishops, the Leadership Conference of Women Religious, and the Conference of Major Superiors of Men. Among other interpretations, actions like these make one wonder if this pontificate is calling into question the principles and outcomes of the past thirty years of efforts at institutional renewal undertaken by the vast majority of religious in this country and in western Europe. What is being held up as a positive counterex-ample is the attitude and practice of a small number of religious who follow a regular'daily order and wear a distinctive habit. 352 Review for Religious Separation rather than transformation marks the spirit that is approved. I need to admit, of course, that mistakes and excesses did occur in the thirty years of postconciliar efforts at renewal. That is too obvious to miss. But it needs to be pointed out, I believe, that the Vatican seems now to single out for approval a simple return to the ways of the preconciliar period. This is what I mean by institutional nostalgia. Applying these observations to secular institutes, I note that their form of consecration does not fit well either with central-ization or with institutional nostalgia. They are trying new ways of implementing the church's ancient commitment to consecrated Christian life. Even though their commitment and spirituality are admirably in accord with the lay vocation and mission as described in Pope John Paul's apostolic exhortation, their juridi-cal and cultural independence place them somewhat outside the central preoccupations of this pontificate. In this context I now ask two essential questions: What is the vocation of a consecrated secular Christian? And how should it evolve? Institutes Described in the Code" of 1983 The 1983 Code of Canon Law describes secular institutes carefully. Their members share a radical commitment to Christian witness and apostolic endeavor. The charism given to secular institutes and recognized by the church is to united Christian commitment and secular presence in the world. Members remain lay or diocesan priests, even though they receive a canonical sta-tus in view of their profession of a consecrated life. The 1983 Code has abandoned the term "states of perfec-tion" and, above all, the language of Provida Mater (1947), which allowed one to think that there was a sort of hierarchy of institutes of perfection which placed members of secular institutes within a third rank. Canon 710 says: "A secular institute is an institute of consecrated life in which the Christian faithful living in the world strive for the perfection of charity and work for the sanctifica-tion of the world especially from within." The use of the cate-gory "consecrated life" allows the possibility of avoiding reference to the category "religious." In the eyes of the present Code, "reli-gious" and "seculars" are two categories of consecrated life of equal dignity. May-June 1993 353 Philibert ¯ Committed Christian Secularity Canon 713, §2, indicates that lay members, in the world and operating in a secular manner, participate in the church's evan-gelizing task in various ways: (a) by means of the witness of their Christian life, (b) by their fidelity to their profession of the evan-gelical counsels, (c) by their "efforts to order temporal things to God," and (d) by shaping the things of the world so that they are enlivened by the spirit of the gospel. "Also, they cooperate in serving the ecclesial community, according to their particular sec-ular way of life" (c. 713). Members of secular institutes are called to strive for the per-fection of charity. The ultimate purpose of secular institutes is apostolic. Their apostolate is the expression and the exercise 6f their consecration. As to lifestyle, the Code of 1983 is insistent upon the secular dimension of their living. Neither common life nor religious garb is to be imposed upon members) Consecration vs. Commitment Let us linger for a moment on the term "consecration"; it is the source of a great potential misunderstanding. Almost thirty years ago, Father M. D. Chenu (the gre, at French Dominican theologian who died in 1991) pointed out that the term "consecration" was loaded with ambiguity when employed in a context of relation or service to the world. The word, from the Latin for "to make sacred," supposes an opposition between the sacred and the profane. Is it, asked Chenu, a useful term.at precisely the moment when the Roman Catholic Church is articulating its openness to the world and its embrace of the ordinary conditions of human expe-rience (see Gaudium et Spes)? Historically the word "profane" meant "not pertaining to that which is sacred or holy," from the Latin for "outside the temple." So, Chenu argued, we would do better in this age to leave aside the term consecration, which suggests an oppo-sition to the secular (the nonsacred) and to express the intensifi-cation of a Christian life with a word like commitment.4 Chenu was at the time in search of the authentic meaning of religious life. His remark is even more pertinent to the vocation of members of secular institutes. Chief among their stated goals is to witness to the fullness of a lay vocation or (in the case of ordained members) of baptismal maturity in a world of secularity. The key issue, it seems, is how to be an active participant in sec-ular life and at the same time to be an exemplary Christian. 354 Review for Religious Secular and Christian What is authentic secular living, and what is authentic Christian witness? One of the meanings of the word secular (from the Latin saeculum, meaning "age") is "pertaining to the spirit of the age or the character of the times." This may refer to things like clothing styles and popular music, but is there a deeper mean-ing too? What is the most profound challenge of our age? I think that the answer lies somewhere within the interplay of political and religious phenomena. We are coming out from what was sometimes called "the age of alienation" or "the age of anxiety." Not that all alienation and anxiety are over and done with, but the world seems to be mov-ing out from under the cloud that threatened us for 45 years with nuclear destruction. It is amazing, now that the Cold War is ended, that there is not more acknowledgment and analysis of the waste of wealth on arms of cosmic destructive power. If the trillions of dollars spent on armaments in the past five decades had been available for peaceful solutions to world problems, we could have eliminated illiteracy and starvation and attacked poverty and disease. We were victims of irrational fear for fifty years; now that period is passing. The demise of the major communist governments is another symbol of a changing age. The irony is that Karl Marx devised the philosophy of communism as a response to "alienation"--people not being able to participate meaningfully in the economic and political processes that governed their lives. The tragedy is that the government of the Soviet Union under Lenin and Stalin became instead a totalitarian dictatorship that was even more alienating than the corrupt government to which it was reacting. Marx's issue, though--participation versus alienation--is still the issue. Here in the United States, at the end of an overlong pres-idential electoral campaign, it is not at all clear that people are pre-pared to participate vigorously in politics, We have been alienated by the media and by the deviousness of the c~ndidates themselves from truly raising or genuinely addressing the issues that are the most significant for our nation as a whole. In the religious world, participation versus alienation is like-wise a key issue. One analysis of the Second Vatican Council and its aftermath is that the dominant social reality of this age has been to promote full participation in church life--worship and administration included--to all those who, by their baptism, are May-ffune 1993 355 Philibert ¯ Committed Christian Secularity entitled to dynamic interaction within the "body of Christ." Forty years ago we would never have conceived of a woman eucharistic minister, a lay pastoral administrator, or a nonclerical chancellor of a diocese. Now we have all these things and have learned to take them for granted. Despite the fact that more progress has been made in securing entitlements to church office for lay people in general and women in particular in the past fifty years than in the previous fifteen hun-dred years, there is nonetheless strong agitation for even more par-ticipation, includinglthe ordination of Catholic women to priestly service. It can be argued that to be authentically "secular" today is to take a stand for the promotion of rightful participation of all persons in the structures, processes, and decisions that shape their lives and shape the communities in which they live. Authentic Secularity Authentic secularity includes three Cs: conversation, com-passion, and conversion. Social psychologists have argued that people enter into a new form of relation when they treat others not as strangers or inferiors, but equals. This is what I mean by "conversation." A conversation is marked by give-and-take, by listening as well as speaking, receiving as well as giving. This atti-tude, when adopted intentionally, empowers others. It opens us to the perspective of another despite distances of role and situation. It favors the understanding and fellow feeling that we generally call "compassion." Living this relation of conversation and com-passion promotes experiences of "conversion." Here conversion means for me a reorientation that makes us eager to promote the growth and freedom of others. By this conversion, one becomes an agent of liberation and a facilitator of the moral and emotional maturity of our neighbors in this world. My effort to spell out the agenda of authentic secularity in our age of transition has remained rather general and abstract, but I hope that these ideas may stimulate recognition of these patterns or possibilities in yourself. I hope you will notice that many people are still marginalized from government and the econ-omy, education and the church, and that their true well-being can be promoted through their fuller participation in these things. The promotion of such participation is a clear responsibility of those who have secular integrity .at heart. 356 Review for Religious Authentic Christian Witness Beyond secular integrity, how does one integrate authentic Christian witness with it? How is one authentically Christian today? First, I would observe that the key issue here is more akin to pol-itics than to piety. I use "politics" in Plato's classical sense, mean-ing the ethos and the discourse of a people. Of all the dynamic changes that have touched the lives of American Catholics as a result of Vatican II, none has been as important or as far-reaching as the transformation of our sense of church. We no longer see Sunday worship as sacred theater. We see that we are each church, but not as isolated consciousnesses, isolated pieties, or isolated agendas. We are church as part of an organic cooperation and growing solidarity in the gospel and in the Holy Spirit. The council's mos~t dramatic theological paradigm shift, according to most theologians, was the fresh view of the church as the people of God. This view was the fruit of decades of the-ological work, especially biblical research and exegesis, liturgical studies, and the reinstitution of adult catechesis in northern Europe in the period between the two world wars. All three of these streams of research found it important to stress the theo-logical continuity between the Old Testament and the New. The opinion that the Old Testament's God was thunderously severe and arbitrary while the New Testament's God is forgiving and gentle was seen for the simplistic misinformation that it was. Better biblical texts and better exegesis, based not upon early Latin translations, but rather upon ancient Hebrew manuscripts, allowed several generations of biblical scholars and theologians to appreciate the theology of the Old Testament for what it was, a testament of mercy and salvation. The key concept of both tes-taments, which unified the revelation of the ages, was that of a people called and saved by God from alienation and absurdity. From the call of Abraham through the story of the sons of Jacob, the Egyptian slavery and the exodus, the kingships and the exile, and the times of the prophets and the remnant, one message dom-inated salvation history. God called and chose a people to become his very own so that they could bear witness in their very existence to his transcendent reality and mercy. The theology of Vatican II places this truth above all others, forcing other themes of theology and other pastoral insights to adjust to it. God calls a people to be the visible expression of God's way with the real. The descendents of Jacob, Israel, heard May-.l~une 1993 357 Pbilibert ¯ Committed Christian Secularity In Jesl, ls ~ God was again calling a people to be his own--. this time a people so closely identified with Jesus the Lord as to be calledhis "Body." (despite disbelief and temptation) and were haunted by God's call until they became the Judaism of history. Jesus came to call them into an intimate relation of love, forgiveness, and transformation by revealing the mystery of the triune God. But many of them rejected the Messiah Jesus, and the story of God's people reached a new moment in the followers of Jesus. These followers carried the "good news" to the nations, while Israel "hardened its heart" once again. But the fundamental truth did not change: in Jesus, God was again calling a people to be his own--this time a,~ people so closely identified with Jesus the Lord as to be called his "Body." It may be that in this theological insight lies the greatest challenge of all for members of secular institutes. For reasons largely associated with the ori-gins of secular institutes in hostile, anti-clerical societies, the institutes adopted the principle of discretion or reserve. One characteristic of this is that the members are not to lead a lifestyle pub-licly distinct from that of their neigh-bors. Part of their "secularity" is their immersion in the ordinary. A public religious profession or an unusual lifestyle would deny institute members access to the are-nas of.activity and witness in which they hope to use their apos-tolic energies: the place of work, casual neighborhood conversations, and the deliberations of university faculties, gov-ernment agencies, and community assemblies. This kind of anonymity--not publicizing their secular- institute commitment-- need not keep members from active involvement in a local parish's liturgical and apostolic life, but institutes differ in encouraging their members to lend their energies to the shared life and apos-tolic projects of their parish community. An authentic Christian life, however, is, as I said above, an ecclesial life. The institute members must always reflect the call of God to all Christians to be part of the people, of God and to give solid witness to God's presence and mercy in the midst of a hurting world. Therefore, they need to guard against such things as escapism, a piety .that is self-absorbed rather than apostolic, 358 Revie~ for Religious and a manner of liturgical participation that avoids involvement with the worshiping community. The ministry of reconciliation and atonement of the Lord Jesus can be seen as a work of solidarity with those who had become alienated from the forgiving and empowering word of his Father. As Vatican II's Constitution on Divine Revelation puts it, "Jesus perfected revelation by fulfilling it through his whole work of making himself present and manifesting himself: through his words and deeds, his signs and wonders, but especially through his death and glorious resurrection from the dead and final send-ing of the Spirit of truth." The central challenge to our moment of time from the gospel is that of visibly joining the dynamics of faith and of social trans-formation. I have been trying to evoke a general sense of the issues that are involved in this joining. But now it is time to turn to the admirable text of Pope John Paul II that followed upon the synod of bishops of 1987 and in which he summarizes the synod's theological insights. Christifideles Laici At the heart of the pope's message in Christifideles Laici is the assertion that lay Christians can bring to the frontiers of society a presence of the church that is unique. As the council's Dogmatic Constitution on the Church Says, "The laity are called in a spe-cial way to make the church present and operative in those places and dircumstances where only through them can she become the salt of the earth" (§33).5 It is the secular insertion of the laity that is the treasured aspect of their witness, in the pope's analysis. He says, "In particular, the lay faithful are called to restore to creation all its original value. In ordering creation to the authentic well-being of humanity in an activity governed by the life of grace, they share in the exercise of the power with which the risen Christ draws all things to himself and subjects them along with himself to the Father, so that God might be everything to everyone" (§14). The pope interprets the secular character of the lay Christian as a theological dimension of the experience of being Christian. It involves living in the world and transforming it through the exer-cise of "every one of the secular professions and occupations." It involves their relationships with family, friends, professionals, members of society, and authorities of the civil order. May-June 199.~ 359 Philibert ¯ Committed Christian Secularity The pope's theological affirmation appears to be that living and working in the context of ordinary reality from motives of faith in God and love for our human fellows is in itself an exercise of grace with the power to influence and ennoble human exchanges. The pope makes an unusually strong statement in saying: The images of salt, light, and leaven taken from the gospel, although indiscriminately applicable to all Jesus' disciples, are specifically applied to the lay faithful. They are partic-ularly meaningful images because they speak not only of the deep involvement and the full participation of the lay faithful in the affairs of the earth, the world, and the human community, but also and above all they tell of the radical newness and unique character of an involvement and par-ticipation which has as its purpose the spreading of the gospel that brings salvation (§ 15). The pope goes on to emphasize that a member of the lay faithful cannot remain in isolation from the community, but must live in an interaction with others that builds up the church. With reference to the church's liturgy, the pope says, "The various min-istries, offices, and roles that the lay faithful can legitimately ful-fill in the liturgy, in the transmission of the faith, and in the pastoral structure of the church ought to be exercised in confor-mity to their specific lay vocation, which is different from that of the sacred ministry" (§23). At the heart of lay people's ecclesial life is the parish, which is the symbol and the realization of the community of Christians. The pope reports that at the synod the bishops, in their discus-sions about renewing parishes, proposed two approaches: (1) "adaptation of parish structures according to the full flexibility granted by canon law, especially in promoting participation by the lay faithful in pastoral responsibilities"--so as to respond to situations where parishes have become geographically too large or where exiles and migrants demand specific pastoral responses (such as ministry in languages foreign to the place); and (2) devel-oping "small, basic or so-called 'living' communities where the faithful can communicate the word of God and express it in ser-vice and love to one another; these communities are true expres-sions of ecclesial co~nmunion and centers of evangelization in communion with their pastors" (§26). Thus the pope links the renewal of the parish to the expanded role of the lay faithful in the ani~nation and development of parish communities and the foundation of base communities alongside 360 Review for Religious and within the structure of existing parishes. Clearly, the need to find new forms of relationship that call to faith and celebrate faith within the neighborhood or the village is at one and the same time a diagnosis of the church's weakness today and a challenging mission for committed lay people. The pope, stating that the council insisted upon "the absolute necessity of an apostolate exercised by the individual [lay Christian]" (§28), then cites the following text of the council: The apostolate exercised by the individual--which flows abundantly from a truly Christian life (see Jn 4:14)--is the origin and condition of the whole lay apostolate, even in its organized expression, and admits no substitute. Regardless of circumstance, all lay persons (including those who have no opportunity or possibility for collaboration in associations) are called to this type of apostolate and obliged to engage in it. Such an apostolate is useful at all times and places, but in certain circumstances it is the only one avail-able and feasible.~ The pope's letter says much about the possibilities for holiness in committed lay life, but here I will include only some summary comments taken from its closing pages. A key preoccupation of Pope John Paul is to foster unity between everyday life and faith experience. He speaks of the need to evangelize the cultures within which we live. In part this means finding a place (in conversation and in social action) for the gospel values that the church preaches. Lives that integrate prayer, con-templation, and liturgical and sacramental life are a witness to the divine origin of our life and our world. The pope urges a readiness to take part in church programs and activities at local, national, and international levels. He indicates the crucial need for capable persons to commit themselves to catechesis and religious teaching. He urges people to organize gatherings and meetings focused upon a Christian analysis of family, civic, and social expe-rience. Finally, he mentions the value of a spirit of detachment and generosity and the power of the witness of poverty in a world " that is seduced by the power of materialism. John Paul then calls for a "reevangelization" of the Catholic and Christian world; we need, he says, to "remake the Christian fabric of the ecclesial community itself. This will be possible if the lay faithful will know how to overcome in themselves the separation of the gospel from life, to again take up in their daily activities in family, work, and society an integrated approach to life May-.~ne 1993 361 Philibert ¯ Committed Christian Secularity that is fully brought about by the inspiration and strength of the gospel" (§34). Earlier I noted how odd I find it that this lengthy document refers only briefly to secular institutes. I will not dwell further on that point. I observe, however, two things on the relation between secular institutes and the pope's apostolic exhortation on the laity: (1) I think this papal document is an extraordinarily well-crafted exposition of the meaning of the life of the vows for members of secular institutes. What they effectively commit them-selves to is an intense baptismal transformation as spelled out in the documents of Vatican II and summarized in the pope's letter. (2) The papal teaching here takes us a step further. The mem-bers of secular institfites must be committed to fostering the Christian life of their friends and neighbors. There is a mission-ary dimension to their vocation--towards their neighbor and towards the common culture within which they live and celebrate together. Although I have no firsthand experience of living the life of secular institutes, I have come as an interested outsider to the study of this dedicated form of life. My hope is not to answer ques-tions and close off discussion, but to raise questions and open new avenues of dialogue. I feel that secular institutes, especially in the United States, have a great opportunity. The church needs evan-gelical guidelines to help people grow in personal holiness and in effective witness to all the people around them. And so I hope that members of secular institutes will find ways to articulate their sense of their vocation even more clearly 9nd ways to make others aware of the very existence of secular institutes and the nature of their life. The gospel warns us about keeping treasures hidden. Notes ~ John Paul II, The Lay Members of Christ's Faithful People: Christifideles Laici (Boston: Daughters of St. Paul, 1989), §56. 2 David M. Bulger, "Men Who Love Their Priesthood and Their Church," Touchstone (National Federation of Priests' Councils newslet-ter) 8, no. 1 (fall 1992), p. 2. The prelate in question is the Most Rev. James Martin Hayes, retired archbishop of Halifax. 3 See the helpful summary in E Valdrini, J. Vernay, J. E Durand, and O. l~chapp~, Droit Canonique (Paris: Dalloz, 1989), pp. 188-121. 362 Review 3~r Religious 4 M. D. Chenu, "Consecratio Mundi," in The Christian in the World: Readings in Theology (New York: Kenedy, 1965), pp. 161-177. 5 The Documents of Vatican H, ed. and trans. W. M. Abbot and J. Gallagher (Ne~ York: Association Press, 1966): The Dogmatic Con-stimtion on the Church, §33. 6 Decree on the Apostolate of the Laity (Apostolicam Actuositatem), §16. Loving Verbs I've always loved nouns. Neatly framed words with clear definitions. Solid, stable words that name safe things, things you can count on and hold and keep. I know now that I've been afraid of verbs. Words that do and have and are. Words that whirl past you so fast you can't catch them, that alter and change things and give ulcers to nouns . Loving verbs is like saying yes to the rollercoaster, going on but still being scared. Loving verbs is saying yes to a kaleidoscope of action and being and having and feeling. Loving verbs is saying yes to Possibility. I think it's time for me to fall in love with verbs. Christen Shukwit OSF May-~une 1993 363 prayer SUZANNE ZUERCHER and direction Liturgy of the Hours: A Reflection "Ritual is the enactment of the myth." --Joseph Campbell The reality of monastic" life has always been formed and shaped around the ritual of the Liturgy of the Hours. In his Rule for Monasteries St. Benedict devoted numerous, if brief, chapters to the content and structure of this prayer, which he called the Work of God. The Divine Office requires that monastics pause again and again, offer praise together, and then move on to the next aspect of their lives. The complete circle of the monastic day gains its momentum ahd energy by stopping for the Work of God. Many monastics no longer spend eight periods daily praying the Liturgy of the Hours. Nevertheless, the pri-ority of this liturgical prayer remains, and they continue to gather daily. For contemporary monastics, as for early ones, this form of worship best manifests what their life together is about. Early monastics were lay persons even in all-male communities, and so opportunities for daily eucharistic celebrations did not exist in many monasteries. In such a context it is understandable that Benedict would place a high priority on the Work of God, which he made the distinctive and constant form of community praise and worship. It remains the heart of monastic prayer life even in this twentieth century. Suzanne Zuercher OSB, well known for her writings and work-shops, has held both administrative and formation roles in her community. Her address is: St. Scholastica Priory; 7430 North Ridge Boulevard; Chicago, Illinois 60645. 364 Re'view for Religious In times when we are so intent on exploring what religious community really means, one place to look for the answer is in this ritual of the Liturgy of the Hours. Joseph Campbell tells us that by examining a ritual we can find out about the myth the ritual attempts to express. For this reason I would like to spend time reflecting on elements of the Divine Office as it is celebrated in monastic communities in order to better understand what com-munity means in such settings. Today's monastic communi-ties say something about who they are as they gather daily for this ritual and worship. Perhaps even they need to pay close attention to what that statement is. Are we overlooking what community life is and needs to remain by failing to examine what may well be its clearest manifestation? Initially, the most basic communication a monastic community makes by gathering for the Work of God is that their life is founded on hope. David Steindl-Rast in his book Gratefulness, the Heart of Prayer distinguishes hope from optimism. A hopeful per-son lives in the present. An optimistic one looks ahead, pumping up positive feelings of how good things will be. A person of hope looks with confidence and trust into reality simply as it is right now. He or she--or they when one speaks of a community of hopeful people--finds life in ordinary, humble, actual experience. Rather than having expectations of good things to come, persons of hope have only one expectation: For those who live and wait in the present moment, life/Life will be a surprise. Monastics watch for such surprises. Ritual, Campbell also reminds us, is by its very nature boring. In its repetitiveness it fails as entertainment and distraction. Instead, ritual forces those who participate in it to search beneath the words and actions to discover the reality it gives shape to. This holds true whether worshipers are from Indonesia or Illinois. Boredom demands the deeper search for meaning beneath litur-gical action. Those who observe monastic communities repeating psalmody week after week and year after year may wonder what can possi- The most basic communication a monastic community makes by gathering for the Work of God is that their life is founded on hope. May-j%ne 1993 365 Zuercher ¯ Liturgy of the Hours bly draw them together for so repetitious a ritual. The sequential reading of Scripture, the yearly round of liturgical seasons, the consistent liturgical gestures are rhythmic, to be sure. To some, such repetition may appear empty and uncreative; but for monas-tics, whose worship is formed around this liturgy, such ordinari-ness underlines the reality of all human life and, consequently, of their life together. It calls to them, demands of them, that they look more deeply into what their lives are about. Eventually, if they are to continue to gather for the Hours, they are forced to cut through ritual to discover what that ritual signifies. It is dif-ficult, if not impossible, to endure the repetitive round of common prayer without such a breakthrough. Monastics who do not respond to this challenge to go deeper either go to sleep or despair. Sooner or later they absent them-selves psychically and physically from gatherings of the commu-nity in prayer or otherwise. Those, however, who hang, on in the face of meaninglessness can be led to the conversion at the heart of monastic commitment. Anguish and desperation can lead to rebirth and transformation in this as in other aspects of the spir-itual life. We do not willingly plumb our lives. We do so only when something demands that we move from the obvious to what that obvious is really expressing. We are forced to ask some questions: Why do we come together, stop our work, come home early, make sacrifices to be together for this time of prayer? What is the mean-ing behind what we do and say here? Do we believe all this, see it as important, even primary? Such questions are about the liturgy. But they are also, if we look closely at them, questions about community itself. Do we really see significance in using up our energies in praise of God together? Given life/Life as mystery, there is no final answer to any important human question. That is possibly why we keep asking what community is over and over again, generation after gener-ation, even though we have a Rule to guide us. Our human nature ultimately insists on experience. Experience is how we learn our answers. Liturgy of the Hours revolves around a lived experience of virtues we have all learned about which form the bedrock of the spiritual life. It makes these virtues concrete. First, we find faith in the gathering of the community, and we believe that life/Life will be found here. Then we recognize that the space in which we 366 Review for l~eligio~s gather is a sacred place where holiness will quicken us; for this we hope. And when it does bring the energy we call spirit/Spirit, we are truly one people, God's family, united in love with those who gather here and with the world of which we are a microcosm. Indeed, the place of our gathering for liturgy is sacred, but the spiritual spills over, if it is gen-uine, into all the other aspects of life: to the kitchen, the grounds, the classroom, the social agency, the hospital ward, the parish offices, the artist's studio. All are sacred places, all filled with objects and growing things and others who are sacred vessels. Benedict told his monastics to pause wherever they were in their work for God's Work, the Liturgy of the Hours, to remind themselves that everything is sacred. They were not to make life holy; they were to remind them-selves that it already is. Another element of monastic community is stability. Sometimes misunderstood as never going anywhere, stability does have something to do with being together in physical space. There is symbol in gathering. When community members come in one after another and take their places for the Work of God, their gathering together says what people want and need to hear expressed: You can count on my presence. Seeing the same per-sons gathered for prayer day after day makes real the word fidelity. The action of monastics looking around and noticing commu-nity members assembled with them is itself a form of prayer--a consoling and strengthening reminder that we wait as a people for our God (o come to save us. The monastics who gather share daily living, values, com-mitment; They are the same people who will be together in wor-ship and in all the other moments of existence as well. Praying together stands for and ritualizes all our being together. Talk and write as we will about the importance of being one in spirit, actu-ally hearing the voices and observing the silences and singing the psalmody with community members provides a needed testimony of this dedication to one another. The physical setting and its rituals offer another reflection on monastic community. As weeks pass, those who participate in the Liturgy of the Hours assume first one role in the ritual and then another. From presider to chanter, to reader, to the one who Praying together stands for and ritualizes all our being together. May-gTune 1993 367 Zuercber ¯ Liturgy of the Hours intones the various choirs, to merely being one of the group at prayer, the rhythm of life involves numerous tasks. The rhythm of monastic community is similar. One may be the prioress for a time, and then the procurator or the formation director, the gar-dener or the cook, the principal of the school or a teacher, the hospital administrator or a staff nurse. Monastics move easily and regularly throughout their lifetime in one another's company from the responsibilities of authority to those of obedience. They do so simply; it matters little in their life together what title they may have or how much prestige it carries. If today they have a larger role, yesterday they were one of the group and tomorrow they will be so again. Prolonged and consistent living among the same people pro-vides opportunity for a unique sort of learning. All the ministries monastics assume in the community and beyond it are for ser-vice, and this service changes. When a group lives in continuity with one another, moving from role to role is a normal, unim-pressive experience. Members give of their talents now in one way and now in another. The content of the Liturgy of the Hours is almost entirely scriptural. Meaning comes from the long and nourishing story of the Judeo-Christian tradition found in both Old and New Testaments. The history of redemption is larger than any indi-vidual person or any community, but Scripture provides words for the human experiences lived out by the whole group and each of its individual members. Monastics ponder the Scriptures until its words--and more importantly, the message they proclaim-- permeate their lives, are absorbed into the marrow of their bones. Body and mind and feelings soak up the liturgical seasons in their cyclic rhythm. In my own experience I once met a group of spiritual direc-tors who were to companion some monastic women on their first directed retreat. These directors expressed concern about how to introduce praying with Scripture. To their surprise, the monastics they directed not only understood the relevance of suggested pas-sages, they were able to add many others on the same theme. The directors were amazed at how steeped these women were in the concrete experiences which various Scriptures highlighted. Many of them had done litde formal scriptural study, but the constant association of the texts with their day-to-day lives had blended both together. 368 Review for Religious The simple reflection on the Gospel which the Liturgy of the Hours provides testifies to the natural, nonelaborate quality of the best of prayer, the best of living. There is design and order in the structul'e of God's Work, but medieval embellishments have been done away with in these times of ours. Monasticism is again being expressed very simply in its most basic and original form, and its prayer ritual has assumed some-thing of the natural breathing in and out of word and silence. As a result monastics experience the order and peace found when an appropriate amount of structure shapes life. It is important that what is and needs to be predictable not degenerate into rigid formalism. Monastic liturgy makes the statement that, as is true for all mature persons, mgnastics need to learn to bend with changing breezes without uprooting themselves as they do so. Perh.aps the most signifiEant statement the Liturgy of the Hours makes is that "it is good for us to be here." In the end, community is its own justification as is prayer. Religious life is valuable simply because it is. People live in community; it is the human thing to do. The kind of community people choose varies according to who they are. Monastics live their kind of commu-nity life primarily because it "fits" them. They find their whole-hess with other people who, like them, seek God, the Work of God and obedience as described in the Rule for Monasteries. When members of monastic communities live their under-standing of who they are in a whole and happy way, they cannot but witness to God's love and peace and joy. They do so simply by their lives. Of course, it is true that any whole person is called to care and to serve~ to be concerned and to work for the good of others. Monastics, therefore, find that they cannot contain what God has given them. It overflows to those around them and cre-ates yet another expression of stability in the environments in which they live. The vision of monastic community that underlies this article is idealized, to be sure. So, too, is the fantasy of perfectly carry-ing out the Liturgy of the Hours. Such perfection never happens. There are coughs and sneezes; people read too softly or too loudly, Perhaps the most significant statement the Liturgy of the Hours makes is that "it is good for us to be here." May-3~ne 1993 369 Zuercber ¯ Liturgy of the Hours too slowly or too fast. People forget to perform their assigned role in the ritual and the flow of things is upset. Differing inter-pretations about how the psalmody is to be read or sung by the group create subtle conflicts. All of these imperfections, and many more besides, limit the beauty and peace of liturgical celebration. Despite such imperfections, monastics continue to gather together for this less-than-perfect expression of a community life that is also less than perfect. They watch and wait, not knowing at what hour the Bridegroom will come in the form of some insight, some consolation, some discernment, some energy released from image or symbol, some decision to act. The Spirit blows when and where it wills. Those who wait find their quick-ening at the point of what we might Fall readiness--a readiness which differs for each person. It demands a culmination of a num-ber of life experiences to reach such a ripeness. Monastics gathered for Liturgy of the Hours never know when their individual hearts will be warmed, when the heart of the person beside them will be set on fire, when the community as a group will hear God's response to the Spirit's groaning within. But they wait, nonetheless, with a certain amount of patience and good humor for these freeing moments to occur in the world of time. This reality best describes for me what community is. It has not always been my description of our life together, but in recent years community has come to mean waiting with one another for each person's time. The ritual of Liturgy of the Hours celebrates and makes that description clear over and over, day after day. It, indeed, enacts the reality we struggle to define, the myth of reli-gious community. 370 Review for Religious KENNETH C. RUSSELL Get Serious! The Monastic Condemnation of Laughter /~,n, chapter six of his famous rule, St. Benedict bluntly forbids talk leading to laughter,''1 Later he notes that a monk has reached .the tenth step of humility when "he is not given to ready laughter:, for it is written: 'Only a fool raises his voice in laughter'" (Si 21:23).2 This condemnation of mirth is not, we must note, some oddity that can be explained away on the basis of Benedict's personal history or the troubled period in which he lived. His outright condemnation of the joviality we applaud was echoed in other monastic rules and in the critical comments of church fathers such as St. Ephrem and St. John Chrysostom.3 This harsh attitude toward laughter seems strange to us and even downright unhealthy. The early spiritual masters frowned on laughter; we, on the contrary, are suspicious of seriousness. ' In today's world all truth is spoken with a smile, as Horace rec-ommended, and Woody Allen, despite his recent troubles, is the only Hamlet we are willing to tolerate. Why Laughter Was Suspect But what prompted the first monks to condemn laughter? The scholars who have explored the early monastic rules and the sayings of the desert fathers offer various explanations. For one thing, laughter disrupts monastic order. It shatters the silence that represents the readiness of a disciple to listen.4 A monk who Kenneth C. Russell is a professor of the theology faculty at Saint Paul University. His address is Saint Paul University; 223 Main Street; Ottawa K1S 1C4; Canada. May-June 1993 371 Russell ¯ Get Serious.t is busy laughing is not ready to hear whatever may be spoken to him by the Holy Spirit or the abbot. In the monastic context it is the abbot's duty to speak and the monk's to listen,s The monas-tic rules are particularly hard on the effort to provoke laughter. In terms of order, this all makes sense because a joker in the clois-ter is obviously the equivalent of the clown in the back row of a classroom competing with the teacher for the other students' attention. Monasticism's reasons for rejecting laughter went deeper than that, however. The early monks prohibited laughter because they associated it with an arrogant, self-satisfied disdain for God and neighbor. Did Jesus not in fact say, "Woe to you who laugh now; you shall weep in your grief" (Lk 6:25)? And where in the New Testament does it say that Jesus laughed? This may not seem an important point to us, but the early monks took the failure of the gospels to show Jesus laughing quite seriously. They were not the only ones. Not even popular piety, which was ready in every cen-tury to fill the gaps in the gospel narrative with legends and sto-ries, ever developed the image of a lighthearted, laughing Jesus.6 Why this suspicion of laughter in the first Christian cen-turies? There would seem to be cultural as well as religious rea-sons for this uneasiness. In the tight-knit societies of the ancient world, laughter was likely to be laughter at someone: the for-eigner, the deformed, the handicapped. It separated the person who had done something "funny" from the group and made him or her a legitimate object of scorn. Laughter mocked and excluded the outsider. This social reality is reflected in the view of the ancient Greeks who, though they recognized risibility as a dis-tinctive human quality, concluded nonetheless that laughter was unbecoming to a mature human being because of its characteris-tic cruelty.7 The world in which monasticism took shape was sev-eral centuries away from the classical era, but the same high regard for how one appeared to others and the same sensitivity to shame were operative. Laughter, therefore, could be seen as a destruc-tive and even satanic force,s We must not think, however, that the fathers and the early monks favored a kind of pious gloom. They did not. In fact, some of those who made the harshest remarks about laughter were well known for their geniality and cheerfulness. What they frowned on was a certain lighthearted devil-may-care joviality. But why? To get to the heart of the matter, I think we have to look beyond the 372 Review for Religious historical situation and the predictable considerations of monas-tic discipline to the very essence of laughter. This is the only way we can discover what the fathers were really condemning and determine whether what they said has any message for us today. What Is So Funny? It seems to me that humor springs from the tension between our spiritual aspirations and the physical limitations imposed on us by our bodies and our confinement in a physical world with laws of its own. Comedy, in other words, is built into our very being. Even when we avoid the ridicu-lous pretensions that blind the proud to the banana peel right in front of them, we are funny creatures. Our efforts to go up the down escalator, our inability to guarantee that the soup in our spoon will reach our mouth without mishap, and all the other follies of daily life constantly remind us of our basic humanity or, to put it differently, of our littleness and dependence. Our comic condition mocks our solemnity? Therefore, if we have a prudent measure of humility and a min-imum of wisdom, we cheerfully accept our role in the human comedy and laugh at ourselves. We also laugh at others, but usually because we identify with them and see ourselves in their pratfalls. That is why Charlie Chaplin holds our attention or why we laugh at the-shy scientist in The Gods Must Be Crazy who falls all over every bit of furniture in sight in the presence of the attractive young woman who has entered his life. "Isn't it the truth!" we say. Male or female, we know what it is like to be completely overwhelmed by the attractiveness and charm of another human being. We have all been there, and our laughter celebrates our humanity and the glory of its fragile being. Our laughter testifies that the world, for all its troubles, is a joy-ous place and humanity, for all its pain, a wondrous thing in the hands of a God who can be trusted. Faith and cheerfulness would seem to go together. Our laughter testifies that the world, for all its troubles, is a joyous place and humanity, for all its pain, a wondrous thing in the hands of a God who can be trusted. May-June 1993 373 Russell ¯ Get Serious! But does our laughter always stand in such a healthy rela-tionship to the basic seriousness of life? What about the cynicism and despair that echoes in much of our laughter? For, indeed, we use laughter, not only to relativize the tragic dimension of life, but also to trivialize it altogether. Laughter can be a way of saying, "Hey, when it comes to silliness and stupidity, we're all in the same boat!" or it can be a frightened, frenzied dance over the abyss of anxiety. Laughter can be a life-affirming chuckle or a panicky giggle. Laughter, therefore, is not necessarily a sign of faith, nor is it necessarily, to use .the title of Richard Cote's contribution to a theology of laughter, "Holy Mirth." 10 It may, indeed, signify a brave stance before the meaninglessness of life. It may be a deter-mined retreat from a truth too dismal to contemplate. It may, ultimately, be an avoidance of seriousness. The Nature of Laughter We have lost the ancient world's suspicion of laughter, but it remains true, nonetheless, that making someone the object of laughter can be a disguised act of aggression. The same chuckle that mocks the other may comfort the joker with the consolation that he or she is not "like that." Whether crude or subtly sugar-coated, this alienating humor is the basis of most racial jokes and stories. Is this cruel aspect of humor just a negative twist that can be explained away by human sinfulness, or is it, in fact, the very basis of laughter? Surprising as it may seem, most philosophers and psychologists who have studied laughter connect it with aggres~ sivity and defensiveness. You may hit your neighbor with a feather duster and protect yourself with a water pistol, but you do hit him and you do defend yourself. In the evolutionary and anthro-pological way of looking at humanity which these thinkers adopt, laughter is partly a protective device, like the cuteness of small ani-mals, and partly a barrier erected to protect the group from the unfit and different. Laughter offers an alternative to a direct assault in those circumstances where overt aggression would be ill-advised. "If you can't hit him, tickle him to death, or make him so uncomfortable he gives up and goes home." The experts seem to consider laughter akin to the excited, mocking behavior of the likes of Tarzan's Cheetah.11 374 Review for Religious Are the psychologists and phenomenologists right? They cer-tainly seem to be on target when they describe how laughter func-tions in society. We have all, at one time or another, used laughter to disarm someone who has assumed an aggressive stance in a conversation, or we have, conversely, "jokingly" taken a verbal punch at someone we dared not face off with seriously. But must we fol-low them when they explain laughter in purely evolutionary terms? Must we see it merely as an outgrowth of aggression and defensiveness? Is laughter--harmful or helpful, loving or hateful--merely an amoral by-product of our swing down out of the trees? Is it someth!ng that will van-ish once genetic engineering succeeds in bleaching aggression out of the human gene pool? The notion that laughter is rooted in the desire to figh.t and defend ultimately cloaks the most lighthearted laughter in very dark colors indeed. It is surely prefer-able, therefore, to view laughter as a God-given, inherent human characteristic and not merely as a stained leftover from some newly grounded ape with the jitters. It is a proper human attribute that can be used, like most things human, for good or ill. Why, then, was laughter so harshly condemned by the spiri-tual masters of early monasticism? It is true that they placed a high value on the gift of tears which enabled a monk to lament his sins .and, indeed, the human condition in its alienation from God, but they certainly did not favor going about under a dark cloud.~z Sadness, after all, is one of the spiritual disorders in the list of passions that John Cassian handed down to Western monasti-cism. 13 We have to keep in mind that cheerfulness is one thing, the deliberate effort to provoke laughter quite another. What Laughter Does It seems to me that, to hold the monastic condemnation of laughter in perspective, we have to keep in mind that cheerfulness is one thing, the deliberate effort to provoke laughter quite another. Cheerfulness is the mark of someone who knows the May-.]une 1993 375 R~ssell ¯ Get Serious! score, as it were. Confidence in the providence of God and faith in the resurrection of Christ make Christianity a joyful religion. Therefore, those who penetrate to the heart of things, the wise, are inclined to be cheerful. However, if they heed the warning of St. Benedict, they will not "love immoderate and boisterous laugh-ter." L4 Certainly they will "speak no foolish chatter" and will not say anything "just to provoke laughter." ~5 Yet surely there is much to be said for the effort to make peo-ple laugh. After all, jokes, wit, and "foolish chatter" function as social lubricants. They act as icebreakers and frequently provide an interlude of relaxation and entertainment in the tense envi-ronments in which many of us operate. This is certainly true, but nonetheless I am inclined to say that, even at the best of times, laughter is a movement toward the surface, toward the shallows. It is always escapist. It is always a distraction because it is always a movement away from the quiet center of one's being. The fact that clowns and clowning around distract us does not, of course, make the effort to provoke laughter an evil. Laughter has its proper, place and its uses. In the hustle and bus-tle of the large, impersonal metropolis in which most of us earn our living, it is a marvelous instrument of social interaction. It helps us survive in a world of strangers. We may not know one another's history or evefi what the person next to us does when he or she is not working in this office, serving on this committee, or attending this class; This may be regrettable on a theoretical level, but the truth is that things would not go smoothly if we had to establish a deep interpersonal relationship with the mul-titude of people we meet. We encounter them in a specific con-text where we wear, as it were, a name tag referring to only one aspect of our personal history. We are "employee," "tennis part-ner, . student," or whatever. We want to be known and to feel that we fit in, but at the same time we have no desire to expose our pri-vate life to people we meet in this one-dimensional setting. Shared laughter allows us to achieve these contradictory goals. It binds the group together by touching our common humanity and, by veer-ing away from a focus on the personal, it protects our privacy. Laughter keeps everything light and frothy as it should be among those who work in the same place or band together to pursue some common social or recreational goal. This'is not the perspective that preoccupied the early monks. Therefore, their derogatory assessment of laughter should not 376 Revie~w for Religious be read as an attack on the social use of humor nor interpreted as a put-down of stand-up comics or, for that matter, the office wiseguy. The words of the fathers were addressed to those who had withdrawn from the turmoil of life and the humor that helps it function pleasantly. They were addressed to those who had, as it were, gone apart to concentrate. An effort to deliberately pro-voke humor in a setting which, by reason of its very seriousness, was surely prone to the laughter rooted in the human condition was obviously inappropriate. Laughter was as out of place in this setting as it would be on a green during a pro tournament. It broke the pros' concentration. Worse than that, the inclination to stir others to laughter indicated that a monk had fallen victim to the restlessness and distraction that the desert tradition called acedia.16 Conclusion Does this ancient suspicion of laughter have anything to say to us today? I think it challenges all Christians to ask, "Why am I laughing?" Does our joviality spring from the confidence that gives rise to cheerfulness, or is it perhaps anxiety in cap and bells faking nonchalance in the entrance hail of death? Is it the prod-uct of faith in a loving God who demonstrated his seriousness by making humans glorious beings and his love by giving them two feet to fall over to help keep things in proportion? Or is it the by-product of unbelief that opts, despite it a

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Issue 64.3 of the Review for Religious, 2005. ; lglous Witnessing The Spirit QUARTERLY 64.3 2005: Review for Religious fosters dialogue with God, dialogue with ourselves, and dialogue with one another about the holiness we try to live according to cbarisms of Catholic religious life. As Pope Paul VI said, our way of being church is today the way of dialogue. Review for Religious (ISSN 0034-639X) is published quarterly at Saint Louis University. by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: review@slu.edu ¯ ~Veb site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ Pontifical College Josephinum 7625 North High Street ¯ Columbus, Ohio 43235 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ° Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2005 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. ev'iew for religious Editor Associate Editor Canonical Counsel Scripture Scope Editorial Staff Wetrmaster Adv#ory Board David L. Fleming sJ Philip C. Fischer SJ Elizabeth McDonough OP Eugene Hensell OSB Mary Ann Foppe Tracy Gramm Judy Sharp Clare Boehmer ASC Steve Erspamer SM Kathleen Hughes RSCJ Louis and Angela Menard Bishop Terry Steib SVD Miriam D. Ukeritis CSJ QUARTERLY 64.3 2005 contents 228 prisms Prisms community chapters 230 Where Two or More Are Gathered Ted Dunn explores some of the unique challenges and opportunities pertaining to religious chapters of election, especially highlighting the differences between politics and discernment. 242 Chapter Delegates, Once and Future Sister Marie de Lourdes Mates IHM recapitulates and refurbishes some earnest practical suggestions about what to look for in chapter delegates. 252 Community Chapters: Seven Personal Beliefs Melannie Svoboda SND presents an outline of concrete expectations for a religious congregation's chapter meeting. Reflection and Discussion 226 259 religious life Invisible--Even to Ourselves? Marie Brinkman SCL emphasizes that visible unity-- community bonds--must become the sign of Christ and his church that religious life is meant to be. Review for Religious 269 Living in Community: Continuing the Conversation Doris Gottemoeller RSM returns to the discussion about the place of community living as an uncommon and striking witness to the power of the gospel and the dynamism of a congregation's charism. Psalm Prayer Reflection and Discussion 281 witnessing With Love from Calcutta and Lisieux: Letters of Mother Teresa and St. Thdr~se Mary C. Carroll SSSF gives witness to the wisdom of a loving friendship expressed in the letter exchanges of Mother Teresa of Calcutta and Father Michael van der Peet SCJ and Thdr~se of Lisieux and Maurice Barth~l~my-Belli~re. 296 Alfred Delp SJ and the Heart of Jesus Mary Frances Coady focuses on Alfred Delp's devotion to the Heart of Jesus that sustained him in his Nazi imprisonment and eventual death by hanging. 301 the spirit Led by the Spirit: St. Basil the Great Andrew Ryder SCJ enters us into St. Basil the Great's contributions to our theological understanding and appre-ciation of the Holy Spirit as the third person of the Trinity. departments 316 Scripture Scope: Encountering the Parables of Jesus 321 Canonical Counsel: Additional Comments on Interpretation 326 Book Reviews 64.3 200~ prisms The prevalent theological cat-egory in describing the church is the word com-munion. It is significant that this choice of word confronts the most serious need of our times. Communion emphasizes what binds us together. Theologians today want to say that this word most captures what the church is all about. Pope Benedict xvI, in his initial addresses as the leader of the Roman Catholic commu-nity, has called for a renewed effort among all peoples of religion to look to some kind of bonding or communion. The essential witness that any Christian gives is that of bonding. There is no working for justice unless there is a bonding with the "other." There is no exercise of charity unless there is a communion with the ones being served. As Jesus pointed out consistently, each one of us as a follower comes to serve and not be served--like him. We do not serve justice or charity out of a superior stance; we can only be on the same level, as with our sisters and broth-ers, and it is there that we work. Perhaps we may look like good secular social workers. As Christians, we want more; we are looking towards communion. If marriage in the Christian community has no greater rate of fidelity than secular marriage, then as Christians we are failing. If men and women in religious life commitment do not give Review for Religious witness to a life in common, then they fail in the most essential witness of their religious life. It is not just in entering upon a vocation and it is not just in generous service that we show ourselves to be Christian. The "proof of the pudding" is whether we truly are people who "bond," who live in communion because commu-nion is entering into God's life, the life of the Trinity. How in our times have we lost some ways of "bond-ing," of being in communion? It seems we no longer recognize that there are three progressive steps which Jesus has identified for us in the Gospels. First, there is detachment ("leave your father and your mother," "go, sell") or what we might today call availability. We come with so many non-negotiables; we come with our needs and our demands. Many of us Christians are unavailable to God and to one another. And. so the first step in bond-ing or communion is being available. The second step is generosity or being in service ("come, follow"). We often pride ourselves on how much we do for others, extending ourselves generously with our time and tal-ent. No doubt we are people of service, but is it all on our terms? Are we covetously in control of all our works of justice and charity? Both the first and the second steps can be half steps in living as a Christian. Are half steps any steps at all? The third is, simply, sharing or, rightly understood, surrendering ("take up your cross"). Commun. ion hap-pens when we are available, when we give. generously in service, and when we share our lives unstintingly--as God does with us. Communion or bonding is our 21 st-_century quest as a Catholic community. It is a quest that Jesus tells us is within our ~raced reach. David L. Fleming SJ 64.3 2005 TED DLrNN Where Two or More Are Gathered community chapters It has been said, "Where two or more are gathered, there is politics." Though many religious communities have embraced communal discernment as their preferred means for electing leadership, they are still not immune to the pulls and trappings of politics. Seeking to hear the voice of the Spirit through communal discernment can, at its best, eclipse and far surpass the influence of politics. Communal discernment, however, no matter how well practiced, will neither eradicate politics nor guarantee that there will be no regressive pulls in chapters of election. But awareness of the differences between discernment and politics can help chapter participan~ts resist the forces of politics and secure the grace-filled opportunities of discernment. Ted Dunn, a clinical psychglogist, wrote for us in our 63.3 issue (July 2004). His address remains Comprehensive Consulting Services; 6209 Mid "Rivers Mall Drive, Suite 294; St. Charles, Missouri 63304. Review for Religgous When discernment and politics collide, how can chapter participants make sense of all the forces in play? During a chapter of election, what are some of the regressive urges that may work against a community's efforts at discernment? What are some of the differences between "political" conversations and "discerning" ones? These are questions I address in this article. We are not likely to rid ourselves of politics completely, but I am confident that, if communities commit themselves to communal discernment, they can grow in their capacity to use it well. From my years of facilitating communal discernment, I am confident that goodwill and good ways of channeling it can enhance discernment and diminish politicking. This, in turn, can help communities to seek God's will more fully and thereby discern their choice of leadership more wisely. In line with this I plan to point out some differences between discernment and politics from three angles, namely, numbers, powers of persuasion, and so-called winners and losers. But first I want to set the context by elaborating on regression (returning to old patterns). Regression often emerges during chapters of election and, if left unrecognized and unchecked, can blight a community's desire to put discernment ahead of politics. Regression in the Face of Discernment For a chapter to be a success, its participants should check their human propensities to constrict the movement of the Spirit, and instead work Collectively toward welcoming the Spirit present among them to liberate and enlighten. They should seek ways of enhancing their own spiritual freedom and that of the group, avoiding anything that might hinder it. They need to be alert to personal and group patterns of regression and strive to eliminate them. I would guess that every 64.3 200Y Dunn ¯ Where Two or More Are Gathered community has had, at one time or another, a dark moment in which its chapter of election fell far short of its best intentions and let, for example, politics take precedence over discernment. I would also guess that-- although such a moment tends to recede from the community's consciousness between chapters--it often returns at the beginning of the next chapter. It is as if the walls of the chapter hall hold the memories and, when the chapter is convoked, so too are the memories. Despite such experiences, or perhaps because of them, individuals and communities I am acquainted with have made courageous efforts to move beyond the pain of past elections and write new memories upon the walls. I have witnessed participants building new bridges, mending frayed relationships, offering and accepting olive branches, and all in all seeking greater unity. Communities yearn to grow in discernment and put forth their best green-gold efforts when given the opportunity. Yet I also know that, as in all growing, communities are at risk. They repeat old patterns of tension and vulnerability. As a psychologist I recognize that regression is a natural and normal response in the face of threat. It is a coping mechanism that people use when new ways of behaving seem shaky or are perceived as failing. Think of the first time you tried a new prayer form and it was not working for you. You likely sought refuge, at least temporarily, in the tried and true. Recall a return to your family of origin. Despite your growth in other relationships, in a difficult interaction with a relative you may have returned to a once-outlived means of coping (withdrawing, clashing, and so forth). Recall your community's initial efforts at the more fluid processes of communal discernment and the simulta_neous urges to return to the familiar confines of Robert's Rules and carefully orchestrated conversations. Review for Religious When it comes to elections, politics is what is most familiar to us. It is part of our culture and is no less a part of religious life. Discernment is newly learned and also countercultural behavior. And so, when tensions arise during a chapter, you have any number of urges to return to old patterns, the patterns of politics. You may have urges to-rally around your friends, to defend perceived "victims," to speak for those not speaking. You may want to tune out, or argue with what you do not want to hear, or go silent in the hope of being rescued by others more vocal. You may want to have the meeting outside the meeting (in the halls and over coffee) instead of in the assembly room. You may want to campaign for some, and against some others, and so on. The good news is that such urges do not have to be your destiny. Your next chapter presents you with the challenge and opportunity to write new memories on the walls of your assembly room. It is a chance to further reconcile and redeem the pain of past elections. It is a chance to weave new patterns of interacting into the collective experience of chapters of election and place discernment ahead of politics. But the undertow toward politics will, if left unrecognized, take away your freedom and wreak havoc upon your desire to grow beyond your past. If it is recognized, however, communities have the opportunity to catch themselves and choose instead the grace and gift of communal discernment. Politics as an Impediment to Discernment We humans have an insatiable appetite for politics. Enquiring minds want to know: Who's on first? Who's it Discernment is' newly learned and also coun~ercultural behavior. 64.3 2005 Dunn ¯ 14~bere Two or'More ~lre Gathered going to be? Who's ahead in the polls? In an election year, politics and politicians dominate the evening news, CNN, and the front page. Political talk is with us at meals and up and down hallways and sidewalks. Religious communities, it seems to me, are no less involved with politics. In fact, if politics means involvement, interest, and concern for how you govern yourselves, religious are just as political as any other segment of society. They desire to understand what is going on in the world, in the church, and in the community and to participate in shaping the future. Politics, then, has its good points, but it is important to understand its pitfalls and get beyond them in order to do the deeper work of communal discernment. One risk is that politics and discernment have definite similarities. Both lead to an informed vote in an election. Both seek understanding and involvement. In both methods, information serves to influence people and to moderate that influence. And both methods are about power. There are other commonalities as well, but there are definite distinctions to be drawn too. Where does politics end and discernment begin? Numbers. First let us talk numbers. Numbers sometimes talk long before people get acquainted with the candidates and their character. In the politics of our day, there are endless permutations of the numbers. Numbers are the heartbeat of American pre-election activity. Pollsters keep taking political pulses and making election prognostications. There are more permutations of polls than there are stats on the Super Bowl. Results are statistically projected hours before the polls close. Such results are not official, of course, but they cause people to think and say, "Why vote? It's a done deal." In discernment, however, the significance of numbers is little or none. In many discernment processes a Review for Religious member needs only one endorsement to enter into it. And entering is far more important than trying to forecast where you will end up. Entering the mystery, walking the Emmaus journey, searching out your future together by collectively seeking God's intentions--these things are not concerned with numbers. Numbers will not answer a community's quest for healing, yearnings for a stronger partnership, desires for deeper understanding, or efforts to resolve differences. Counting numbers, wondering how many votes you or someone else might get, will not help you hear the voice of the Spirit. You cannot take a poll to find out what God wants. Numbers at the moment of election have a different, though still secondary, importance. Ideally, numbers are the result of, not the means for, discernment. Ideally, they are the outcome that confirms the will of the Spirit mediated through the chapter. I do not know about your community, but in some communities, once the balloting begins, discernment goes out the window and people start listening to the numbers. They write the numbers down, tally the votes, and track who is getting what. Like a runaway train people start following the numbers instead of the Spirit. The numbers take over. It is important to work as a chapter body to prevent a numbers-oriented election. Facilitators need to intersperse .processes into the election itself to help the community discern its way through to the end. Ideally, the election process should be the culmination of the discernment process, not detached or separate from discernment. In my experience, when an election keeps the integrity of the discerning body and its discernment process intact, then numbers, if used at all, are of negligible importance. Pozver~ of Persuasion. In politics, power is .sought from a variety of sources through a variety of means. Power is 64.3 2005 Dunn ¯ Where Two or More ~qre Gathered found first in the money used for campaigning. Money pays for ads and buys favors from special-interest groups that in turn lobby for their candidates. In one form or another, money runs the machinery that shapes the information that people receive, which is of course the ultimate means of influence. In American politics "information is power," and, if you want to know who has it, "follow the money." While voters want information about what their candidates hope to accomplish, and while politicians vow that they will "stick to the issues," too often there is regression toward name-calling and mudslinging. Politicians know that there is great power in casting doubt upon their opponents. So-called "negative campaigning" persists despite the public outcry against it, in large part because research shows that when used skillfully it works. Political elections, as we have witnessed, are not about how you play the game; they are about winning, no matter the cost. Politics centers on persuasion as a means to attain desired outcomes. Spin doctors seek to persuade by parsing the truth. Political strategists provide different information for different target groups, strategically timing the leakage of news, all in an effort to sway specific voters. Party politics uses these powers of persuasion to garner support for their respective camps, which in turn support their candidates. Selective information to induce fear or call for party loyalty is among the powers of persuasion in American politics. In discernment, though, how you play the game and what kind of power you use make all the difference. The power of discernment rests on faith. It rests on your ability to pray, reflect, and journey together in such a way as to discover your collective truth, to experience the movement of the Spirit among yourselves. Paradoxically, Review for Religious the power of discernment is inversely related to persuading others or controlling the outcome. In fact, detachment from the outcome, rather than attempting to engineer the outcome, is a hallmark of discernment. Discernment requires conversations about the direction your community is moving, the issues you face, and the ideal team to facilitate the desired movement. It is about who can complement whom, not who is better than whom. It is not about camps competing around special interests. It is about cooperating in the interests of the whole. Instead of trying to convince others of your truth, communal discernment invites you to discover the community's collective truth. Discernment is not about campaigning, convincing, and cajoling, but about listening, sharing, and deepening the common understanding. Chapter participants are not chosen to elect favorite, candidates to represent personal interests, but rather to come up with a team of persons who together can best serve the interests of the entire community. I believe that the power of communal discernment is in direct proportion to a group's determination to be enlightened by one another and by the commitment of all to the common good. This power is present in direct proportion to your freedom, individually and collectively, to respond to the Spirit echoed in the voices of all the chapter members. It is present to the degree you are interiorly free from whatever might bind you, be it your loyalties to others, passions around your own agendas, fears of being hurt or hurting others, or haunting and hurting memories. It is present when people are free of 64.3 2005 Dunn ¯ Where Two or More Are Gathered prejudice and free of gossipy reputations, of labels that persist year after year. Being flee, however, does not mean an absence of anxiety and fears. Rather, it means a willingness to name, claim, and, if possible, work through your fears rather than succumb to them. It means acknowledging your desired outcomes while simultaneously relinquishing any efforts to control them. It means a willingness to enter the unpredictability and mystery of your personal and communal faith journey. If you are free enough to embrace a truth larger than your own--free of efforts to hide from uncomfortable truths or blind yourselves to a common good that may ask more of you than you want to give--then your power to discern is enhanced. The power of such spiritual freedom is yours to claim. No one can claim it for you or work towards it for you. Freedom is inherently yours to begin with. If you do this work collectively, if you maintain deep roots of knowledge, passion, and conviction while holding all things lightly, then you will have access to the Spirit moving through you and among you, The movement of the Spirit and your own search for enlightenment and understanding are at the heart of discernment. Discernment is the polar opposite of politics. It is a continuous focus on winning, not on having won and resting on our laurels. Winners and Losers. Let us talk about so-called winners and losers. Who is better? The St. Louis Rams or the Dallas Cowboys, the French or the Irish, African Americans or Caucasians or Hispanics, rich or poor, tall or short, women at the well or men at the "Y," a lilac ora rose? We humans are prone to thinking in categories and classes. We have carved up God's creation into categories. We have boxed and labeled the people and things of our world as good or bad, right or wrong, winners or losers. Review for Religious ¯ We have prejudices, biases, preconceived notions, assumptions, and conscious and subconscious judgments that put price tags on so many things that God looked at and said are "good." God sees us all as both blessed and broken, but we seem to view ourselves as good, better, best, less than good or less than evil, depending upon our looks, ethnicity, friends, affiliations, or supposed motives. Children not chosen for this or that often feel "excluded" and "hurt." Out of such feelings we form judgments and begin to think in terms of winners and losers. From facilitating many community discernments over the years, I consider all participants winners. All community members who are endorsed, who come to discernment gatherings, who respond to the call to serve in elected leadership are winners. They take risks that have brought hurts in the past and perhaps even made them say to themselves "Never again." COmmunal disdernment i~,~[fOiJ[: ~de" }in g women ~ ~or men ~who,brzn~ g together a complement of gifls tha~;~in its ~isimportant for ~he :enti@ ~com~u~ity. Those who participate in discernment are asked to reach deep inside themselves to find hope again, when staying disengaged would be easier. Individually and together they are winners as they extend themselves beyond their comfort zone in response to calls from their community. Conventional politics would suggest that those who are elected have the "right stuff" and those who are not elected do not. Communal discernment, however, is about electing women or men who bring together a complement of gifts that, in its unity, is important for the entire community. 64.3 200Y Dunn ¯ Where Two or More Are Gathered Not long ago my wife and I attended our daughters' graduations, Kelly from high school and Colleen from middle school. For the occasion we went out to buy them some flowers. The florist asked, "What are their colors?" I was taken aback, having expected to pick out bouquets from the showcase and be done with it. She escorted us to a refrigerator, showed us a vast array of flowers, and urged us to have a whiff and take a good look at them. Before long we had flowers and greenery and paper strewn over the counter. Other customers watched us try various combinations to see what would best fit each girl's particular likes and sense of beauty. There were lilacs, roses, and other flowers whose names escape me. In combination, some were not the right color and some not the right fragrance. Some got lost alongside others. All were beautiful in their own right, but some fit better than others in the bouquets. At last we had two unique bouquets, each beautiful, each saying what we wanted to say. In your next communal discernment, remember that every individual has a beauty all her own. Blessed and broken, gifted and flawed, they are on the same journey as you. Some combinations of their beauty will express what you want to say, what you hope leadership to be. Others will not. This makes them no less wonderful, no less worthy. Their beauty will find other bouquets. In your next discernment, honor all these women (or men) with your prayers. Support all of them with your encouragement. Affirm them for their courage in walking deep into discernment with you, opening themselves up in personal ways to you, to each other, and to God. Walk gently with them. Your next chapter of election will be a continuation of the work you have begun at earlier chapters. It presents you with an opportunity to grow in communal discernment and Review for Religious be more faithful on your personal and communal faith journey. Anticipate, identify, and resist any regressive tendencies. Keep the election a matter of the Spirit, not a matter of mere numbers. Do not let it be about winners and losers. You are all winners, for you are all on the same team. Be gentle with yourselves and with your mistakes, for mistakes will surely be made. In your efforts to write new memories on the walls, may the Holy Spirit be your guide, and, where two or more of you are gathered, may you find Jesus in your midst. The Transient Seed To go wherever you would lead Will mean ourselves to die, Forsaking self and every need For you, risen, on high. Buried with you, the transient seed Awaits your Spirit-cry Creating us anew, rubied By blood from Calvary. Walt Bado SJ 64.3 2005 MARIE DE LOURDES MATES Chapter Delegates, Once and Future ~onh~hne m qyu arleigtiieosn aanl dsu rpeesrpioonr saisbkileidti ems eo tfo c shpaepatekr delegates, my response was typically prophetic. I screamed into the phone: "What? Me? Why me? Don't you think I'm a bit too old for this? You're twenty-five years too late! I know a lot of people who could do a better job." She listened politely and then replied, "Well, will you at least think about it?" So I did, and for some reason I just could not say no. Father Robert Morneau's article (1977, almost thirty years ago) was suggested as the basis for what I might say. Since I did not have a copy of it, I began to make my own list of qualities a delegate should have. I came up with a dozen or so. To my surprise, when the article arrived I discovered that the future bishop and I were thinking along the same lines. I thought to myself, "Maybe I should have been a bishop!" Many of you could Marie de Lourdes Mates IHM, who has taught at all levels of K-12 and published various articles, resides at the IHM House of Prayer; 140 West Mill Street; Nesquehoning, Pennsylvania 18240. Review for Religious come up with a similar list. I admit, though, that I learned a great deal in getting this presentation ready and even experienced a kind of conversion. That is what I will share with you now. The first word that came to my mind was articulate. I wanted delegates who would speak out loud and clear. But almost immediately I had a second thought--Whoa! Suppose they go too far and destroy what our unique history has gifted us with. No, another thing that must be present is a listening ear. This slowed me down, and I pondered the word dialogical, which Bishop Morneau had used. I called upon Webster for help: "dialogue: a talking together, a conversation." Not sufficient! Definition 2: "an interchange and discussion of ideas, especially when open and frank, as in seeking mutual understanding and harmony." Perfect! In other words, the listening has to be of a special kind, but so also does the speaking. To be articulate means to speak easily and clearly; you have to be pretty well convinced about what you are saying. Let me interject here a little story about listening. An interaction years ago with a freshman girl stopped me in my tracks and made me realize I was not truly lis-tening. Her parents were divorced. Her father was out of sight. The thirteen-year-old and her mother lived together, but in time the mother became interested in another man. She left her teenage daughter to fend for herself every weekend while she traveled by plane to spend two days with him. When. the daughter told me this story, I tried to explain that her mother had needs also. She looked up at me with tear-filled eyes and said in a shaking voice "But what about me?" I knew at once I had failed to enter into her world. I have never for-gotten her words, and even now they haunt me, still find-ing it hard to really listen. 64.3 200.q Mates ¯ Chapter Delegates, Once and Future Our delegates need to speak easily and clearly, but they also need to listen with a compassionate desire to enter into the speaker's world, not necessarily agreeing but at least understanding. Besides speaking and listen-ing well, Bishop Morneau said delegates must have trust. I thought, "Oh, this is an easy one. Isn't it a given that members of a religious community have a deep abiding trust in each other, as their polite conduct habitually shows? The thing that stymied me was that Morneau went on to say that they must have trust also in themselves. I puzzled over this long and hard. I came to realize that persons who have trust in themselves will speak their own insights and convictions with a certain self-confidence. I realized, too, that to do this they must spend time and energy listening to others and be willing to say inside chapter what they say outside chapter. Coupled with trust is another virtue, desire for truth. Regardless of who speaks--a retired sister, a young novice, a former mother general, an infirm sister, an artist (musician, painter, sculptor, poet, and so forth), or just one of the rest of us--the delegate's desire for truth must help her listen and then evaluate. She needs to turn off the stream of consciousness that runs all day long and sometimes washes past others, hardly slowing down for them. Our delegates should be prophetic persons. The Old Testament prophets acquiesced to God's call only reluc-tantly. Consider the following. Isaiah says, "What a wretched state I'm in. I am a man of unclean lips." Review for Religious Jeremiah says, "Look, I do not know how to speak; I am a child." Jonah--well, he just ran away. But God was insistent. With Isaiah: "Let's see if this live coal touching your lips will help." With Jeremiah: "Don't say you are a child. Go, now!" With Jonah, a storm at sea begins to get him to pay some mind to God. Consider the great-est prophet of all, Jesus: "Father, if it be your will, let this chalice pass. However, not my will, but yours be done." Being prophetic does not appear to be a much-sought- after vocation. I am mentioning these things about prophets because the women we elect as delegates will automatically assume the role of prophet. They will be missioned by us to determine the future direction of our IHM commu-nity. If this direction is to be in accord with the will of God, certain characteristics should be evident. They should be women who are perceptive, sensitive to the here and now. We hope they will walk unshod the way of the lowest and the least. We want them to come up with new and exciting ideas for all of us--the old and infirm, the young and ambitious, those nearing retirement, those changing their apostolates. We want them to respond sensitively to the question "But what about me?" as each group asks it. We also want them to be sensitive to our roots and traditions, knowing enough of our history to stand firmly on the shoulders of the courageous holy women who were here before us. Prophets are courageous. Consider some from our own time. Dorothy Day, who did jail time for civil disobedi-ence and also (as Father Richard McSorley said) "led the way within the Catholic Church on solidarity with the poor, racial justice., all those big issues., she brought the name Catholic to all of them. These issues that pri-vate Catholics see as politics she saw as faith, and knew it had to come from faith and be alive with faith." 64.3 200~ Mates ¯ Cbapter Delegates, Once and Future Consider our foundress, Mother Theresa Maxis, who was forced to live outside the community she had worked so hard to establish. Consider Mother Teresa of Calcutta, who embraced lepers and opened her heart to the poor-est of the poor. Consider Joan Chittister, Benedictine sister, ' whose outcries for justice and peace have been heard and will continue to be heard by many around the world. Perhaps now as we prepare for the chapter of 2006, some new courageous happenings will occur. Courage can be manifested in all kinds of ways. It might be just bringing an issue to the forefront for consideration. It might be putting some relationships in jeopardy because of what some see only as boldness or outspokenness. The model delegate should be a person of vision-- but what exactly does that mean? It definitely does not mean they live in la-la land. Sometimes, however, I think that the term vision triggers a picture of someone out in space. So let us bring it down to earth. Simply, an IHM sister of vision sees something that many do not. That "something" could be anything from a cute idea to a unique dream. It could be something so commonplace as a one-on-one learning environment, only one teacher and one learner. It could be a duck farm. A friend called me one day and asked if she and her cousin could use my computer and set up a conference call with a con-struction company. I said yes, thinking it was a matter of great import. It turned out that he was just starting to plan a duck farm. His long-range plan was to raise ducks for gourmet restaurants. To me this seemed crazy, but when he promised me a duck dinner I thought--who knows?--that maybe in the not-too-distant future he would be a man of means. The sister who has vision will see value in what at first seems crazy to most people. I am suggesting that Review for Religious we have to look beyond the ends of our noses to deter-mine the best direction for our aging community. We need to have some answers for the young, the old, and the in-between in our community when they ask, "But, what about me?" Victor Hugo, author of Les Miserables and The Hunchback of Notre Dame, had this to say about visions: "Progress will be carried forward by a series of dazzling visions." I love that word "dazzling." The visions have to be startling; they have to awaken us and get us moving. Long before Victor Hugo, the prophet Habakkuk also had something to say about "the vision." I remember it from a time about twenty-five years ago. In her morning talk a speaker had created an air of excitement, but in the after-noon session the excitement disappeared. I left the assem- .,,. Prophetie delegates need t6 be pcrsoqs, of " ,de ray&;: especially script al prayer. bly feeling rather down, but I remembered the words of Habakkuk from the day's Scripture reading. It is time to hear those words again: Write down the vision clearly upon the tablets, so that one can read it readily. For the vision still has its time, presses on to fulfillment, and will not disappoint. If it delays, wait for it, it will surely come, it will not be late. (Hab 2:2-3) As I said, being a prophet is not a fun thing. Prophetic delegates have to work hard: read, study, do research. They have to make decisions, some very hard decisions. They have to make them decisively, with cer-titude (as Morneau says, referring to Newman), and then hold themselves responsible for what results. They need to be persons of deep prayer, especially Scriptural prayer. 64.3 200Y Mates ¯ Chapter Delegates, Once and Future Such prayer will illuminate their understanding of con-temporary issues. Dorothy Day can help us here. In her autobiography The Long Loneliness, she describes herself at the age of ten. "We lived in a house with an attic, and I spent hours one rainy Sunday afternoon reading the Bible. I remember nothing that I read, just the sense of holiness in holding the book in my hands. I did not know then that the Word in the Book and the Word in the flesh of Christ's humanity were the same, but I felt I was handling something holy." Dorothy's love of the Scriptures persisted throughout her lifetime and even-tually led to her conversion to Catholicism and to her lifelong work with the poor. Scriptural prayer should be the mainstay of every chapter member. It already plays a major role in all of our lives in the Christian Prayer that we pray three times a day. It would be worth the while of every chapter delegate, in fact every sister who puts her name on the list of nom-inees, to ponder well the words of Hebrews 4:12: "The Word of God is something alive and active: it cuts like any double-edged sword but more finely; it can slip through the place where the soul is divided from the spirit, or joints from the marrow; it can judge the secret emo-tions and thoughts." And then suddenly in verse 13 it switches from the Word of God as an "it" to the Word of God as "the one": "No created thing can hide from him; everything is uncovered and open to the eyes of the one to whom we must give account of ourselves." Dorothy Day at age ten was assuredly an inspired person. You might wonder why I have referred to Dorothy Day more than once. When I was a junior in high school, I joined the Martin de Porres Club at Harrisburg Catholic High. Every Thursday my friends and I traveled to an inner-city house run by a woman named Mary Frecon. There we taught little African American children, helping Review for Religious them with their school work and interacting with them. One Thursday I noticed that the work space was spruced up as if for something important to happen. About the middle of the session, Mary came through accompanied by an elderly woman with white hair. They simply paused for a few minutes, and I simply ignored them, being involved with the children and their work. Afterwards Mary came back and exclaimed, "Do you know who that was?" I shrugged my shoulders. She said, "That was Dorothy Day." I shrugged my shoulders again. Later on in life, I got to know about Dorothy Day. I have never forgotten her favorite quotation, taken directly from Dostoyevsky's The Possessed: "All my life I have been haunted by God." To that I add: All my life I have been haunted by Dorothy Day! To me her life seems the per-fect response to the question of the poor, the addicted, the sick, the helpless when they ask "But what about me?" Morneau ends his article about chapters by portray-ing the delegate as a wounded healer, the term that Henri Nouwen had introduced. Most of us would admit to being wounded people, people who have experienced some deep hurts, which sometimes seem beyond heal-ing. But out of those hurts can come deep compassion for others who are hurting. Without being told, one can sense it. Compassion heals, not only the one to whom the compassion is directed but also the one who is showing compassion. Hopefully, the delegates we choose will be women of compassion. Persons of compassion do not make judgments on the motives of others. If you have ever been the object of judgmentalism, your experience helps you avoid inflicting such destructiveness on others. A delegate should be able to balance tolerance of per-sons with an intolerance of falsity. Do not be dismayed if you are chosen to be a chap-ter delegate and you do not have all these qualities. It 64.3 2005 Mates ¯ Chapter Delegates, Once and Future will be an elegant sufficiency if the chapter assembly itself contains individuals who together have these qual-ities. It would be a miracle if anyone had all of them. Here let me quote, what Morneau quotes toward the end of his article (Micah 6:8): "This is what Yahweh asks of you: only this, to act justly, to love tenderly, and to walk humbly with your God." I would emphas!ze the first challenge: "to act justly." I believe it encompasses everything that has been said up to this point. If we work to act justly, to DO justice, everything else will fall into place. As a community we are already becoming more involved in works of justice. We are responding to the poor and the needy here in the United States and in Haiti, Peru, and Chile. We are attentive to the question "But what about me?" and are alleviating pain and suffering where we are able. One day in Louisville, Kentucky, at Fourth and Locust, Thomas Merton suddenly realized that he loved all people and no one was alien to him. As a community we are growing in that same realization. For me there occurred a profound conversion to justice in the sum-mer of 1973, while I was studying physics at Rensselaer Polytechnic Institute in Troy, New York. One weekend a Franciscan sister took me along to her motherhouse in Buffalo. We visited Niagara Falls, and I was duly impressed. But later we drove upstream to view the Niagara River, the flow of which creates the falls--and mesmerized me. The river's swiftness took my breath away. The sunlight glittering off the surging waters filled me with a kind of supernatural joy, while their force to sweep everything before it--and me too if I let it--fright-ened me. I have never forgotten that impression. The memory awakes in me every time I read the prophet Amos (5:24, l~SV):."But let justice roll down like waters, and righteousness like an ever-flowing stream." Review for Religious Can you imagine what our world would be like if more and more people let their justice roll down like a river? For us I think the time is ripe. Let's ROLL! The Crossing John 6:17 The crossing is hazardous: fragility 6fold wood in a fretful sea, the weight of oars against contentious waves, implacable darkness, absence of horizon, ominous thunders. Then - the skin grows cold with terror - like a brooding spirit he comes gravely across the water: fathomless radiance, first light of a new world. They stammer in recognition and welcome him into the boat where no one dares question what darkness he has crossed to bring them safe to land. Kate Martin OSC 64.3 2005 MELANNIE SVOBODA Community Chapters: Seven Personal Beliefs y personal beliefs about this chapter we are ~. iv .1. beginning amount to seven, the perfect biblical number. 1. This chaplet won't be easy. I say this not because I have some secret knowledge of what will transpire here these next few days. I say it because this chapter is a part of life and life is not easy. As we know, in the Bible the primary image of life is a journey, and any journey is fraught with difficulties. It takes courage even to embark on a journey, because we must leave where we are, we must let go of the known. We cannot start on a journey and stay put at the same time. Once we have taken to the road, we must negotiate unexpected turns, steer clear of dangerous potholes, plan regular "pit stops," devise detours around roadblocks, interpret road signs, and check the fuel gauge regularly. (Recently I saw a cartoon of two men walking away from their car. They had run Melannie Svoboda SND, provincial of the Sisters of Notre Dame of Chardon, Ohio, presented this material as part of the opening of their chapter of December 2003. Her address is 13000 Auburn Road; Chardon, Ohio 44024. Review for Religious out of gas. One man says to the other, "I thought the E meant Enough!" It is one thing to see signs, another to interpret them correctly!)Journeying is hard work. Small wonder that we are often tempted to forsake the life journey by going back into the past (it is familiar and feels safe), by stopping altogether, or by taking a side road that is easier but leads to no place worth going. At this chapter let us recommit ourselves to the hard work of daily living, to the hard work of our earthly jour-neying. And let us commit ourselves to the hard work of this particular chapter--four days of undeniable self-discipline, the discipline of sitting, listening, speaking, praying, discerning, waiting in line. Talk about modern asceticism! 2. This chapter will be fun. It will be fun because we are here--and just look at us! What a unique group we are! Has God got a sense of humor or what? This chapter will be fun because where we are there is bound to be some joy and laughter. When we did the recent inter-views for the Appreciative Inquiry, how many of us said that one reason we were drawn to the Sisters of Notre Dame in the first place was their joyfulness! This chap-ter will be fun also because the planning committee has thought up some fun activities for us to do. But, most of all, it will be fun because we know who is ultimately in charge of this chapter. Not me, not our facilitator, but God! Yes, at this chapter we will discuss some seri-ous issues. Yes, we will make some serious decisions. Yes, there may even be a few tears as we try to express what is deepest in our hearts. But I hope we will do the work of this chapter with a lightness of heart that comes from our charism: that deep experience of God's goodness and provident care. Jesus is at this chapter. Maybe we should have made a folder with his name on it, Jesus is here in word, in 64.3 2005 Svoboda ¯ Community Chapters 254 sacrament, in each other. It is in Jesus' name that we are gathered here, and, as Jesus promised, "Where two or three are gathered in my name, there I will be!" Jesus is with us. Emmanuel. That fact cannot help but bring smiles to our faces! 3. This chapter needs me. This chapter needs every sis-ter regardless of her age, education, health, ministry, temperament, background, mood. It needs every sister regardless of her chosen level of participation. In the name of all of us, then, I welcome every sister to speak. And I welcome every sister to listen and to pray. Throughout these days we will have times of formal dis-cussion. But we will also have times of informal sharing as we gather around the coffee urn, eat lunch together, meet in the hall, or ride back and forth in a car. The Spirit can use even these times to move hearts. Perhaps I may never say anything at the open mike, but I can still influence this chapter by some.thing I say in my small group or even while standing in line for the restroom. 4. This chapter must be rooted in the real world. God is found only in the real world--not some fantasy world of our own making. No, in the real world. And what does the real world look like? First of all, it is a world of incomparable beauty--from stars to snowflakes, roses to mountains, sunsets to the Grand Canyon. So much beauty! It is a world filled with innumerable people of goodwill--in all lands, in all cultures--people who live their lives with faith and love. But the real world is also a world steeped in war and violence. Historians tell us the 20th century was the bloodiest century in human his-tory. Ours is a world of the obscenely unfair distribu-tion of the world's limited resources--where 1.2 billion people live on less than one dollar a day. The Jesuit Jon Sobrino calls this reality a "macro blasphemy." It is a world filled with hunger, poverty, greed, corruption, and Review for Religious wanton disregard for the sanctity of human life. I could go on. But, the fact remains, this is the world into which Jesus was born over two thousand years ago, the world in which he still lives. And it is the world he calls us to serve today. This chapter, therefore, must acknowledge both the beauty and the ugliness of the real world. It must take into consider-ation both the light and the darkness in the world--the world not only out there, but the world in here, in °,. ,,. ~ .~' .' our community and in our own hearts. We began our chapter with a reconciliation service. That was no accident. May forgiveness and rec-onciliation be an underlying theme of everything we do here these days--and beyond. 5. This chapter can't do everything, but it must do some-thing. When we contemplate all the needs of the world, we can become overwhelmed. So many voices crying out for help! Yet our resources are so limited. At times the inces-sant cry of the poor can even paralyze us. We can find ourselves crying, "We can't do everything!" And that is true. We cannot. But, for God's sake, let us do something. I believe this chapter will do something. I do not know what, but it will. That something might be the passing of a proposal dear to my heart--or the defeat of one I cher-ish. Maybe this chapter will result in a single step in a new direction or an old one. Or maybe this chapter will begin to name the content of our next province plan, the focus of future province summer assemblies, or the agenda for the next provincial leadership team. Whatever this chapter does, I hope and pray it will result in some definite corporate movement forward. But °our chapter i ith recOnciliation service? 64.3 2005 Svoboda ¯ Community Chapters I also hope this chapter will challenge me on a deeply personal level. I hope it will make demands upon me, stretch my thinking, and cause me to question some of my daily choices--and cause me to alter them in per-haps subtle but very real ways. 6. This chapter will not be perfect. That is because we are not perfect. And imperfect people do not a perfect chapter make! Sometimes I hear sisters say, "I don't expect much from this chapter, because all we do is talk about the same stuff over and over again. I'm tired of it!" Well, I'm not! I am not tired of the fact that we often end up talking about the "same stuff"--like community, ministry, prayer, the vows, mission. I am not surprised or disappointed either, because that "stuff" lies at the very core of our identity as women religious. The way I see it, we will always be talking about these things--we should be! Why? Because we are on a journey, and, as we go forward, life will continuously challenge our under-standing of who we are and what we should be about. Could we ever exhaust the topic of prayer? No. Will we ever be "finished" with mission? No. Will we ever be able to say, "Well, we have no more problems with community living." Or, "Well, we've got poverty down pat now, so let's move on to something else. How about chastity?" No. In the novel The Secret Life of Bees, August, a middle-aged black woman, says to the little girl Lily, "There is nothing perfect. There is only life." We could say something similar: there is no perfect chapter. There is only this chapter. The feast of Christmas reminds us that Jesus came into our broken and messy world. He did not wait for the ideal time to come. Let us not let our hopes for the ideal chapter prevent us from doing some-thing good with this real one. 7. This chapter must be about loving. Let there be no mistake: we are gathered here these four days for one Review for Religious purpose only: to become better lovers. That is the bot-tom line. This chapter must help us to love better the incredible God who seduced each one of us into mak-ing a lifelong commitment of "chastity, poverty, and obe-dience according to the spirit and content of the Constitutions of the Sisters of Notre Dame." God seduced us. I know of no better word to describe the experience we all underwent. As consecrated religious we have the duty to keep ourselves in this ardent, pas-sionate, and dangerous state of loving. May this chapter rekindle our wholehearted and reck-less love for God, for Jesus. May it remind us that we are partners with Jesus in his mission--not because we have signed up for a cause, but because we have said a loving yes to a person. May this chap-ter rekindle our love for the. church. Oh, the church! Our poor, poor church! The terri-ble scandals! The unspeakable crimes! The betrayal, the deceit! But may we remember that this church is still our church. It is still Christ's church. As Archbishop Sean O'Malley, of Boston, said at his installation ceremony, "though we are living through a ~ad chapter in the church's history, we must recall that it is a chapter, not the whole book!" And then he said these profound words: "We come here today to ask God to make our pain redemptive." What fitting words for us, as Sisters of Notre Dame who have a 153-year-old history of being marked by the cross and a 153-year-old tradition of loy-alty to the church. And, finally, may this chapter rekindle our love and devotion to one another. May it remind us that, by mak- , H'a~v .e. .w. e :ever tho:u g h t ¯of a chapter as having onepuNoseonlY) :to become ,better.lovers ? 64.3 200Y Svoboda * Community Chapters ing our vows, we have bound ourselves to one another for the term of our whole lives. We have promised to live religious life not in the abstract, but within this partic-ular, concrete congregation, the Sisters of Notre Dame. For most of us that means being embedded in the province of Christ the King of Chardon, Ohio. We live in a culture that deifies privacy, individualism, and con-trol of one's destiny. Such a culture desperately needs our witness of community, the witness of diverse indi-viduals living and working together--selflessly and joy-fully-- in Jesus' name to bring about the kingdom of God. My final prayer is a simple one. May this chapter rekindle in us the hope-filled daring of St. Julie, of Sister Aloysia, and of those countless sisters who have gone before us. And may our hope-filled daring be an inspi-ration for those Sisters of Notre Dame who will come after us--in whatever country they may be. In his apos-tolic exhortation Vita consecrata (§110), Pope John Paul says these words to us: "You have not only a glorious history to remember and recount, but also a great history to be accomplished." May this chapter be one small step toward the accomplishment of that great history. 258 Reflection Questions 1. What are the personal beliefs I would list about an upcoming chapter in my congregation? 2. What are some of the ways that we, could bring a sense of joy and a sense of passion into the ordinary busi-ness of a chapter? Review for Religious MARIE BRINKMAN Invisible-- Even to Ourselves? It comes as something of a shock to learn that some people of the Catholic faith community do not know what we are up to--we women reli-gious, that is. Engrossed in ministry as we are most of the time and in close touch with asso-ciates, colleagues, and other friends who by now take for granted our attire and our social or pro-fessional habits, we hardly realize that some still wonder where we have gone or why we live as we do.~ Others see almost nothing of our pre-sent community life or our ministries born of renewal, for we have made ourselves invisible. Unless they happen to know one or two us per-sonally, young women see little of the differ-ence we make to the church and less to attract them to the vowed life we lead. This is a claim many of us might question or debate, but few young women are knocking at our doors to give themselves to our enterprise. ] 259 I :. Marie Brinkman SCL wrote for us in 1971 and 2001. She may be addressed at Sisters of Charity; 4200 South Fourth Street; Leavenworth, Kansas 66048. 64.3 2005 Brinlrman * Invisible ~ Even to Ourselves? I want a other generation Of sisters for the ture mission and life of our community? This is not the place or time to raise moot questions about discarded religious symbolism. Options have been made available, freedom to discern how we will dress and where or with whom we will live in relation to ministries that we believe witness to the gospel. Yet, forty years after the beginning of our renewal, people ask if we are going to survive as vowed communities or congregations. How have we failed to convey to ,:~ them that we are not only alive and well but also are planning for a future even more vigorous and effective than our past? Given our reduced numbers and what some perceive as a disappear-ing act, that may sound like a pipe dream: Women's intu-ition, unreliable. Wishful thinking. Plain presumption. We stand open to such charges, but we do not accept them. Our young sisters are realists and pose questions of their own. Let me mention a few I encountered as we. were preparing for our sixteenth general chapter. In the reports from the council, from task forces, and from standing committees, notes from sisters fifty-five and younger were given careful attention. Calling themselves "Between Alpha and Omega," these sisters--who stand between the community's past and future--asked about the quality of community life, the diffusion of ministries, and a "visioning process" for looking at our future. A few paradoxes appeared as well as concerns we should all share. Repeatedly they asked for direction from com-munity leadership. ¯ Does the small size of local houses limit choices of how we can live in community? Review for Religious ¯ Are local communities willing to support a new kind of associate program allowing young people to live with some of us for a limited or extended time? ¯ How can we envision the future of relationships between SCLs and HCLs (our North American sis-ters and our hermanas of Latin America) and between our sponsored works and new ministries? That is, how can we deepen our unity of mission?2 Questions from the Associate Program director sug-gest the need for greater unity with the laity with whom we have intentionally allied ourselves for the past twenty years. Ties have been forged, and leadership within our institutions has been handed over; the identity and roles of our 180 associates are not so clear. One of them asked me how they might become more aware of the issues we face in chapter and beyond. That suggests a need for better communication and stronger collaboration with our associates--a stage other communities have already reached and gone beyond.3 A fundamental question the director of vocation min-istry posed to chapter delegates was a challenge that implied more than prayer and moral support. She asked us to ask ourselves: "Do I want another generation of sis-ters for the future mission and life of our community?" A firm yes in reply would bring a pledge to tithe a percent-age of time for the effort. Extrapolating from her recom-mendations suggests ways of committing time and talent. For example, the communication office for promotion of religious life in every channel of the media could draw on the volunteer services of active retired sisters. Houses of hospitality throughout the community could use the services of partially employed or volunteer sisters.4 A startling question came from the director of ini-tial formation, speaking in chapter on behalf of the fifty-five- and-under group. She wondered whether we realize 64.3 200~ Brinkman ¯ Invisible --Even to Ourselves? that, as women religious deepening our renewal of mis-sion and ministry, we are living "on the fringe" of the church in its present hierarchical operation,s Given facts from which the question comes, I would have replied that on the contrary we are at the heart of the church renewing itself. It is a matter of perspective, but I think she is the more realistic about the present and a consid-erable piece of the future. During a chat after an inter-congregational gathering, a novice, expressing what she felt, said in effect: "Where's our vision? Let's not be dis-tracted by a future of diminishing numbers and advanc-ing age. I want to hear us talk about the present and our potential and what we can do now to make a new future come to be.''6 She wondered whether so many small dwellings and so little cultural diversity can offer com-munity to new members. That is the voice of new life and promise. That is the echo of our founders, who knew nothing but risk and challenge. What they did we can do on new frontiers and in new ways. In her report a community councilor considered our progress in living out the vision statement of the 1998 general chapter, pledging us "to love the poor, to love one another, to live simply, and to unite the whole of our lives in the poor and loving Christ." Some of her questions challenged us to assess our lives in the light of priorities we have set for ourselves: to partner with the poor for mutual transformation, to simplify our lives in the spirit of our founders, and to make our local com-munity a welcoming experience and genuine support for each member--rather than a comfort to ourselves. Other questions challenged us to deeper awareness of what globalization has brought to the poor, to all our ministries, and to the life and mission of the church. They asked us to examine what "gospel values" and "work for systemic change" mean--in terms, for example, Review for Religious of personal and house budgets. They asked if we wish to--or even can--remain an ethnically homogenous group in the face of cultural diversity that is literally changing the face of the country we live in. Does our advocacy for the poor change us as it should?7 The councilor's questions carried implications. We may not be aware of who we really are or have become. Deeply different experiences of religious life and com-munity living divide us even within our day-to-day unity. The reconciliation we struggled to achieve during renewal chapters allows for a degree of hid-den complacency. Different perspectives on how our ministries--individual and community-sponsored-- manifest our mission may hinder further transforming action. Do we know what we are capable of and to what the Spirit now calls us? It is only fair to remark here that the chapter confronted these and other prob-ing questions persistently and with no little vision and courage. Writing the story of our community's last fifty years, I have learned something of the potential residing in institutions we sponsor and in various ways still staff. Their growth over these decades of diminishment reveals what women have always done in times of retrenchment: put people first, get purposes clear, find means where there were none, and never take no for an answer. The deluge of facts and figures took shape in patterns of change and renewal that most congrega- 64.3 2005 Brinkman ¯ Invisible -- Even to Ourselves? tions could duplicate or surpass. They include: ¯ mergers and coordinated systems of parochial schools, moving from strength of programs into lay administra-tion and staffing, and continuing commitment to under-served or inner-city areas ¯ the maturing of a small liberal-arts college for women into a coeducational university offering baccalaureate and masters' degrees to working adults, getting under-prepared minority students ready for college, educating youth to service ¯ incorporation of hospitals--regional leaders in health-care-- under a centralized health-services system com-mitted to community education and the care of all persons in need regardless of their ability to pay ¯ operating clinics staffed by sister or lay administrators and volunteer professionals to serve uninsured families and individuals ¯ transforming homes for parentless children into com-plex professional partnerships for treatment, care, and schooling of emotionally disturbed youngsters in both residential and day programs ¯ staffing missions in Latin America through forty years of growth into native leadership in formation and expan-sion of catechetical and healthcare ministries. As separate incorporation and lay boards for hospitals, homes, and the unive~'sity became advisable and advan-tageous, community sponsorship maintained the charism of the Sisters of Charity of Leavenworth through strong programs of mission integration. Certainly such collab-orationand continued presence in institutions that serve cities, states, and regions affirm an identity and confirm a religious mission. Are numbers, uniform dress, and common quarters necessary for recognition and symbolic significance to those who care anything about it? If not, what then is lacking? Why are those who retain such out- Review for Religious ward signs drawing young candidates, and why are we who faithfully minister without them relatively invisible? Individual ministries have witnessed to the gospel and offered religious presence in unprecedented ways during the last four decades. Pastoral ministry drew early numbers; women took leading roles in liturgical renewal, youth ministry, and the adaptation of the RCIA to cate-chesis and religious formation. Degrees in theology, min-istry, and canon law led sisters to chancery offices and marriage tribunals, to social services and diocesan hous-ing, and to spiritual direction and retreat centers. Choices of hospital chaplaincy, ministry to the dying and their families, guidance in holistic health, and counseling of delinquents, single parents, and families meant personal encounters that called on a deep prayer life and com-munity bonds. More rare but equally demanding have been calls to scholarship, writing, and the creative arts. Potentially paradigmatic in their effectiveness and extent are individual ministries to AIDS patients, admin-istration of mission and even city parishes in the West, and repair and renovation of houses for poor families in urban areas. Partnering with civic agencies is integral to such ministries. Our Office of Social Justice and Peace has allied our communi~ for these thirty years with the lobbying forces of Network, with religious and lay groups committed to creating a sustainable environment and combating systemic poverty and oppression, and with the humanitarian offices of the United Nations. Such collaboration is common to most religious congrega-tions. The community's leadership has allied us with the Charity Federation and the Leadership Conference of Women Religious (LCWR) in their proactive agendas of renewal and mission. All of these ministries and alliances are familiar to professed religious. To allude to them is to make a point, 64.3 2005 Brinkman ¯ Invisible --Even to Ourselves? 266 namely, that the renewed unity of mission and ministry that many now seek and a renewed visibility in service to the church consist in much more than celebrating our differences and prioritizing our use of limited resources. Our unity and visibility consist, on the other hand, in more than freedom to diversify our ministries in part-nering with the poor. Making our mission and commu-nity manifest requires that we discern the Spirit's call to all women religious who believe that in their unity the people of God have a unique source of power. Our vis-ible unity must become the sign of Christ and his church that religious life is meant to be. Our unity is a crucial response to the Spirit, whose power alone can transform the church and turn back the global tide of cultural enmity and systematized violence. One of the foundations for our own faith in our future is the solid work of renewal that has continued through decades of loss and diminishment and through a period of relative immaturity in dealing with new free-doms to dress, drive, reside, and relax as we chose. This renewal effort hungers for deeper prayer life while seek-ing more effective channels of action. This renewal effort calls for community bonds that will hold firm across dis-tances and separations. Once realized, it is communion, the ultimate grace of vowed life on earth. The unity we seek requires deliberate decisions like these, adaptable to our individual communities: ¯ To find common ground for all our ministries, individ-ual and communal, in the church's mission to transform social and economic structures of oppression into resources of human growth. This means conscious commitment to uncover and combat causes of the suffering we constantly work to alleviate. ¯ To create a community culture that is welcoming and visible to young women who may desire to live and work Review for Religious with us for varying periods of time as associates com-mitted to the gospel. This means opening certain con-vents to women of various ethnic and educational backgrounds willing to learn of our charism and mission without seeking a vowed life. ¯ To make of our community communications a min-istry (rather than simply sources of information), a min-istry that lets our various publics know that all our ministries are part of the broad mission of the church on earth. Admirable models of print and electronic media exist that show salaried personnel and volunteer workers dedicatedly pursuing the goals of the religious commu-nities that own or sponsor the various large or small institutions and initiatives. ¯ To seek new ways of bringing gospel values into the national conversation: new forms of education at all lev-els (like the Jesuits' Cristo Rey schools), or public lec-tures and dialogue inspired by the community's mission (like the Benedictines' Atchison Threshold or the Global Institute at Leavenworth's University of Saint Mary). This means collaborating imaginatively and being will-ing to take some risks. ¯ To seek collaborators among associates, alumni/ae, and other friends for ventures into the public arena that do not depend on financial support or common allegiances. This means engaging partners as Vincent de Paul and Louise de Marillac and other founders of apostolic con-gregations did, perfecting the art of bridge building between those with means and those without. ¯ To create offices of mission and ministry that assist sisters in transition or nearing retirement to discern where best to contribute their services, within commu-nity- sponsored institution( or in partnership with sisters and associates in other activities that can use their help. This may well mean active/retirement residences for the 64.~ 200~ Brinkman * Invisible ~ Even to Ourselves? mutual support of those more active and less active. If we energetically choose some paths like these to a renewed unity of mission and ministry in our communi-ties, a new visibility will surely follow. Notes t A case in point is John Fialka's Sisters: Catholic Nuns and the Making of America (St. Martin's Press) and Ken Woodward's review in the New York Times Book Review. 2 Sister Elizabeth Youngs SCL, "Between Alpha and Omega," Sisters of Charity of Leavenworth Report for the Sixteenth Chapter, June 2004, pp. 117-119. 3 Sister Sharon Smith SCL, "Associates Sisters of Charity of Leavenworth," in SCL Sixteenth Chapter, pp. 105-107. 4 Sister Sharon Smit,h SCL, "Vocation Ministry," in SCL Sixteenth Chapter, pp. 99-101. s Sister Mary Beth Minges SCL, "Initial Formation. 1998-2004," in SCL Sixteenth Chapter, pp. 102-104. 6 Conversation with Sister Erica Berg SCL, May 2004. 7 Report from Sister Constance Phelps SCL, community councilor 1998-2004, in SCL Sixteenth Chapter, pp. 16-25. ,Review for Religious DORIS GOTTEMOELLER Living in Community: Continuing the Conversation Scix years ago I published an article titled "Living in ommunity: Beginning the Conversation." In it I suggested that the unwillingness or inability of contem-porary religious congregations to discuss this aspect of our way of life may well be our Achilles' heel, the point of vulnerability that diminishes our integrity and threat-ens our future. The article included some definitions, theological underpinnings for community living, sup-portive spiritual practices, reflections on the role of lead-ership in creating and sustaining community, and some special challenges.1 The dozens of responses to this article that I received from readers in the United States and abroad convince me that I touched on a neuralgic point. I would say the responses fall into three categories: (1) Yes, you have touched on a vital topic, tell us what to do; (2) Yes, you have touched on a vital topic, but it is too late--we have lost too much to ever regain a commitment to commu- Doris Gottemoeller RSM last wrote for us in our 62.2 issue of 2003. Her address remains Catholic Healthcare Partners; 615 Elsinore Place; Cincinnati, Ohio 45202. 64.3 200Y Gottemoeller ¯ Living in Community nity living; and (3) No, you do not know what you are talking about; it is the wrong issue and the wrong premise. In these pages I would like to dialogue with these groups. "Tell Us What to Do" The first two groups affirm the significance of com-munity living, but seek direction for its revitalization, so I will respond to them together. Several authors offer helpful insights. In a talk given to the National Religious Vocation Conference Study Days in September 1999, Nancy Schreck OSF addressed "The forces that push us toward and pull us away from community.''2 She begins with the assumption that community involves persons living together in shared space with shared resources, not in order to re-create family relationships, but in order to create the possibility of a radical following of Jesus. She develops a force field analysis in which com-peting forces or energies impinge on the reality of com-munity. The driving forces that she identifies include cosmic awareness, the struggle with diversity, the need for prophetic witness, the action of the Spirit, the iden-tity of religious life, mission effectiveness, a new desire in the members, the desire of new members, and lim-ited resources. The forces that move against community include paradigm paralysis, U.S. mainstream culture, patriarchal influence, drift, lowest-common-denomina-tor performance, adjustments made in good faith, lack of need, lack of energy, community as an event, ability of members, public witness, the asceticism of personal growth, and participation in multiple communities. This is not the place to analyze these competing forces. They are, however, part of the ambiance of religious life today, and have to be taken into consideration in any effort to energize community living. Her article could be a won- Review for Religious derful starting point for a conversation in any local com-munity or congregation. Another analysis of the current reality comes from women religious under fifty in their newsletter Giving VOICE. The December 1999 issue addresses this topic in a number of thoughtful reflections) The editor, Jan Hayes RSM, reports that the editorial team received "an avalanche" of responses to the questions: How do you define community? Does it include communal living or doesn't it? VVhat is your experience of communal living? VV-hat is it that you bring to group living situ-ations? What is it that you need? Does communal liv-ing add to the vitality of the larger community or doesn't it? Is communal living still an integral part Do ,we findit~ helpful to compare' the loosening of communal bonds: in American society tO the ~ame phenomenon in 'women's ,religious life ? of religious life? Space precludes summarizing all of the excellent contributions on this issue, both in the articles and in the comments received from emails and letters to the editor. The overall tenor of the contributions, however, affirms the centrality of communal living to the sisters' understanding of their vocation and their desire to grow in this dimension of their life. The sociologist Mary Johnson SNDdeN addressed the issue in these pages in her article titled "Bowling Alone, Living Alone: Current Social Contexts for Living the Vows.''4 She responds to an article by Robert D. Putnam titled "Bowling Alone: America's Declining Social Capital"S and to my earlier article. Putnam's the-sis is that there has been a .loosening of communal bonds across U.S. society in the last thirty years. His provoca- 64.3 2005 Gottemoeller ¯ Living in Community 272 five title comes from his observation that persons tend to bowl alone or in small groups today, rather than joining leagues, which require regular attendance. He has pre-sented this viewpoint in Vghite House conferences and national workshops and in other publications as well, and he has been quoted frequently. In Putnam's analysis, communal bonds, norms, and networks constitute "social capital" that facilitates coordination and cooperation for mutual benefit. He cites evidence of decline in religious involvement, labor-union membership, involvement in parent-teacher associations, and volunteering in civic, fraternal, and women's organizations like the Red Cross, the Boy Scouts, the Shriners, the Jaycees, and the League of Women Voters. He acknowledges that groups like the Sierra Club, the National Organization for Women, and the American Association of Retired Persons have seen a dramatic rise in membership in recent decades. But, as Johnson notes, while the political clout of these orga-nizations is considerable, the nature of involvement is vastly different from the organizations discussed previ-ously. Putnam says: "For the vast majority of their mem-bers (Sierra, NOW, AARP, and so forth), the only act of membership consists of writing a check for dues or per-haps occasionally reading a newsletter. Their ties, in short, are to common symbols, common leaders, and perhaps common ideals, but not to one another. From the point of view of social connectedness, the Environmental Defense Fund and a bowling league are just not in the same category." Similarly, Johnson adds, "a group of friends that meets quarterly, a prayer group that meets monthly, and a support group that meets weekly are just not in the same category as a c.ommunity that lives under the same roof and interacts daily." Johnson goes on to compare the loosening of communal bonds in American society to Review for Religious the same phenomenon in women's religious life. As evi-dence she cites research findings, funded by the Lilly Foundation, from a national survey of women who entered apostolic, monastic, and evangelical orders since 1965. Her data, based on responses from 70 percent of the women's institutes (whose membership constitutes 84 percent of the sisters in the United States), indicate that 69 percent of religious houses consist of one or two sisters. When asked "If you had your preference right now, with how many sisters would you prefer to live?" these post-Vatican II sisters responded as follows: with none (11%); with one other sister (14%), with two other sisters (12%); in a group of 4-7 sisters (45%); in a group of 8-10 sisters (6%); in a group of 11-15 sisters (2%); in a group of 16-20 sisters (4%); in a group of more than 20 sisters (6%). The gap between what sisters experience and what they would prefer is intriguing. No doubt the restrain-ing forces cited by Schreck above would help explain the disparity. There is much more in Johnson's article, but overall she believes that "the work of sharply defining and rebuilding community is essential to the mission and future of apostolic religious life in the United States and other nations where religious life struggles to free itself from the hegemonic hold of middle-class values." This probably summarizes the opinion of most of the respon-dents in this first group. Now to another viewpoint. "Wrong Issue, Wrong Premise" The most explicit argument is voiced by Barbara Fiand SNDdeN in Refocusing the Vision: Religious Life into the Future.6 In chapter 4 she differs strongly with Johnson and me (pp. 147-149). Citing both of our articles, she accuses us of a bias toward living together and a "high-handed" rejection of other experiences, saying that some- 64.3 2005 Gottemoeller ¯ Living in Community thing new is evolving from the grassroots which needs to be taken into consideration. Because of the diversity of living situations today, she says, "the whole tenor of what used to be called 'community living' has changed." She adds that the alleged desire of potential new members for residential community living needs to be probed fur-ther lest it be mistaken for an adequate reason for becom-ing a religious. Finally, she suggests that Johnson's bias toward community living prejudices her as a professional investigator. Fiand seems to believe--as do others with whom I have spoken--that promoting communal living today would be an example of restorationism, a regrettable regression into some prerenewal version of religious life. It is regarded as giving way to nostalgia, a selective mem-ory about the benefits and joys of living together. Nostalgia screens out, she says, the struggles and dys-functions that were part of the reality. In response I would suggest that to restore an earlier practice with a renewed understanding of its value and with suitable adaptation to changing circumstances can be a valuable retrieval. Others object to efforts to restore community living on historical grounds. They charge that women religious lived "in community" only because the hierarchical church imposed this on us. Or, similarly, they say that something which was essential to monastic life was inap-propriately required of evangelical and apostolic reli-gious life as well. This objection would require substantial historical research. Investigation would prob-ably show, for example, that the Council of Trent's effort to insist on cloister for women's religious orders was widely resisted, as much by bishops as by women them-selves, since the works entrusted to them required the ability to be out and among the people. Cloister or papal Review for Religious enclosure, of course, is not what today's supporters of communal living envision for their apostolic lives. Investigation would probably also show that various founders from the 16th century to the present have had different ideas about the significance and modality of community living, and so the research would need to make a congregation-by-congregation review. The most neuralgic point in any discussion of com-munity living is whether a congregation should express and promote any norms around living "in common," that is, in groups of two or more. The most helpful resource here is Sandra Schneiders IHM's treatment of the issue in Selling All: Commitment, Consecrated Celibacy, and Community in Catholic Religious Life.7 The premise and context of her discussion is life in a "mobile ministerial religious congregation." Her thesis is that community life, "an intrinsic and constitutive dimension of minis-terial religious life, is theologically necessary for all mem-bers of the congregation, but that it can be embodied on the personal level in a plurality of lifestyles, both group and individual, which are related to each other as equally valid variations, not as legitimate to aberration, normative to exceptional, or superior to inferior" (p. 350, italics added). Specifically, she discusses congregational group living. (pp. 317-330) and three varieties of indi-vidual living. She defines each and spells out the cir-cumstances which may prompt it and the major advantages and challenges each brings. The three forms of individual living are living singly (pp. 330-335), living alone (pp. 336-339), and living in solitude (pp. 339-349). The first is the case of someone who would not choose individual living, but is compelled to do so by educational, ministerial, or personal respon-sibilities (such as the care of aging parents). Vghen the circumstances change, persons in this category are likely 64.3 2005 Gottemoeller ¯ Living in Community 276t 7 ~ to return to group living. The second is the case of some-one who is self-marginalized, on a sort of exclaustration without going through the formalities. This is the per-son who probably has not been seen at a community event in anyone's memory. The third form of individual living is the case of per-sons who seek and choose solitude for their own spiritual development and psychological health. Schneiders describes them as neither alienated nor estranged, but deeply committed and actively involved, perhaps even holding congregational leadership posts. They are fully accountable to congregational leadership in regard to finances, ministry, and personal lifestyle; they are fre-quently involved in very demanding ministries; they are actively committed to the justice agenda. My observation about sisters in this third category is that they are the very persons with whom I would like to share community living and that, for every one of them who opts for solitary living, there is one less com-panion available to those who desire healthy group liv-ing. And so I do not agree with Schneiders that the choice to live individually is without consequence for the rest of the group, or that a norm favoring group liv-ing would be inappropriate. Each member's choice enlarges or diminishes options for others. The more often healthy and active sisters choose to live alone, the more the impression may be given that those who choose to live together are immature, dependent, and nonre-newed. Creating the Future What are some considerations for sisters who want to break through the hesitancy and silence that surround the issue of community living? Here are four sugges-tions. First, the venue for choice of a norm around com- Review for Religious munity living is the congregational chapter. By the very nature of what is involved--an authoritative interpreta-tion of the commitment to community--an individual sister or small group of sisters cannot be determinative. As with any norm, interpretations in specific cases and exceptions for specific individuals can be made by the leadership. This authority to interpret the Rule and to apply it in specific circumstances is one of the highest obligations of leadership. If done sensitively and consis-tently, it will build up the common good and respond to individual needs. Exceptions, then, will not detract from the clarity of the ideal embraced by the membership and the good-faith efforts to strive toward the ideal. Second, congregations will legitimately differ in their interpretation of their commitment. Their history, tra-ditions, and present circumstances may prompt some to choose the norm of living in common, others of living singly, and others of honoring individual choice. Clarity about what the normative interpretation of community is may lead to less diversity in lifestyle within a congre-gation and more diversity among congregations. This clarity should be valuable in describing a congregation to the larger church and to potential new members. Third, in discerning their choice around community living, each congregation should factor in how its choice influences its practice of poverty, of obedience, of celibacy, of prayer, and of ministry. Each of these ele-ments of religious life is meant to interact with the oth-ers to create a synergistic whole. How is a communal spirituality built up through the daily efforts of the mem-bers? How is the sharing of goods implied by poverty realized in practice? And so forth. In a way the manner of community living chosen creates a template for the realization of each of the other elements. The discern-ment should also project the possible impact of the 277 ¯ 64.3 2005 Gottemoeller ¯ Living in Community 278] choice into the future. What will be the possible impact of the congregation's present choice a generation from now? Fourth, the congregation's choice of a norm around community living must be supported by appropriate resources, both material and spiritual. If it is true that forty-five percent of sisters desire to live in groups of four to seven, and this is consistent with the congrega-tion's norm, then housing must be found to make that possible. The loss of parish convents is one of the factors that led to the drift into individual living, and apart-ments will seldom accommodate more than two people. Of course, the investment in living space requires a good-faith commitment on the part of groups to use the space. Congregational leadership has to invite and promote the dialogues that lead to these choices. Leaders .also have to make available other resources, such as materials for group prayer and ritual, occasional group facilitation, intervention in crisis situations, and a general climate of encouragement and support. The intention in pursuing this conversation is not to simplify what is a very complex issue, having historical, cultural, sociological, and theological dimensions. Nor is it to minimize the experience of anyone living religious life today. Rather, the purpose is to call attention to a principal dimension of religious life and to invite a cor-porate discernment. Few questions cut closer to the real-ity of a congregation's identity than its norm or lack of norm around community living. Attempts at dialogue are sometimes stalled by the prospect of choosing between ministry and community living, with the assumptions that members cannot be expected to bring energy to both and that ministry is to be preferred. A better perspective would be to view both ministry and community as equally valuable expressions Review for Religiozts of mission, each strengthening the other. The presence of adults living together in simplicity and harmony, shar-ing prayer, hospitality, and the duties and struggles of daily living, is an uncommon and striking witness to the power of the gospel and the dynamism of a congrega-tion's charism, so much so that it deserves to be called a prophetic stance. Six years ago I closed with the phrase that is the sub-title of the Vatican document on community, "The Love of Christ Gathers Us into Unity." This phrase captures the motive and dynamism of community life. Only the love of Christ is enough to support and sustain this way of life. Love attracts and gathers us. The process is never finished, always calling us to greater unity, greater gen-erosity, greater zeal. We will all fall short of this ideal, but it is one that will never be approached unless it is artic-ulated in behavioral expectations appropriate to a con-gregation's charism and mission. Notes ~ Review for Religious 58, no. 2 (March-April 1999): 137-149. See also my article "Community and Communion: Making the Connections," Review for Religious 60, no. 2 (March-April 2001): 139-151. 2 Horizon, Spring 2000, 7-15. 3 Giving VOICE 1, no. 3 (December 1999). Contributors include Denise Starkley OP, "Community: An Essential Part of Charism"; Rayleen Giannotti RSM, "A Common Life and a Vibrant Spirituality"; Janice Bader CPPS, "Commitment Grows through the 'Rubbing of Elbows'"; Debbie Wells CPPS, "Generation Xers in Community: A Cultural Expert--No Experience Necessary!"; and Kathy Wright SL, "Community ls for Mission." 4 Review for Religious 59, no. 2 (March-April 2000): 118-130. s Journal of Democracy 6, no. 1 (January 1995): 65-78. 6 Barbara Fiand SNDdeN, Refocusing the Vision (New York: Crossroad Publishing Co., 2001). 7 Sandra Schneiders IHM, Selling All, Vol. 2 of Religious Life in a New Millennium (New York: Paulist Press, 2001). 279 64.3 200Y Gottemoeller ¯ Living in Community Prayer: Psalm 122:1-3, 6-9 I rejoiced because they said to me, "We ~ill go up to the house of the Lord." And now we have set foot within your gates, O Jerusalem-- Jerusalem, built as a city with compact unity. Pray for the peace of Jerusalem! May those who love you prosper! May peace be within your walls, prosperity in your buildings. Because of my relatives and friends I will say " Peace be'within you!" Because of the house of the Lord, our God, I will pray for your good. Reflection and Discussion What is my personal experience of community support and sharing in our congregational vocation and charism? Religious community life mirrors the secular cultural breakdown of social groupings. Do we agree or disagree? If we agree, what kind of changes would we want to work for in religious life? What would be some "norms" that a religious congrega-tion might establish to support and sustain a healthy living "in common"? Review for Religiou~ MARY C. CARROLL With Love from Calcutta and Lisieux: Letters of Mother Teresa and St. Th~r~se When Father Michael van der Peet SCJ, A col-league of mine and seminary spiritual director, lectured on Mother Teresa of Calcutta, it was not just his reporting of particular facts but the heartfelt friendship he had with this remarkable woman that inspired me.~ Because of my com-pelling interest, Father shared the twenty let-ters he had received from Mother Teresa and spoke at length about their conversations and his continuing sense of her presence in his life. I was reminded of another friendship and the poignant letters exchanged between Maurice Barth~l~my-Belli~re, an aspiring seminarian, and Th6r~se of Lisieux. As he departed from France for the African missions, Maurice was deeply consoled by the assuring words of Th~r~se that somehow she would be with him. What is it that motivates and sustains such relationships? Mother Teresa wrote her letters in Mary C. Carroll SSSF is a professor and spiritual director at Sacred Heart School of Theology; .7335 South Highway 100; P.O. Box 429; Hales Corners, Wisconsin 53130. witnessing 64.3 2005 Carroll ¯ With Love from Calcutta and Lisieux 282 the midst of enormous travel demands, and Th~r~se of Lisieux wrote even when she was extremely ill. What is it that so strongly moves people to assist one another on the spiritual journey? Examining these two relationships may provide insight into Jesus' admonition to "abide in my love" (Jn 15:9). My purpose here is (1) to describe the origins of these two friendships, (2) to explore the contents of select letters and conversations, and (3) to share the wisdom of the relationships. Mother Teresa of Calcutta and Father Michael At a bus stop in Rome, Father Michael--a native of Holland and something of a world traveler himself-- noticed that the diminutive woman patiently waiting was Mother Teresa. Considering how rare such a respite must have been for her, he thought of giving her just a nod of recognition. But then he thought: "Here is a saint and I am a sinner. At least I can ask her to pray for me." Fortuitously the conversation that ensued included an invitation to give a talk to Mother's congregation, the Missionaries of Charity, in Rome. Arriving early and sitting in the chapel, Father Michael noticed the Ego Sum (I Am) on the tabernacle door. This became a prayer focus and filled him with a sense of "holy ground." This day concluded with another invitation, for a retreat. Mother requested continuing contact because, as she told him, "You kriow Jesus and you know us.''~ In her first letter Mother says: I would be grateful if I could turn to you for spiritual help, but I am absolutely too small and empty. Only Jesus can stoop so low as to be in love with one such as me. Pray for me--that "No" does not pass through my heart and lips---when Jesus asks. (Letter 1, 11/16/75) Because of traveling, Mother apologizes for a delay in her next letter; she assures Father Michael, however, that Review for Reli~ous a holy hour follows every Mass so that "I get the two hours with Jesus before people and sisters start using me. I let Him use me first" (Letter 2, 3/6/76). Several months later Mother is in New York and invites Father Michael to a private meeting, during which he suggests leaving after an hour. Mother's response is "No. The morning is for us, and the media don't know where I am." On. another occasion Father Michael raised a question: "Wherever you go, Mother, people con-sider you to be a heroine or saint. You received all those beautiful prizes. The Holy Father admires and praises you. You were the guest of Indira Gandhi, of Queen Elizabeth, and of President and Mrs. Reagan. How do you handle all of that?" She laughed and said: "Father, [pointing to her ear] it goes in here and comes out there. I am too small to contain it all. Jesus has given me a great grace, and that is the absoluteconviction that I am nothing without Him. If He could find a poorer woman than I, He would not choose me but He would choose that woman." This theme of "littleness" appears again in a letter: I want to write, but I have nothing to say, but that wonder at His great humility and my smallness--noth-ingness. I believe--this is where Jesus and I meet-- He is everything to me--and I--His own little one--so helpless--so empty--so small that all these things that people keep pouring at and round me, can-not enter within me. Maybe because of the darkness I do not see. Maybe He just wants it to be so. I let Him have His way. I smile at the cardboard box [referring "If He co ld find a poorer w man than!, He would noLchoose me but He would choose tha woman." 283 64.3 2005 Carroll * With Love from Calcutta and Lisieux 284[ to herself] getting filled--with all kinds of things-- Big things, most of which I do not understand, but I know that I am being used--only--for and by them so that they proclaim the presence of the Poor--and their concern for the poor. And so I accept everything with a smile in their name. (Letter 3, 5/29/76) In another letter the theme of an unconditional love-- despite the inexplicable darkness that encircles Jesus within her--is quite pronounced in the last paragraph: My love for Jesus keeps growing more simple and more I think personal. Like our Poor, I try to accept my poverty of being small, helpless, incapable of great love, but I want to love Jesus with Mary's love, and His Father with Jesus' love. I know you are praying for me. I want Him to be at ease with me--not to mind my feelings--as long as He feels alright--not to mind even the darkness that surrounds Him in me-- but that in spite of everything Jesus is all to me and that I love no one but only Jesus. (Letter 4, 6/19/76) Within a few months Mother is writing of Brother Roger of Taizd's presence in Calcutta and marveling at someone so full of God and willing to live right in the slums. She promises Father Michael more sharing when her table is "a little empty of letters" (Letter 5, 11/6/76). There is a specificity of issues--providence and faith-fulness- mentioned in the following letter. First Mother refers to their wonderful "chance" meeting in Rome. We have received much from accepting to meet-- without being consulted or prepared. I do not know how He does with you--but with me He always does so--just to make me realize His tender concern for me and my nothingness--His fullness and my empti-ness- His infinite Love and my childlike love. (Letter 6, 11/26/76) Then she addresses Father Michael's personal concerns: Review for Religious "Let not your infidelity and hesitancy as you say--pre-occupy you, but accept all that He gives and give what-ever He takes with a big smile. For this is holiness: to do His will with a big smile" (Letter 6, 11/26/76). But that smile is difficult for her too as she handles her celebrity status in a visit to the United States. "It was all one act of blind obedience. I began to understand the Stations of the Cross with a deeper meaning. The Police, the crowds, it all seemed as if Calvary was being re-enacted all over again" (Letter 6, 11/26/76). The significance of the Missionaries of Charity and the Eucharist are recurring themes as well. Mother is impressed by a priest who points out that God has to exist or else the MCs have "no meaning at all." She agrees, but adds that the essential source for this ministry is the meekness and humility of Jesus: To be able to eat the Bread of Life--we need meekness and humility--if we want to feed Him in the hungry one. I would be happy if you [Father Michael] wrote about the hunger of man and the Bread of Life, the hunger of God and the Hungry One in the distressing disguise of the Poor. (Letter 6, 11/26/76) Regarding hours of adoration, Mother confides, "Here lies our strength and our joy." She concludes: "I ask you to tell Jesus--when at your wordwthe bread becomes His Body and wine becomes His Blood--to change my heart, give me His own Heart so that I can love Him as He loves me" (Letter 6, 11/26/76). Within the year, Mother makes a similar plea with deep affection: "My prayer is very close to you. I do hope you will keep me close to you in your prayer--and love Jesus for me, for all the times when my heart is cold and empty" (Letter 7, 6/20/77). A short time later Father Michael is planning an extended time of reflection and Mother has some pas-toral words for him: 64.3 200~ Carroll ¯ With Love from Calcutta and Li~'eux It is just like you to ask to spend the [three] 3 months with Jesus alone, but if during this time the hunger for Jesus in hearts of His people is greater than yours for Jesus you should not remain alone with Jesus for all the time. You must allow Jesus to make you bread to be eaten by all those you come in touch with. Let the people eat you up--by the Word and presence you proclaim Jesus. (Letter 8, 2/17/78) She then lays out a tentative plan for her scheduled time in St. Louis: I wish you would be there. We could--maybe have Adoration every day and so bring . . . our lives [together] with the Bread of Life. No greater love, not even God could give than in giving Himself as Bread of life to be broken to be eaten so that you and I may eat and live, may eat and satisfy our hunger for love--and He seemed yet not satisfied for He too was hungry for love, so He made Himself the Hungry One, the Thirsty One, the Naked One, the Homeless [One]. (Letter 8, 2/17/78) Mother claims that she can understand Jesus' majesty because He is God, but "His humility is beyond my understanding because He makes Himself the Bread of Life so that even a child as small as I can eat Him and live." In further reflection on the Eucharist, she recalls an awesome memory: Some days back, when giving Holy Communion to our Sisters in the Mother House, suddenly I realized I was holding God between my [two] 2 fingers. The greatness of [the] humility of God. Really no greater love--no greater love than the love of Christ. You, I am sure must feel often like that when, at your word ¯. the [b]read becomes the Body of Christ, the wine becomes the Blood of Christ. (Letter 8, 2/17/78) Her closing comment is characteristic: "He [Jesus] Review for Religious can do with me just as it pleases Him without even a thought of consoling me. I iust want to be His own lit-tle one, if He so wants. Otherwise I will be happy to be just Nothing and He everything" (Letter 8, 2/I 7/78). After more than a year's lapse, a subsequent letter includes an apology for a "long silence." She refers to the Silver Jubilee celebration since, with the foundation in Beirut, twenty-five tabernacles are established in MC houses around the world. With reference to the Eucharist, she again ponders the ineffable: "I just under-stand less and less the humility of God-made-man for love of us" (Letter 9, 5/30/79). A few months later, at the time of the congregational chapter, Mother makes a request: "Ask Our Lady to take care of our Society, which was born at her pleading and grew under her care. I would love to be just a simple Sister. I will not ask--let Jesus do whatever He wills without con-suiting me, for I belong to Him" (Letter 10, 9/22/79). She also offers an apology for leaving Father Michael and oth-ers at a profession in New York to join Cardinal Terence Cooke in meeting with the boat people: "The sea has become an open Calvary where the Passion of Christ is being relived . You only wonder how people can suffer so much and never break. Looking at them I feel physical pain right in my heart" (Letter 10, 9/22/79). Mingled with joy in the expanding congregation, the letter contains signs of a dark night of the soul: "As for me, the silence and the emptiness is so great that I look and do not see, listen and do not hear. The tongue moves but does not speak. Helpless yet daring." Mother asks for prayer so that "I let Him have a free hand and even if He chooses to cut me to pieces that every single piece, however small, be only His." Mother ends with "Ask Our Lady to take care of me as she took [care] of Jesus" (Letter 10, 9/22/79). 64.3 2005 Carroll ¯ With Love from Calcutta and Lisieux 288 There is a postmark from Rome on the next letter. "A bishop told me that I will spend my Purgatory in writing letters, because I am so bad in answering" is her opening statement. Even so, she claims that, "however long Purgatory may be, there is the beautiful hope of seeing Jesus, one day." Her delay is, to some extent, due to her presence at a synod. She expresses amazement to be "with all the big people of Church" (Letter 11, 10/18/80). At the synod Mother requests that the bishops and the Holy Father "give us holy Priests." She then reflects on Father Michael's priesthood: "How tenderly Jesus must love you as to use your tongue to change [b]read into the Body of Christ and through your absolution take away the sins, wash the sins with His precious Blood." Mother is delighted that soon "we shall have Priest-Co-workers." She closes with "Let us keep the joy of loving Jesus in our hearts and share this joy with all we meet" (Letter 11, 10/18/80). During the next decade Mother's letters are less fre-quent but, with reference to Father Michael's corre-spondence, she repeats, "They are my strength" (Letter 12, 12/29/82). Upon returning from Ethiopia she somberly says, "I only saw an open Calvary, where the Passion of Christ was being relived in the bodies of crowds and crowds of people." She hopes, however, to send more sisters to be Jesus' gentle presence to them (Letter 13, I/1/1985). "Often I have wanted to write, but not knowing where you are--it was [a] good excuse not to write" is one of the opening lines of her next letter. With so much poverty around the world, the three hundred and fifty MC houses in seventy-seven countries console her. In her imaginative way she says: St. Peter must be wondering what is happening in the homes of the MC's, as each one who dies in our homes Review for Religious goes to heaven with a ticket for St. Peter. [Twenty-three] 23 thousand have died with us only in Calcutta out of the 53,000 that we had picked up dying from the streets. Same is happening in New York. Already [fifty] 50 have died a beautiful death . At the begin-ning St~ Peter would not let me enter Heaven, because there were no slums in Heaven. Now Heaven is full of slum people. Jesus must be very happy to have those thousands coming to Him with love from Calcutta. (Letter 14, 1/1/88) Although there is a short typed note expressing grat-itude, the last hand-written letter arrives in March 1992. Mother repeats an earlier refrain, "Your letter brought me great joy that you still remember me and pray for me after such a long time." She is happy with an expanding congregation but hopes that the "Society remains only all for Jesus through Mary" (Letter 17, 3/3/92). Then, until Mother's death in 1997, the notes are short and typed but her spirit comes through, especially in the final letter: "God's blessings be on you as you continue to satiate the burning Thirst of Jesus." The last line concludes with "Please, pray for our Society and for me that we may not in any way spoil the works of love" (Letter 20, 3/10/97). In reflecting on his experience, Father Michael mea-sures each word as he says, "With her, you inhale God's presence." Mother's decorum is not "pietistic or exag-gerated." There is a flow of "something genuine, natu-ral, and spontaneous." At the ceremony for the beatification of Mother Teresa, Father Michael watched carefully at the unveiling of her picture and with grati-tude said in his heart, "There is my friend." In the years that have followed since her death, Father Michael says, "She has never been far from me." Whereas Father Michael and Mother Teresa met numerous times and exchanged over fifty letters, Maurice 289 64.3 2005 Carroll ¯Witb Love from Calcutta and Lisieux 290 Belli~re and Th~r~se of Lisieux never met, and exchanged only twenty-one letters. Nevertheless, their correspondence also provides a rich dynamic of a grow-ing friendship. Let us now turn to the genesis of that relationship and some excerpts from Th~rEse's letters. Thdri~se of Lisieux and Maurice Barth~l~my-Bellii~re Like Father Michael van der Peet, Maurice Belli~re --a twenty-one-year-old French ~eminarian--reached out for someone to pray for him by writing to a Carmelite convent. Mother Agnes of Jesus, Th~r~se's older sister Pauline, received the letter in which Maurice introduced himself with the words, "The grace of God, which impelled me toward the Sanctuary, has not washed away the last traces of a thoughtless life., and in spite of my efforts I have a hard time absorbing the spirit of the Church and holding myself to all the demands of the seminary rule." 3 Subsequently, while in the mundane surroundings of a laundry room, Pauline asked Th~r~se to become a spir-itual sister to Maurice by praying for him. Th~r~se was delighted, and, although they never met, thus began a significant friendship manifested in the letters exchanged, largely during the last year of her life. When Maurice Belli~re sent his first letter to the Carmel of Lisieux, he was desperate because his manda-tory military service was interrupting his seminary stud-ies and it could negatively affect his vocation. Within a week Pauline assured Maurice that a "little saint" would be praying for him. His next letter is quite idealistic, for he does not want to come back from military service "without bringing some souls back to the true Light." En route to the barracks in Caen, he drops off a postcard recommending prayer for the seminarian-soldiers and their saddened families. Review for Religious It is another nine months before Maurice sends a let-ter revealing a man, fresh from the seminary, whose per-sonal confidence in his ideals have been severely challenged. What exactly happened in the army is mys-terious; obviously, Maurice is disillusioned. He writes again, to the new prioress, Mother Gonzague, who turns the correspondence over to Th~r~se. With alacrity and sisterly concern, Th~r~se responds and soon learns that Maurice--having finished his military stint and returned to his religious pursuits--is now anxiously awaiting acceptance in the Missionaries of Africa (White Fathers). Excerpts from Th~r~se's first letter (December 26, 1896) are full of encouragement for the aspiring missionary: Let us work together for the salvation of souls. We have only the one day of this life to save them and thus to give Our Lord some proof of our love. The tomorrow of this day will be eternity, when Jesus will reward you with the hundredfold of those sweet and lawful joys which you are giving up for Him . I hope, Monsieur l'Abb~, that you will continue to pray for me, who am no angel as you seem to think, but a poor little Carmelite who is very imperfect--yet who in spite of her poverty wants, like yourself, to work for the glory of God. Thtr~se includes some of her poems. Maurice is grateful, apologizing for his "rough and ready" prose but saying he feels that something in her communication is working in the depths of his soul. Th~r~se responds with equal gratitude: "Truly, only in heaven will you know how dear you are to me. I feel our souls are made to understand each other." In this same letter Th~r~se articulates her "little way" by saying: "Since He Himself has chosen me to be your sis-ter, I hope that He will not take notice of my weakness, or rather that He will use that very weakness to do His work: 29i 64.3 200~ Carroll ¯ With Love from Calcutta and Lisieux 2921 for the Strong God likes to show His power by making use of nothing." Th~r~se has lofty desires that can be accomplished by being the "small flower" in the apostolic garden. For Thdr~se, the Divine One is not giving awards to the competent but rewards to the humble who are con-fident in Him, It is not entitlement but instrumentality. There is an increasing intimacy in Thdr~se's saluta-tion in the next letter. "My dear little Brother" replaces the formal "Monsieur l'Abb&" Fearing an overestima-tion of her person, she says, "I beg you to believe me that the good God has given you as your sister not a great soul." But she hastens to add: "Don't think that this is humility which prevents me from recognizing the gifts of the good God. I know that He has done great things in me, and every day I sing to Him with joy for doing so." Her motivation has also crystallized. "I under-stood my mission was not to crown a mortal king, but to make the King of Heaven loved, to conquer for Him the kingdom of hearts." Just months before her death, Thdr~se takes advan-tage of the privacy afforded her in the infirmary to answer Maurice's letters. She makes it clear that she is facing the end and assumes that, when he receives her letter, she will have left this "land of exile." There seems to be a sense of urgency when she says, "I would like to tell you a thousand things which I understand as I stand at the door of Eternity." One thing is clear: "I under-stand more than ever that only one thing is necessary, and that is to work solely for Him." A month later Thdr~se says, "The Spouse is at the door." Facing her own demise, she wants Maurice to know that their relationship will continue. "When my dear lit-tle brother leaves for Africa, I shall follow him not only in thought and in prayer; my soul will be with him for-ever." But Maurice is devastated when he understands Review for Religious that TMr~se's days are numbered, for he has found "a lovely home" in her friendship. He lets her know that she has been instrumental in his finding Jesus. Maurice soon expresses his anxieties and moral weak-ness. Thdr~se uses the image of an elevator of love, not fear, that takes us to God. She gives the exam-ple of two children who are disobedient. One withdraws in fright, but the other throws himself into their father's arms to beg forgiveness. Thdr~se promises to help Maurice remedy his hesitancy with God. "I think it will be easier for you to live with Jesus once I am there at His side forever." Thdr~se knows she must wait for the next life to further converse on these profound realities. In Thdr~se's last letter she speaks of knowing that her passport for heaven is ready and credits her deceased father for the grace of that awareness. Once again she assures Maurice that, whatever his faults, he is .dealing with the infinite mercy of God. She closes with: "ADieu, dear little brother, may God give us the grace to love Him and to save souls for Him." In the meantime Maurice is on board a ship destined for Africa. He recalls looking up at the stars and praying for Thdr~se, unaware it was the night she died. His first day in Africa is Thdr~se's first day in eternity. Later he is convinced that his peacefulness and joy are attributable to her. If today one goes to Maurice's grave, there is a plaque on the wall of the nearby church acknowledging this relationship: Maurice Belli~re, Spiritual Brother and Protdgd of Saint Th4r~se. A Dieu, dear littlebrother, may God give us the grace to love Him and to save soulsfor Him," 1293 64.3 2005 Carroll * With Love from Calcutta and Lisieux 294 Summary Observations These two women--sending letters permeated with affection, gratitude, and insights--gifted both Father Michael van der Peet and Maurice Barth~l~my-Belli~re. Mother Teresa's themes are more broadly based: retreat requests, Eucharistic insights, concern for an expanding congregation, global poverty, and a thirst for God whet-ted by an acute spiritual darkness that seem to hollow her out for a greater fullness of Jesus' presence. In each MC house she had the phrase "I thirst" given a prominent place as a reminder of Jesus' longing for souls, and per-haps as a reflection of her own longing for God. Th~r~se and Maurice were in their twenties and fer-vently idealistic. Th~r~se articulates the "little way" to accompany her dreams. She uses the face of Jesus and the phrase "King of Hearts" to focus her image of her Beloved. There is immediacy in Th~r~se's writing because it is penned as she stands at the door of death while whispering secrets to Maurice. Although cloistered in life, she promises that in eternity she will travel with him as a spiritual companion. Both women view themselves as God's instruments: a cardboard box, an insignificant flower. In life, many know similar images of themselves and reluctantly accept them, but these women rejoice in them. Both knew they are not sources, only conduits, of love. Both women say to their friends what John the Baptist once said: "He must increase, and I must decrease" (Jn 3:30). But, most especially, both women testify to a divine indwelling through Jesus that makes true friendship possible. "As the Father has loved me, so have I loved you; abide in my love" (Jn 15:9). Notes ~ Father Michael van der Peer, a member of the international Congregation of the Priests of the Sacred Heart (SCJ), served on the Review for Religious commission for the beatification of Mother Teresa of Calcutta. He has graciously given me permission to quote from her letters and has answered numerous questions. Further resources regarding her expe-rience with spiritual direction are J. Neuner SJ, "Mother Teresa's Charism," and Albert Huart SJ, "Mother Teresa: Joy in the Night," Review for Religious 60 (September-October 2001): 479-493 and 494- 502 respectively. 2 Words quoted here and below (whether Mother Teresa's or Father Michael's), if not otherwise documented, are from my interviews with Father van der Peet. 3 Patrick Ahern, Maurice and Tberese: The Story of a Love (New York: Doubleday, 1998), p. 15. Below, other quotations longer than three words are from the following pages of this book: 25, 65-66, 82 and 86, 82, 103 and 108, 104-I05, 106, 130, 129-130, 152 and 155, 153,188, and 211. At Cana Before time was, She was in God's eye, As a bloom in the bud Awaits its moment. And the moment, too, Was in God's eye, That sees and saves, Counts hairs on heads, Yet defers to her, Her.unspoken wish Already his command. Leonard Cochran OP 64.3 2005 MARY FRANCES COADY Alfred Delp SJ and the Heart of Jesus 296 O n the first day of December 1944, a thirty-seven- year-old Jesuit, imprisoned in Berlin and awaiting trial for treason against the Third Reich, edged himself between the plank bed and table of his small cell and with manacled hands began to write a reflection on the Heart of Jesus. His name was Alfred Delp, and he had been arrested four months earlier in an all-out purge following a failed attempt on Hitler's life the previous July. He had been interrogated and tortured. In letters smuggled out of prison by two women who brought clean laundry and other supplies to prisoners, he had written about his fear, his struggles against despair, his optimistic hopes for acquittal and release, and his desire to leave his fate in the hands of God. The date, 1 December, that he began putting his meditation to paper is significant, for as the day dawned he realized it was the first Friday of the month, the day honoring the Heart of Jesus. This devotion held a cen- Mary Frances Coady published With Bound Hands, about Father Delp, at Loyola Press in 2003. She writes from 35 Cowan Avenue; Toronto, Ontario; M6K 2N1 Canada. tral place in Delp's prayer life. The veneration of the Sacred Heart of Jesus, with its deep biblical roots, had grown to enormous popularity with the revelations to St. Margaret Mary Alacoque in the late 17th century. This obscure Visitation nun received visions of Jesus in the chapel of her convent in the town of Paray-le- Monial, in Burgundy. In these visions Jesus exposed his heart to her, saying, "Behold my heart, which burns with love for all humanity." He added that those who received Communion for nine consecutive first Fridays in repa-ration for sins against his love were assured of dying in the state of grace. In the following centuries and under Jesuit influence, the Sacred Heart devotion ushered in a new and more gentle approach to the Christian spiritual life--one of self-abandonment, trust, and surrender--as a means of combatting the cold, harsh spirit of Jansenism that had permeated the church. The Litany of the Heart of Jesus was given official church approval in 1891. Along the way, however, the devotion became encrusted with infe-rior art, sugary sentimentality, and obsessive supersti-tions regarding the nine first Fridays. Alfred Delp, the product of a Catholic-Lutheran mar-riage, grew up without Catholic devotions because his father insisted he be brought up a Lutheran. The Sacred Heart caught up with him, however, after his adolescent embrace of his mother's Catholicism and his subsequent entrance into the Society of Jesus in 1926. A book of Jesuit devotions, one of which was the Litany of the Sacred Heart, was sent to him in prison. Delp had studied philosophy and political theory, but his prayer life as a Jesuit had been fashioned by the Catholic piety of the time. As a preacher and writer, he had tried to infuse his philosophical work with his deep-ening sense of the divine mystery at the core of his devo- 64.3 2005 298 tions. On the first Friday of December, in his cold prison cell, his hands in manacles, he pondered the love of God as the driving force of the universe. In the extremity of his situation, he realized the immensity of God's love for him, that God was holding him and protecting him with a love that was infinitely greater and more powerful than the forces imprisoning him. And so he began to write his meditation on the Litany of the Heart of Jesus. The heart represents the essence, or center, of a per-son, and he had earlier written of the heart as the only way to God. Now, in a preamble to his meditation, he lamented the dissociation of the devotional from the the-ological. Without a theological foundation, he wrote, the devotion can dissolve into mush, and without the devotion the theology becomes dry and devoid of personal passion. He described the arc that moves between the divine and the human: the basis of this devotion is the cry of the creature in need and the offer of help from God through Jesus Christ. The answer from God takes two forms: a healing, redemptive help and a call for humanity to share in that healing. And so this is not a just a "me and God" approach to the heart of Jesus, but a proposal to be a graced presence for others as well. The language used in the prayer is the language of love, but the theological framework is there. The prayer expresses a deep, myste-rious relationship between God and humanity, he wrote, and must not be demeaned by sentimentality. As with other litanies, the Litany of the Heart of Jesus follows an antiphonal course; the response "Have mercy on us" follows each of the various titles attributed to Jesus. What follows is my translation of an excerpt from Delp's reflection on the first invocation: "Heart of Jesus, Son of the eternal Father." "We call upon the Heart of the Son of the eternal Father. In this invocation there are particular consider- Review for Religious ations for us to contemplate. Heart: here, as in the whole litany, we are calling upon the love of God. The Heart is the symbol of God's innermost being and God's fun-damental relationship with us. A person who does not believe in God in this way should not continue praying, because that person is not up to the words of the prayer. "Heart of the Son: one ought to be able to state briefly what theology has to say about the Son. But one thing should be men-tioned as far as this devo-tion is concerned: from the beginning, the Son is the place of comfort and belonging for the world. The Word is God's image, of which we are shadows. He has always been the living incarnation of God's commitment to the worl

Issue 46.3 of the Review for Religious, May/June 1987. ; REVIEW FO, RELIGIOUS (ISSN 0034-639X), published every two months, is edited in collaboration with the faculty members of the Department of Theological Studies of St. Louis University. The editorial offices are located at Room 428; 3601 Lindell Blvd.; St. Louis, MO. 63108-3393. REWEW FOg RELiGiOUS is owned by the Missouri Province Educational Institute of the Society of Jesus, St. Louis, MO. ©1987 by REVIEW FOg RELiGiOUS. Single copies $2.50. Subscriptions: U.S.A. $11.00 a year; $20.00 for two years. Other countries: add $4.00 per year (surface mail); airmail (Book Rate): $18.00 per year. For subscription orders or change of address, write: Rv.vlv.w FOR REI.I(;IOUS: P.O. Box 6070; Duluth, MN 55806. Daniel F.X. Meenan, S.J. Dolores Greeley, R.S.M. Iris Ann Ledden, S.S.N.D. Richard A. Hill, S.J. Jean Read M. Anne Maskey, O.S.F. Editor Associate Editor Review Editor Contributing Editor Assistant Editors May/June, 1987 Volume 46 Number 3 Manuscripts, books for review and correspondence with the editor should be sent to REVIEW FOIl REI.I~;IOtlS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108-3393. Correspondence about the department "Canonical Counsel" should be addressed to Richard A. Hill, S.J.; J.S.T.B.; 1735 LeRoy Ave., Berkeley, CA 94709. Back issues and reprints should be ordered from REVIEW fOR REI.I~:IOUS; Room 428; 3601 Lindell Blvd.; St. Louis, MO 63108-3393. "Out of print" issues and articles not published as reprints are available from University Microfilms International; 300 N. Zeeb Rd.; Ann Arbor, MI 48106. A major portion of each issue is also available on cassgtte recordings as a service for the visu-ally impaired. Write to the Xavier Society for the Blind; 154 East 23rd Street; New York, NY 10010. Mary and Our Reconciliation in Christ Donald Macdonald, S.M.M. Father Macdonald has written yet another thoughtful and fruitful article on Mary our Mother. His last article on Mary was "Our Lady of Wisdom" (May/June, 1986). His last article in our pages was "Invisibly Companioned" (January/February, 1987). Father Macdonald still resides at: St. Joseph's; Wellington Road; Todmorden, Lanc.: 0LI4 5HP England. It is puzzling to read from time to time that,- seemingly, the appeal of Our Lady is chiefly psychological rather than personal. So, for example, "Mary .has been a very popular image for both women and men . Men still Often seem to derive a great deal from the image of Mary, perhaps cel-ibate men. in particular, since Mary as mother provides a safe, that is, sex-ually taboo womanly image.''~ Is her appeal then in what she represents rather than who she is? Is she a popular image or a popular person? Every individual suggests more than herself, of course, but in the living of the everyday Catholic this emphasis on "the image of Mary" seems sadly unreal. There is a world of difference between admiring her icon at an exhibition and taking her into our home in faith and love. Insofar as she is seen primarily as a psychological refuge she is no longer the mother of Jesus as the Gospel reflects her. It was no image but someone authentically human who "gave birth to her firstborn son and wrapped him in swad-dling clothes, and laid him in a manger because there was no room for them in the inn" (Lk 2:7). A male religious might be forgiven instinctive irritation as he feels him-self being patronized. More to the point, being particularly singled out as finding Our Lady a safety valve seems to contradictexperience. Is it true? The experience of an adult lifetime spent in pastoral ministry at the grass roots could more plausibly make a case for the attraction Our Lady has for the married woman or the professional man. In thinking of those with an 321 322 / Review for Religious, Ma.y--June, 1987 enviably marked and integrated devotion to Our Lady, the male celibate, while there, is by no means primary. Mary means so much to so many, far beyond the few who, it is suggested, see in her particularly a safe, sex-ually taboo womanly image. A lifetime could be spent in a Catholic com-munity without ever meeting many of that particular group, though one would certainly find genuine devotion to Our Lady. Too, contemporary novelists and journalists notwithstanding, genuine devotion to her from the male celibate has surely stronger ties than sexual security. It is a Catholic thing, not a psychological need. It is of the faith. Again, does everyday devotion to Our Lady really express itself like that? Is it mainly a popular image useful for meeting a psychological need? Whether it be the assembly line, down-market product of "repository art,'" or-the faith-aesthetic creation of a Giotto, the Christian can distinguish between the person and the product. The picture or image can focus atten, tion, and there are psychological overtones in every glimpse of Our Lady, since every individual carries more meaning than he or she knows. Mary may transform whomever and whatever she is introduced to in the context of Christian devotion. She creates her own climate in the generations con-sidering her ,blessed among women. Yet traditionally and individually within the Church, the person of Mary is known and loved beyond all that art, theory and culture might suggest. Faith and the feminine are lovely, life-enhancing qualities. To speculate about them may have some point, but cannot be compared to seeing them in a particular woman. Here lies Our Lady's appeal. Her union with her Son as the Gospel reveals this, and her oneness with us in our humanity and faith are definitive. Many talented peop!e can perhaps paint an icon, but only the specially prepared, it is said, may paint its eyes. Insight is a gift. The scientist and man of contemporary culture who considers the cathedral of Notre Dame de Paris exclusively in terms of its construction has literally not seen it. In ignoring God and her whose name it was given, he has lost the key which would unlock its meaning. This is much more than simply discarding a relative culture. The contemporary Catholic, attracted by the appeal of Our Lady, might say of her what the medieval mystic said of being gripped by the desire for contemplation: "You would run a thousand miles to talk about it with someone you know has really experienced it, and yet when you get there you can find nothing to say. ''-~ One need not be able to articulate what one knows. The common tongue of Lourdes~ Fatima, Banneux and "down-town anywhere," as far as Our Lady is concerned, is faith working through Mary and Our Reconciliation / 393 love. With the mother of the Word made flesh dwelling among us, we are in touch with someone rooted in humanity and faith. ,.- This, then, is why devotion to Our Lady in Catholic tradition is not something subjective, as a liking for sugar, but an objective reality whether we advert to it or not. It is not an arcane secret given to some esoteric group inhabiting an ethereal heaven. It cannot be when so many Christians' first real introduction to Mary is often in the world of the Christmas carol, where "earth stood hard as iron, water like a stone . " She is known by the company she keeps--like her Son, easily going to the houses of sinners to be with them. The consequent allegiance she has won in the Christian world is far from the preserve of a Gnostic group. She is real to so many. "~ray for us sinners now and at the hour of our death," is possibly the most common prayer of invocation in the Catholic world. We can, perhaps, understand something of her appeal if we consider the best which can be said of Christian life, and glimpse how genuinely she reflects it. The anonymous medieval author mentioned earlier suggests that the human spirit can safely work with God once it "has been checked by the three witnesses, Scripture, direction, and common sense.-3 We can usefully consider how Our Lady reflects authentic Christian living in the light of that rubric. A New Creation Although not to everyone's taste, our faith is incarnational and so, "God'was in Christ reconciling the world to himself" (2 Co 5: 19), says St. Paul. He goes on to explain that, as an apostle and preacher, he shares in the same office of reconciliation, since God "gave us the ministry of reconciliation . . . entrusting to us the message of reconciliation" (2 Co 5: 18-19). It follows, therefore, that "we are ambassadors for Christ, God making his appeal through us" (2 Co 5:20). Paul's mediatorial role is thus heavily emphasized in line after line. Such a mandate implies that who-ever is so commissioned as God's ambassador to help reconcile people to God must have received the enabling power of God to help him do it. He is, then, attuned to both God and man. His very person helps in binding people to God. "All this is from God" (2 Co 5:18). How is it done? It all depends on what is seen. Paul begins where the New Testament begins, with God first loving us in Christ. "For the love of Christ overwhelms us when we reflect." (2 Co 5: 14), he says, quite bowled over as he comes to an ever-wondering realization of what God has done for us in Christ. Christ, as one of us, lived, died and rose from a grave so that, in him, we might break out of our congenitally self-centered exis-tence which can even challenge the will of God, and so be able to "live 3~.4 / Review for Religious, May--June, 1987 no longer for themselves but for him [Christ] who for their sake died and was raised" (2 Co 5:15). Insofar as I am at one with the selfless Christ I can do the same. This vision of God in Christ can,provide the dynamic to draw me out of myself towards the will of God. Paul, a man among men, shackled, too, in the same self-centered world, and so wanting to be free of it, but seemingly powerless to change, now knows that this is possible in Christ. Paint the picture in the most somber colors, as bleak as can be, in a world where personal sin and selfishness can wreak havoc in epidemic proportions, and in it all Paul sees Christ. "For our sake, he [the Father] made him to be sin who knew no sin, so that in him we might become the righteousness of God" (2 Co 5:21). Whatever depths of evil can be reached individually or collectively, God in Christ is there empowering those who would accept him to break free of its infernal power: "All this is from God, who through Christ reconciled us to himself" (2 Co 5:18). This Paul sees and is part of as Christ's ambassador, engaged in reconciling his world to God. So deep is this view of reality that Paul sees it as something wholly new, not just a change or adaptation. "If anyone is in Christ he is a new creation; the old has passed away, behold the new has come" (2 Co 5:17). His center of reference now is God giving himself in Christ. The selfless Christ replaces the selfish Paul, as he breathes the invigorating air of one now free to live for God.He is still an imperfect man with partial vis~ion, but insofar as his lifeqs a response to God in Christ, he can only describe what is happening to him as a new creation. Ideally, he describes Chris-tian reality. His world has been recreated. Glorifying God If such a grasp of reality is true of Paul and the best of Christians, and true of us :all to a degree, it is, self-evidently, descriptive, too, of Our Lad~,. That vision is flawlessly realized in her. Sinless from her conception and now assumed into heaven, she is a new creation from the mind of God. So alive to God is she that she is alert to the implications of her being way beyond any experience of ours. She hungered for the will of God, so it became her food (see Lk 1:53). "Behold, I am the handmaid of the Lord; let it be to me according to your Word" (Lk 1:38) is the total response of the new creation. She is blessed, the Gospel maintains, because she believed and there-fore gave herself wholly to the Word of God. She is particularly blessed "among women, and blessed is the fruit of [her] womb" (Lk 1:42) as in her God in Christ was reconciling the world to himself. Her Son Jesus "will save his people from their sins" (Mt i:21). As the Word became Mary and Our Reconciliation / 325 flesh in her womb and in her life, having been welcomed in faith and love into her heart, her maternal being from first to last becomes part of the gift of her Son: "And going into the house they saw the child with Mary his mother"; "But standing by the cross of Jesus were his mother, and his mother's sister" (Mt 2:1 I, Jn 19:25). Only a mother, perhaps, could under-stand the give and take of that exchange over a lifetime. Mary, one with her Son at so many levels as the years went by, learned so much of life as he lived in and for his Father's will, and yet "he went down with them and came to Nazareth and was obedient to them; and his mother kept all these things in her heart" (Lk 2:51). The reflective Chris-tian, too, has assimilated much of the perplexity of life in oneness with the heart of Mary. When she stood with her crucified Son as his life ended in ag6ny, "Jesus saw his mother, and the disciple whom he loved standing near" (Jn 19:26), and gave them to each other. Far from seeing this as a son tying up loose ends as best he could--his use of the word woman sug-gests more than a domestic arrangement--generations have felt the weight of those words from the Cross, and have gladly accepted the relationship, taking ourLady into their own homes. She is not then seen as just a type or evocative image of yesterday. Her appeal is of today and tomorrow, as her reconciling presence helps Christians to welcome and live the appeal of the Gospel in the Church. Admittedly these Gospel glimpses of Mary are or~ly straws in the wind, but many in the Church have loved the way the wind was blowing. The Pauline sketch of reconciliation in Second Corinthians outlined earlier, can become real in her person. This is especially true of those who could never read St. Paul, nor perhaps even pronounce the word "reconciliation." She radiates Christ, invariably generating the wonder and pleasur6 of Elizabeth's welcome as Mary hurried to her door: "And why is this granted me, that the mother of my Lord should come to me?" (Lk 1:43). "Mother of my Lord" is, in the context, a new creation in Christ, ideally and providentially there to help reconcile us to God. Her heaven, too, is being spent doing good upon earth. DirectionmWhat Do the Saintlike Advise? Given that Our Lady, because of who she is in the providence of God, mediates God in Christ to us through her feminine, reconciling presence, we can reinforce that insight by continuing to take the advice of an English mystic and seek direction. What did those with the clearest Christian insight advise? What did the saints andsaintlike do? Perhaps we can glance at Julian of Norwich who, in her fourteenth-century hermitage, has distilled 396 / Review for Religious, May--June, 1987 sufficient insight to be found today on contemporary bookshelves as a best-selling paperback. Julian tlad asked for a bodily vision of Our Lady. She was never given one, but "when Jesus said: 'Do you wish to see her?" it seemed to me that I had the greatest delight that he could have given me in this spiritual vision of her which he gave me.-4 Delight, of course, is characteristic of Julian's understanding of the Faith, and she finds Our Lady delightful. She is enthralled by this God-given insight, and clear as to its implications: "And so he [Jesus] wishes it to be known that all who take delight in him should take delight in her and in the delight that he has in her and she in him." There is no suggestion here of tension, division or embarrassment. It is all so perfectly natural. Julian's understanding of the Faith, like St. Paul's, centers on Godwin Christ reconciling the world to himself through the cross. So suffused is it by the love of God--Julian really had grasped Paul's insight--that she can only delight in what God is doing. Responding as she does to Our Lady, she believes that she is sharing in Christ's delight in his mother and in hers in him. "For after myself [Jesus] she is the greatest ~joy that I could show you, and the greatest delight and honor to me." Far from seeing any contradiction or distraction in so honoring Our Lady, Julian sees it as the express will of Christ. One might reasonably expect this, as the relationship echoes the best in human nature as well as suggesting the hundredfold of all who are at one with God. Whenever delight is experienced, the whole person is marked, together with a~wish that everyone could see it, coupled with sad-ness and incomprehension if the delight cannot be shared. Julian, a new creation in Christ, savoring with an immediacy given to few his reconciling presence, sees Mary as part of the treasure to be found in Christ. Mary, for her, is not tacked on in a moment of misguided devotion, but rather soldered on by the love and will of God, intrinsically, if subordinately, part of the reconciliation found in Christ. In Mary she sees herself and all of us, "as if he [Jesus] said, do you wish to see in her how you are loved? It is for love of you that I have made her so exalted, so noble, so honorable; and this delights me. And I wish it' to°delight you." Maryqs no shadow across the face of Christ, but a further means of shar-ing delight in what God is doing in Christ. As one in Christ we may savor this, too, and insofar as we can see just how much we are loved in her, enjoy a comforting glimpse of our present and future status. It is not without interest that in the shorter text of Julian's "Revela-tions," believed to have been written some twenty years before the longer Mary and Our Reconciliation /327 text we have been using, she adds, after seeing Christ more gloriously than she had yet realized, "In this I was taught that every contemplative soul to whom it is given to look and seek, will see Mary and pass on to God through contemplation.-5 As always, in Julian the tone is uniform and the perspective unforced, and her faith is so alive in her belief that attachment to Our Lady will inevitably bring us to its source in God. Mary herself effects the transition, reconciling to God whoever is open to h~r influence. ~ It is said that, increasingly, women find less and less in Our Lady "as women discover themselves as less passive than Mary is made to appear in the gospels.",° They therefore look for other models. Women can, of course, speak for themselves, but as regards passivity in the gospels, it is useful to remember that the biblical "divine passive" is often just a passive tense serving to emphasize the wholly present activity of God. So, for exam-ple, Paul speaks of Christ, "who for their sake, died and was raised" (2 Co 5:15). God in Christ is not molding plasticine. The death and resurrection of Christ is not the behavior of a mechanic using an inert tool, but God's response to a life actively given to his will, even to accepting death in his name. The passive tense implies an active God and willing human Cooperation, and so as Paul said of the process of reconciliation, "All this is from God" (2 Co 5:18). So, too, when Julian speaks of those "to whom it is given to look and to seek," far from indicating lack of initiative in a passive recipient, she is speaking of someone alert and alive, empowered by the driving Spirit of God:. Motherhood strikes one as possibly the least passive of all vocations, especially as glimpsed in Mary's life in the gospels. She is so attractive and influential today simply because whatever God said she did in'faith. Does anyone really believe that banner headlines in a newspaper or a pic-ture on the cover of Time magazine are the measure of lasting influence? With so much left unsaid in the gosPels, it may well be'that the feminine, creative, nourishing and responsive qualities of Mary are what God has valued in her. Without these, people wither and personal relations are bleak. The old advice is still sound: "Do not teach [God] his business. Let him be. He has enough might, skill and goodwill to do the best for you and for all who love him.''7 Julian is always concerned for her "fellow-Christians," and her delight in the Faith is tangible, though she, too, lived in a socially horrific age. Calm self-possession is her keynote, never raising her voice. There is none of the stress that takes so many women today to the bottle or drugs, the counselor or the hospital. So many are living lives of quiet desperation, while others are teetering on the edge of despair. She writes out of con- Review for Religious, ~May--June, 1987 cern, with the simplicity of wisdom reflecting what she sees in faith. Her teaching of the natural delight of mother and son, and Christ's desire that we share in it, since we see just how much we are loved by God .in her, is surely, "simple, courteous, joyful.''8 Her guidance is at one with so much that is good in the Church. Common Sense God was in Christ recon~ciiing the world to himself. Those closest to him are effective mediators of his presen.ce. Clearly, "Paul, an apostle-- not from men or through man, but through Jesus Christ and God the Father" (Ga l:l), is superbly placed, but the origin of that call is valid, too, for Our Lady: Immaculately~conceived, bringing Christ into the world, raising him, beside him as he died, praying in the Church then, and now within the Church gloriously assumed into heaven, common sense would suggest that such a woman cannot but help in reconciling us to God. "This is only what sanctified common sense would expect: that God should keep safe all who for love of him forsake themselves, indifferent to their Own welfare.-9 The safety that is now hers she wants to be ours, and almost instinctively the Catholic faithful have felt this. In view of who she ~is in the providence of God, generations have opened themselves to her influ-ence in an often very unsafe world. G.K. Chesterton emphasized this when he told of the reaction of two eminent nineteenth.century Victorians to news of the proclamation of Our Lady's Immaculate Conception. Prince Albert was the husband of the leg-endary Queen Victoria who gave her name to an era, .and W.E. Gladstone was one of the outstaffding political figures of the age. If Chesterton is to be believed, the proposed declaration by the pope of Our Lady's Immac-ulate Conception was greeted with indecent hilarity by the former and with grief by the latter, as each in his own way saw in it the sign of the immi-nent downfall of Catholic. Christianity. Both were agreed that it would be unpopular. Albert and Gladstone, who both worked conscientiously for the poor, "understood so little of what that crown and image really meant to millions of ordinary people . Yet the applewoman did not dash madly out of church; seamstresses in garrets did not dash their little images ,of Mary to the ground, on learning that she was named Immaculate."~° Chesterton then speak~ of the first appearance of Our Lady at Lourdes some four years later. While the influential and educated still puzzled, "little knots of poor peasants began to gather round a strange, starved child before a crack in the rocks from whence was to spring a strange stream and almost a new city; the rocks she had heard resound with a voice crying, 'I am the Immaculate Conception.' " Did Albert and Gladstone~ men of Mary and Our Reconciliation / 329 integrity, even remotely approach the influence for good with ordinary people that is associated with the name Bernadette Soubirous? Shrines such. as Lourdes and private revelations such as Julian's are not to be considered as though from St. Paul and the gospels. Yet as a fact of life within the Church and with the approval of the Church, such places and similar insights undeniably have helped reconcile so many from every walk of life to God. In the light of Mary's Immaculate Conception each one of us is handicapped and in need, and she has particular appeal for those who are aware of their need. Here, especially, her faith and her fem-ininity are found so attractive, as she is known to be present now in imag-inative sympathy. In the circumstances, common sense would direct us to her company. Jimmy Durante used to celebrate that he was "the guy who found the lost chord." Unhappily, in the same breath, he had to admit that he had lost it again! It is given to few to be truly original. Life, genes, language, skills, food--virtually everything of consequence that has made us what we are have been mediated to us by others. It is the human condition, and it is the supernatural condition. Even the insights of a St. Paul are, under God, largely the result of an interchange, often troubled, between himself and his people. "The fathers have eaten sour grapes and the children's teeth are set on edge," may not be valid in terms of personal guilt, but it is true in terms of personal influence. Human beings transmit life and superb medical care, as well as AIDS and drug-dependent babies. Often the fruits of the Spirit are mediated through others as are the sins of the flesh. We all have reason to thank God for some of the people we have met as well as to regret the influence of others. As mediated experience is a fact of life for good or ill, common sense; would suggest that nothing but good can come from opening ourselves to Our Lady's influence. Her selfless, perceptive being, one person in Christ with ourselves, radiates God as she delights in the Lord her Savior. What-ever life did to her, "Mary kept all these things, pondering them in her heart" (Lk 2:19). Open to her reconciling influence, we too can assimilate experience, responding to God's presence in a sacramental world. Finally, common sense would especially commend that religious, who "ought to be poor in both fact and spirit" (Perfectae Caritatis 13), con-sider Our Lady's guidance in the search to be truly reconciled to God. She sees further and more clearly than any other guide in the Church, and her encouraging presence is always here. With increasing affluence, or possi-bly insensitivity, numbers of religious travel far looking for enlightenment. It is not wrong of course, but there does seem to be an innate contradic- 330 / Review for Religious, May--June, 1987 tion in the context of poverty when, for example, the search may take a religious to an a~hram in India, the deserts of Israel or California, or to the monasteries of Japan, Whatever insight is gained may be at the cost of a threadbare vow of poverty. Our Lady once appeared so nondescript as not to merit a first glance when she came with the offering of .the poor. Yet to the one truly enlight-ened by the Holy Spirit she was seen to be carrying in her arms "a light for revelation to the Gentiles" (Lk 2:32). She still reflects that same light now wherever we are in Christ. NOTES ~ M. Furlong, "The Power of,Images," The Way, October 1986, p. 299. 2 The Epistle of Privy Counsel, Chapter II, in The Cloud of Unknowing and Other Works, Penguin Books, 1978. 3 The Epistle of Privy Counsel, Chapter 10. 4 Julian of Norwich, Showings, Chapter 215, tr. E. C011edg~ and J. Walsh, Paulist Press, New York, 1978. All quotations are from Chapter 25 of this edition. 5 Julian of Norwich, op. cit., short text, Chapter 13. 6 M o Furlong, op. cit., p. 299. 7 The Epistle of Privy Counsel, Chapter 10. 8 Julian of Norwich, op. cit., short text, Chapter 13. 9 The Epistle of Privy Counsel, Chapter 6. ~0GoK. Chesterton, The Strange Talk of Two Victorians, and The Common Man, Sheed and Ward, 1950. Each quotation is from this essay. Brothers in the Church: A Vocational Reflection William Mann, F.S.C. Brother Mann is in his eighth year as a Formation Counselor for the Brothers of the Christian Schools. He had also served as Assistant Provincial for Formation (1979- 1984) and Director of Novices up to the present. He may be, addressed at: Christian Brothers; 83 West Lake Street: Skaneateles, New York 13152. ,~ few years ago, I volunteered to work at a Soup kitchen in Rhode Island. As my first experience of working with the street poor, it was both diffi-cult and challenging. Most of the time, I was afraid; and my fear kept me washing dishes and away from the people. I was attempting to make my contribution and avoid contact at the same time. On more courageous days, I would visit the dining room to sit and talk with the guests. Occasionally, I ventured, into the lounge to socialize after a meal. On one particularly hot day, a six-year-old child walked over to me, climbed into my lap, and using a shredded and badly soiled napkin wiped the perspiration from my forehead. He kissed my cheek, hugged me, and moved my heart. So para-lyzed by my own fears that I found it difficult to offer hospitality, this poor child reached out and offered me love. The story of my encounter with this young boy in a soup kitchen high-lights four key aspects of the vocation of Brother: I) ours is primarily a ministry of example; 2) our ministry on behalf of the Gospel and on behalf of the sanctification of others r~quires our own radical transformation; 3) those to whom we minister will be the instruments of our own conversion; and 4) 9urs is, therefore, primarily a ministry of reciprocity and mutuality. At the time that this incident occurred, I was teaching English and reli-gion in a coed secondary school. "Example makes a much greater 331 339 / Review for Religious, May--June, 1987 impression on the mind and heart than words."~ If I wanted my students to take seriously the admonition of Jesus to feed the hungry and clothe the naked and visit the imprisoned, then I knew that I was going to have to put those words into action myself. In twenty-two years as a Brother of the Christian Schools, I can hon-estly say that I have attempted to put my life at the service of the Gospel. As teacher, activity moderator, dormitory supervisor, school administrator, retreat director, and now formation counselor, I have worked consistently at proclaiming the Gospel by word and by example. Often this has been a humbling experience. "We are only the earthenware jars that hold this treasure, to make it clear that such an overwhelming power comes from God and not from us" (2 Co 4:7). My entire life as a vowed religious brother is a sincere, and yet sometimes inadequate, attempt to put the Gospel into practice. Accompanying those students each Wednesday to the soup kitchen was just one concrete instance of living out this commitment. "Your zeal for the children under your guidance would be very imperfect, if you expressed it only in teaching them; it will only become perfect if you practice yourself what you are teaching them. ''~- The example of Chris-tianity lived is what "brother-ing" is all about. Although religious brothers have traditionally been identified by the work we do (teacher, health practitioner, parish assistant, or manual laborer), I contend that our particular ministry, while significant in terms of individual congregations, is not of the essence of our vocation in the Church. It is the choice to be called "brother" which has always pinpointed our key contribution. Our very existence as brothers announces the new world order ushered in by Christ. We understand ourselves to be among those chosen by God "long ago and intended to become true ima.ges of his Son, so that his Son might be the eldest of many brothers [and sisters]" (Rm 8:29). The Scriptures tirge us to "love our neighbor as ourself" (Mt 22:39). That child reached out to me in love; and I believe that, in his person, Jesus Christ reached out to me and reminded me that, since God is my Father, all of us are'brothers and sisters. That young child reminded me that I was his brother, and challenged me to accept the people around me and not to get caught up in the differences of age, class, or color. He reminded me that God intends that we should love one another and that we should let go of the prejudices, defenses, fears, and barriers that hold us back from truly being his children, brothers and sisters of one another. This very ministry in which I was engaged on behalf of others was requiring that I °Brothers in the Church / 333 change. I was being challenged to live more fully the message that I preached. I was at the soup kitchen on this particular day precisely because I was trying to educate my students to share the gifts and the blessings of their own lives with those less fortunate. However, Jesus used the opportunity to challenge me to see him among the poor. This is the second key aspect of the vocation of brother; our consecration as brothers commits us to a life of transformation. Loving Jesus always means being changed. I wanted to help my students; Jesus chose to help me be more open to receiving the blessing the poor could be in my life. I went to the soup kitchen hoping to embody the loving presence of Jesus in the world; I returned home having encountered Jesus' loving presence in another. Initially, it seemed ironic that I was challenged to live the Gospel more wholeheartedly by the very people for whom I was attempting to be its proclamation. This was, however, the very heart of the teaching of St~ John Baptist DeLaSalle on what it means to be a brother. Furthermore, this was not only DeLaSalle's teaching; it was his own experience. We minister to others, but they call us to holiness. St. John Baptist DeLaSalle founded the Brothers of-the Christian Schools in France in 1679 to give a Christian education to the children of the working class and the poor. By 1682, however, the Society of the Chris-tian Schools was threatened with collapse. DeLaSalle urged his first di~cj-. pies to trust in Providence. As with the birds of the air and the lilies of the field, God would provide (Mt 6:25-30). The brothers challenged .DeLaSalle's right to say these things. He still had great family weal~l~ and a prestigious position as Canon of the Cathedral of Reims. What did he know of trusting in Divine Providence? If the schools collapsed, he would be safe. In his attempt to minister to the brothers, DeLaSalle hims61f was called' to holiness. He attempted to announce the Gospel to them; they challenged tiimto a fuller living of the Gospel. The first biographers report that so complete was his devotion tO the brothers and to the foundation of the Christian Schools that he heard in their challerlge the invitation of Jesus to take the Gospel more seriously, resign his Canonry, and distribute his wealth among the poor.3 Christ continues to speak to the brother through his disciples. If" we open our eyes and our hearts, we will continue to hear in them the invita-tion to draw closer to God. I believe that~this is what DeLaSalle meant when he wrote: "You can be assured that if you act this way [with an ardent zeal] for their salvation, God himself will take responsibility for yours."4 He was not speaking here of some kind of mysterious and passive 334 / Review for Religious, May--June, 1987 transformation. He was articulating his own experience. In proclaiming the Gospel to others, the Gospel lays claim on our own hearts. God uses the people and the situations of our lives to evangelize us. Through them and for the sake of the Gospel, God gradually refashions us into the image of his Son. Over and over again, the people and the situations of my life have pro-vided the opportunity to draw closer to Christ. There have been many times in my life when Jesus has asked me to recognize him and to love him in another person. Sometimes that person has been someone for whom I cared deeply; at times, that person has been a complete stranger. What has so often struck me in the Gospel has been the ability of Jesus to be open to all kinds of people in so many different situations. He saw in every person he met a reflection of his Father, a new and unique and beautiful side of God that could be seen in no other person or in no other place on this earth. I believe that Jesus calls us to open our eyes and our hearts to him as he continues to show himself to us in one another. Hence, ours is a ministry marked by reciprocity and mutuality. "They are a letter which Christ dictates to you, which you write each day in their hearts, not with ink, but by the Spiri! of the living God.-5 In inviting others to holiness, our own lives are opened to holiness. Those to whom we min-ister facilitate the capturing by the Gospel of our own hearts. I more and more suspect that this is the key aspect of the vocation of brother. In our openness to the evangelical dimension of everyday life, we provide our clearest witness on behalf of the Gospel. What greater example can be given than that I allow another to become the instrument of my own con-version to a fuller living of Gospel values? Jesus Christ is the "pearl of great price" (Mt 13: 44-46), and I ardently .desire to "share Jesus with those who have been entrusted to my care. We brothers desire to share "the treasure we have found hidden in the field of our own lives. ,,6 Our world is already bombarded with empty and meaningless words. What is needed are people who not only speak of Jesus but who act as followers of Jesus. What is needed are people who follow him so wholeheartedly that they become new incarnations of God's loving presence in the world. This is what I believe the vocation of brother is all about; this is what I am trying to do with my life---do this because I.believe this is what God Wants me to do. Furthermore, I do it because I believe that there are millions of people on our planet today~some Chris-tians, some Jews and Moslems, som6 far away, but very many are young Americans who look,to see if anyone any longer takes Jesus Christ seri- Brothers" in the Church / 335 ously. What hangs in the balance is the very credibility of the Gospel itself: 7 St. Paul assures us that the wisdom of this world is not the wisdom of God (I Co 3~!9); and I do not doubt that, in the face of a modern' Amer-ican society that encourages and fosters a pursuit of pleasure, possessions, and self-interest,8 it is perceived by many as foolhardy to be willing to want God to be more important than anything else in this world, and courageous enough to take the vows of chastity, poverty, and obedience. Yet we broth-ers are bold enough to believe that our own radical, personal conversion to Gospel values really has the potential to make a difference in the lives of those around us. We believe that this is the gift which Jesus Christ intends us to be for his Church. As DeLaSalle writes: "Be convinced of what St. Paul says, that you plant and water the seed, but it is God through Jesus Christ who makes it grow, that he is the one who brings your work to fulfillment?. ~ Earnestly ask him to make his Spirit come alive in you, since he has chosen you to do his work.-9 NOTES ~ John Baptist DeLaSalle, Meditations for the Time of Retreat, trans. Augustine Loes (Winona, Minnesota: St. Mary's College Press, 1975), p. 94] 2 DeLaSalle, p. 80~ 3 John Baptist Blain, The Life. of John Baptist DeLaSalle, trans. Richard Arnandez (Winona, Minnesota: St. Mary's College Press, 1982), Vol. I, Book I, pp. 81-84; Eli Maillefer, The Life of John Baptist DeLaSalle, trans. William Quinn (Winona, Minnesota: St. Mary's College Press, 1963), pp. 27-28. 4 DeLaSalle, p. 91. 5 DeLaSalle, p. 54. 6 Jose Pablo Basterrechea, "Address of the Superior General to the Regional Convoca-tion of the Brothers of the Christian Schools" (Mgraga, California: Regional Convoca-tion, 1984). 7 James Wallis, The Call to Conversion (S~in Francisco! Harper and Row, 1981); Pedro Arrupe, "What Is the Greatest Service Which Religious Can Give Today to Human-ity and to the Church?" Donum Dei No. 24 (1978). 8 John Kavanaugh, Following Christ in a Consumer Society (Maryknoll: Orbis Books, ~981). 9 DeLaSalle, p. 56. ' Appropriate Formation Martin O'Reilly, C.F.C. Brother O'Reilly, Director:of Formation for his community in Liberia, previously wrote "Current Conceptions of Religious Formation: An Analysis"r (November/Dece,mbe.r issue, 1985). His address is: Christian Brothers; P.O. Box 297; Monrovia, Liberia; West Africa. When Captain Smith of the Titanic uttered the words, "The only ice around here, Sparks, is in my drink," he was displaying a characteristic common to most of us--skepticism. When many American and European religious hear of the great vocation boom within the develoPing churches and look at their own decreasing numbers and formation houses being turned into retreat centers and homes for the aged, they skeptically wonder: "How it is that so many young Africans and others are being attracted to living a life of community, prayer and service as religious?" When I returned to Liberia in 1982 after an absence of eight years, we still had no local brothers in our West African communities~espite erect-ing a novitiate building in 1975 and having made it clear toall and sundry that we were keen to welcome local candidates into our communities. As I write this article in 1987 we have, to date, eighteen Wes~ African mem-bers and a thriving candidacy.program. We have just missioned our first West African brothers to set up a new community to work among leprosy sufferers, and fully expect to open another community elsewhere in either Liberia or Sierra Leone during the coming year. It seems fantastic to many in our congregation that in the space of five years we have more novices and junior professed religious in West Africa than in many of our other pro-vinces combined together. When people ask me how it is, I usually tell 336 Appropridte Formation / 337 them that it is the Holy Spirit's work--and something called "Appropri-ate Formation." This article will be concerned with defining the meaning of a religious formation that is~rooted within a developing-church situation. I will be using categories and concepts normally associated with the development of appropriate technology in developing economic and social orders, and .'using them to map out a theory of religious formation that is ,appropri-ate" to this new wave of young religious that congregations throughout the developing world are beginning to welcome into their ranks. In the second part of the article I will outline some of the important issues that our own young West Africah members felt should be on the agenda for an appro-priate formation. Appropriate Formation: A Definition Appropriate formation involves the application of the principles of reli-gious life to concrete local situations. This means developing ways or "technologies" which can be defined as "replicable methods for solving community problems and developing the capacities of communities to achieve their own goals" (S.B. Fawcett, R.M. Mathews and R.K. Fletcher, "Some Promising Dimensions for Behavioral Community Tech-nology," Journal of Applied Behavior Analysis, 13, 1980). These authors propose that seven dimensions of a technology must be considered to ensure the appropriateness of the technology: - Effectiveness - Expense - Decentralization - Flexibility -Sustainability - Simplicity - Compatibility A new technology means anew way of.doing things for the people who use the technology or who are affected by its use. For any significant change in behavior or attitudes to persist and the technology to be effective, the rewards, satisfactions and achievements obtained have to clearly outweigh the efforts and difficulties involved. For this to happen in the area of religious formation, formators need to have a firm understanding of what are to be the intended outcomes, methods t6 be used, content to be consid-ered and evaluation procedures which will° make up their formation pro-gram. This will, of necessity, demand that'~i formator sit down with both professed members of the group a~d neophytes, and work out what real- 338 / Review for Religious, May--June, 1987 istic goals a formation community can set itself, what practical wfiys they can be realized, and their appropriateness evaluated at different stages of the formation program. Inexpensiveness is of'considerable importance in a context such as West Africa since cash incomes are generally low. If we expect r~ligious from such regions ,!o earn their own keep and to be credible followers of the "chaste, poor and obedient Christ" for their people, then their formation experience should~prepare them f6r this reality. The end values of religious life shouid"not be obscured by the trappings of a partiCular lifestyle that is alien to the majority of Candidates prior tO entering a religious com-munity. Decentralization means the application of technology at a local level rather than from a remote center. Local religious will need to assume full responsibility .for the living out of their commitment, and not look to over-seas generalates and provincialates for direction on every facet of their lives. They are "the people on the spot," and they need both the compe-tence and the confideqce to discern in what direction the Spirit is calling them. As far as possible, ~those in initial formation need to be shown that responsibility and accountability are intrinsic to religious life. If candidates are not willing to grow in these areas, then there is no place for them 4n a religious community. If formation technologies are not flexible there is. little chance that people will be prepared to handle the gigantic social and pastora, I devel-opments that are taking place in so many parts of the world. There has to be a clear distinction made during religious formation between the end values and the means values of religious life. The end values are not negotiable, but the means ones can be redefined in the light of new insights among the members and the needs of the Church and of society. A flex-ible dimension in religious formation will concern itself with presenting a range of options to cope with specific concerns, and will include guide-lines for Change according to the felt needs of the group in formation. A frequent concern of formation personnel is that many young reli-gious, after having passed through the novitiate, experience a painful regression to the state they were in prior to entering the community. It is as though no significant personal or spiritual development had taken place. Often the cause~of this is because the technology, or way of being a reli-gious, is not sustainable: at the local community level. They leave the novitiate with either unreal expectations of what religious life will be,, and are disillusioned with what they find to be t.he reality~ or they flounder with- 6ut ihe strong guiding hand of a r~ligious specifically missioned to help Appropriate Formation / 339 them overcome every hurdle they may encounter. A gradualist strategy is needed during formation wherein "stretch-outs" are provided so as to allow young religious to know what it means to live, pray and work in a typical community of the congregation. Here they can focus on the con-crete problems of religious life rather than on the long range goal-setting which makes up so much of the agenda of religious formation. A new technology must be simple and comprehensible enough to be understood by its potential users. Religious formators will need to acknowl-edge the "multi-path" approach when dealing with candidates coming from differing social, economic and educational and faith backgrounds. There. have to be features of a formation program that provide for acceler-ation when goals are realized and values interiorized, and a locking-in system that prevents regression from gains obtained. Finally, any new technology must fit into the community or society at large. To be compatible with the surroundings from which the candidates are comirig and in which their religious formation is taking place, the new technology must be seen to work. It must be seen to provide religious men and women whose lifestyle is clearly valued and appreciated by the immedi-ate society. If religious life is seen as wholly meaningless by those around, it is difficult to see how an individual can commit himself or herself unreservedly to such a vocation. Appropriate Formation: An Agenda I want to turn now to a consideration of what are some of the problems facing young local religious. I shall outline these issues within the frame-work of the three end values of religious life---community, prayer and ser-vice. To identify what are the problems our young religious will have to confront is the necessary first step towards devising a formation program appropriate to the people and situation in which religious life will find a new beginning. Community. ~ The issue of where a person's primary loyalties lie---either with one's extended family or with the community--is a source of tension for most local religious at one stage.or another of their lives. Appropriate formation must tackle this area sensitively but una.mbiguously: "No, a community cannot take on the responsibility of supporting and educating younger mem-bers of a local religious' family; but yes, a community will help in a crisis or an emergency as best as it can." Formal membership in a religious.con-gregation must broaden a person's "in" group to .those past and living mem-bers of the congregation around the world. If the extended family holds 340 / Review for Religious, May--June, 1987 the central loyalties of the young religious, then eventually a clash will come and he or she will be the casualty. It is hard to be a citizen of two worlds! Unless serious efforts are made to tackle the issue where a person's identity and sense of belonging lie, feelings of inauthenticity may arise within the young religious, and eventually may lead to their departure from the community. Likewise, with the question of tribal or national bonds, while encour-aging people to be proud of their heritage, those distinctions which blur the call of a person to see everyone as his or her brother or sister in Christ, must be faced up to during the period of initial formation. Tribalism, mean-ing the preference for one's own tribe over national interests, is a growing political concern in post-colonial Africa. Local religious can easily fall into a tribal mentality with disastrous consequences for community living. Going against tribalism is no easy thing and young religious need to be under no illusion that to have respect for each person's tribal identity is one of the primary signs that they can give to their people of the inclusive nature of the kingdom of God. Many of those who apply for membership in religious communities in developing countries carry with them stories of how they had to struggle against all odds to complete their schooling and perhaps to start in a career. This experience of being a "survivor," when so many of their friends gave up along the road, can lead some to evaluate any or every facet of religious life in terms of what they can get materially from the community--instead of what they can give to the community. Every formation community fairly exudes the idea that there are those already in the community (i,e., they own the house, the bedsheets and the marmalade), and those who wish to join the community. This is a classic "donor-receiver" situation. Usually it takes years for a religious to believe that the house and community pos-sessions are not "theirs" but "ours." In a developing-country situation this "donor-receiver" mentality can persist far longer when the professed religious are white and those joining the community are black. Obviously, religious life means old and young, black and white--or ~,hatever other contrasts a person cares to make between people--all attempting to live in harmony together. This is our" witness of the kingdom and the means by which we build up the Church. For that to happen, there has to be a basic leveling among the members of the community. Formators need to devise ways in which local religious can "own," not only the community goods, but the core values at the heart of the community. Prayer Appropriate Formation / 341 . Much of religious formation, in the spiritual domain, is concerned with deepening a person's,capacity for, and appreciation of, a "grace-full" rela-tionship with Jesus. This is a task for religious formators worldwide, but in my experience, .those working in countries with a strong animist tradi-tion have added challenges. The first one is helping young religious see that prayer, to be real; must be a constant part 6f a person's life. Just praying when the community decides to pray in common is not enough. When prayer is simply a duty expected of one by others, then the shallowness of a person's prayer~life will be revealed when serious vocational problems arise and a ~oung~reli-gious doesn't really believe that there is a God who is ready to love, under~ stand and forgive. In my experience of countries with a strong animist tra-dition, God is more than likely to be feared rather than loved, .and for-giveness is at a price. Coupled to the above challenge is that of helping local candidates real-ize that the form and structure of prayer are not ends in themselves. They are only aids to developing an'awareness of God in ~ne's life and in encour-aging prayerful living. The tendency in the animist tradition to overstress the ma,.gical nature of prayer can lead to a marked separation ~of the sacred and the secular, andah inability to make the "stuff Of daily living" the quarry for one's own prayer. A third challenge I believe formators can have is helping young reli-gious recognize that their own people's spiritual heritage can provide them with stepping stones to discover and value the face of God in Jesus. They will need a strong, personal faith to be able to discern authentically the pres- 6nee of God in their people's faith history, and a vision of the Church as embracing all peoples and cultures, as acknowledging and respecting the I,ocal character of each people. Service In many countries where the Church is newly rooted, much is made of a person's final profession or ordination--I suppose because local reli-gious and priests are still a rarity in many places. Sadly, perhaps, not a few young men and women leave the altar as newly professed or ordained with a very exalted view of themselves. They go on mission with a mentality, more suited to starting a career than a vocation. We need a model of the "servant" Church as never before in devel-oping countries. Otherwise the cr6"dibility and respect which the first mis-sionaries earned from the people will vanish. If there are not local men and women prepared to minister with total conviction and compassion to the marginalized of their society,, then things do not look well for the future. 349 / Review for Religious, May--June, 1987 I believe that there are people amongst those seeking to follow "the chaste, poor and obedient Christ" who have the dynamism and selflessness of those first missionaries. But they will need every encouragement and incen-tive to rise above merely identifying with the better educated and affluent members of their society. Appropriate format.ion will need to stress the distinction between a career and a vocation, and to present clearly and simpl~, the model of Jesus who had "nowhere to lay his head," who could welcome all and who was wholly caught up in doing the will of his Father. Conclusion Thi~ article has concerned itself with indicating dimensions of a for-mation program that must be appropriate to the persons it serves and to the so(iety in which such people will minister. I have pointgd out some of the priorities I feel that formators involved in develpping-church situations need to take note of and to put.on their formation agenda. To those who are skep-tical concerning the future of religious life in the. world today, let me end wiih a quote from Samuel Beckett: "He sat with me in the dark room of my doubt and lit a candle." During my five years of close involvement with religious forma_tion in West Africa, I have seen that candle glowing, and my hope is that religious throughout the world will, like me, grow in certainty by its light. From Tablet to Heart: Internalizing New Constitutions land II by Patricia Spillane, M.S.C. Price: $1.25 per copy, plus postage. Address: Review for Religious Rm 428 3601 Lindell Blvd. Growth Producing Tensions in Pre-Novitiate Formation Donna Marie Wilhelm, S.N.D. Since writing this article, Sister Donna Marie has been transferred to Sarasota's Cardi-nal Mooney High School where she now teaches and is local superior. She may be addressed at 4004 Fruitville Road; Sarasota, Florida 33582. Liberal, conservative; masculine, feminine; introvert, extrovert; Ignatian, Franciscan; adjectives--"labels" that describe experience, that are valu-able as long as they do not become restrictive in their attempt to'describe, as long as they do not bind rather than free us for growth and understand-ing. These labels are set up in tension as opposites, or perhaps better as complements. Their value is not so much in setting persons in opposition to one another, but in directing them to wholeness of vision. They provide for an expression of tension that can lead to healthy growth and a more com-plete outlook on life and experience. I believe that formation, too, is about tension--healthy tension--that is inherent in the process itself. Tensions exist throughout the period of initial formation with varying emphases and with differing intensities. This is particularly true in the pre-novitiate period. One of the dangers in the beginning of the formation process is that some individuals, once they begin to live in a community setting, may live out of a sense of finality that says, "I have made my decision. This is where God wants me. Just tell me what to do in order to be a good Sister of Notre Dame (or Franciscan or whatever) and I will do it." A stance like this needs to be explored gently, and then laid to rest as a false and harmful presupposi-tion. 343 344 / Review for Religious, May--June, 1987 I believe that it is more accurate to define vocation as a verb rather than a noun, as E.F. O'Doherty has suggested in The Psychology of Vocation. A vocation is not something that I "have"; it is a possibility for me to "become." Implied in this kind of definition is the reality that following a particular vocation involves a repeated act of choosing. In the initial stages it involves decision-making that then becomes the raw material for an ongoing discernment process. For the remainder of this article I want to describe three of the tensions that I think are common to those who are new to the religious process: those in pre-novitiate. Since formation does not happen in a vacuum but in the context of community, community members and attitudes among members are very important in helping the individuals in formation to negotiate these tensions successfully. Child/Adult. Jean Vanier has said, "When people come into a community they are usually in a state where you can ask anything at all of them . People coming into community have a child's grace.''1 This stateof becoming "like a child" again i~ a result of a variety of factors: the initial joy and enthusiasm of any beginner; the "rush" that comes with "finally arriv-ing"; but perhaps most importantly there is a tremendous loss of the famil-iar for the newcomer. o Ray B(adbury in his book Dandelion Wine tells a story that points to the importance of the familiar, of the everyday. It is a story of two y, oung boys and their summer discoveries through everydayness. Doug, the older boy, decides to keep a record bf the summer's adventures in a yellow nickel tablet. In explaining his plan to his brother Tom, Doug begins: I'm going to divide the su.mmer up in two parts. First part of this tablet is titled: Rites and Ceremonies. The first root beer pop of the year. The first time of the year running barefoot in the grass. First time of the year almOst drowning in the lake. First watermelon. First mosquito. First har-vest of dandelions. Those are the things we do over and over and over and never think. Now here in the back, like I said, is Discoveries and Revelations or maybe Illuminations, that's a swell word, or Intuitions, okay? 'in other words you do an o!d familiar thing, like bottling dandelion wine and" you put that under Rites and Ceremonies. And then you think about it, and what you thinkr crazy or not, you put under Discoveries and Revelatiohs. Here's wha~ I got on the wine: Every time you bottle it, yo~u got .a whole chunk of 1928 put away, safe.2 Wh~t Bradbury recounts is in many ways similar t~ the dynamic of the familiar in our lives, the movement from the experience of the world.,gs Tensions in Pre-Novitiate Formation / 345 alien, through a sense of well-being, to an awakening to "otherness." Our first experience as children, or later in life as beginners in a religious for-mation process, is one of awe, dread, an overwhelming helplessness and powerlessness. As children, this sense of, anxiety is usually answered by our parents who provide a caring atmosphere in which we can experience some security. We need this sense of security and familiarity with persons, things and event~ in order to function in this world. This movement from helplessness'and powerlessness to security and familiarity is a "child to adult" movement. Being "at home" in our world is also essential to our spirituality. We need to be grounded in the familiar and the ordinary, since it is that grounding that gi'ves us a feeling of belonging, at homeness, security. And these experiences point to a deeper ground, ou~ groundedness in God in faith, hrpe and love. Our faith in God must be incarnated in our experience, and this happens as we reflect 6n the everyday occurrences where God touches our lives. If what is familiar and "everyday" in our lives is so important to our adulthood, to our functioning and to our grounding in God, then losing our"' sense of "at homeness" in our day-to-day living is a significant loss. It is this loss that brings us back to being like a child again, a child in an alien world. What takes place at the onset of the pre-novitiate is e~actly that: the loss of the familiar. "Familiar" in this context may mean different things for different individuals but for most it includes job, apartment, car, friends and family and a certain degree of indepepdence ih action and in decision-making. Loss of the familiar is often accompanied by a feeling that "I'm out of control," a feeling of helplessness in my new environment. In many candidates this is expressed by a loss of ability to do something as simple as balancing time, and that results in lost hours of sleep, cutting down on leisure and exercise to make up, loss of efficienqy on the job, in ministry or at school. Moving into a new place with new people requires a tremendous adjust-ment. It involves~a period of trying to determine what "the rules" are in this group .with whom I have chosen to live. It is a time of grieving for many losses. And it is a time that is often ac~companied by regression, the return to patterns of behavior that helped us to cope with an alien world when we were children. One of the problems in c?mmunity is that this regressive behavior can be very disconcerting to the "old-timers" unless they are aware of what is happening. It is a crucial period when the com-munity must offer support and understanding, but must carefully guard against giving a formula for a new identity too soon. As in any loss, the loss of what is familiar can break the newcomer open to another necessary 346 / Review for Religious, May--June, 1987 element of life,- the transcendent. The pain of this experience can be an invitation to the candidate to begin the process of lived discernment, of choosing his or her vocation in day-to-day life. A further difficulty.in community can occur if the purpose of this time of formation is not well understood. The heart of the pre-novitiate is built on the call to holiness that all Christians share. That call must be explored and deepened through gradual growth in self-awareness and developing nat~ ural gifts, in dealing with past losses and hurts, in deepening prayer and in learning the dynamics of community living. "Our candidates are older women," some community members say, "women with education, with work and life experience. Why do they need to spend a year or two in a pre-noyitiate process?" It is a very common mistake to look at a person's age, work experience, social skills and make a statement like "Why can't she just begin as a novice?" It is so important not to equate age absolutely with any given level of human maturity, of experience, of spiritual or pro-fessional development. Accompanying women, especially older ones has ¯ only confirmed my belief that each individual is composed of many com-plex variables, and the time spent at the beginning of the formation pro-cess is not "lost" but is essential to provide a confirmation of gifts, an accurate assessment of needs and limitations, and then time to allow the individual to begin to build a foundation for continuing discernment for the future. This is the purpose of the pre-novitiate as it is described in Essen-tial Eletnents. It is the period "in which the genuineness of the call is iden-tified as far as possible . -3 It is a time of growth, not stagnation. Being In/Being Out Another significant area of tension for those in the pre-novitiate pro-cess is the tension that is created by not being a "real" member of the congregation, by hot even, strictly speaking, being a "religious," while living in a house of the congregation with its real members, more or less according to their manner of life. One of the major emphases in the doc-uments dealing with formation that have been published since Vatican Coun-cil II is that of the concept of gradual transition, that is, the idea that the mok, ement from the previous lifestyle to the life of religious consecration should be a gradual, not an abrupt one, and that it involve a time of transi-tion rather than of drastic or dramatic change. Congregations have made many and varied efforts in this diri~ction. They have developed vocation-awareness activities that reach into the elementary schools, retreats and overnight experiences for high school stu-dents, and live-in programs for those who hre seriously considering the option of religious life.-'Many congregations have begun nonresident affil- Tensions in Pre-Novitiate Formation 347 iate programs to give interested men or women an even closer experience of their life. These efforts are all for the sake of gradual acquaintance and transi-tion, find they are invaluable. They need to be carried into the period of pre-novitiate as well. One way to accomPlish this is to establish the pre-novitiate community as an "in-between" community as Vanier cails it in his book Community and Growth. IdeallY this community will be com-posed of the candidates, the director ahd several oth,er professed members who represent different mir~istries. I am not speaking here of simply moving the candidates and director into an established local community-- even though in fact this is what may happen. The difference is that the pri-mary purpose for the existence of the "in-between" community is to pro-vide a formative environment for the candidates. Such a community pro-vides an environment which facilitates the transition of the individual from being an independent lay man or woman to being incorporated as a com-munity member, and finally to becoming a committed member of this specific community and congregation~. It must, be an environment that encourages reflective living, where acceptance is~not based on conformity. What is of primary significance at this stage is to foster human growth and a sense of responsibility towards the life, not to provide a cozy escape from decision-making or a neat set of dos and don'ts. Such a community will provide a rhythm of life that is the "bare bones" for continued discernment; a rhythm of reflection, silence and prayer. It must give the time for candidates to participate in courses or group direction that con-tinue, to develop knowledge of the faith and of the spiritual life. Finally it will provide opportunities for some type of initial exposure to the ministries of the congregation and for some connectedness with the local Church. The individual who +omes to a pre-novitiate experience has made a definite decision and commitment, and so has the congregation ~vhich he or she has joined. Being "in-b~tween" does not water down that commit-ment or mitigate the decision. Rather it gives the space f~)r the candidate" to do two very important things: t~) learn hoW to live in community arid to adjust significant relationships to his or her new lifestyle. These issues are important ones in becoming a member of any community, not just a religious congregation. Outlining the elements in "learning" community is simple. Living them is a tremendous challenge. At the very beginning, a knowledge of the stages in the growth Of a community is essential, as is an awareness of some basic dynamics that can occur. I have found the material provided 3till / Review for Religious, May--June, 1987 by Hammet and Soefield in their book Inside Christian Community extremely helpful in these areas. Communication and dealingwith conflict are two other key issues. I believe that the most difficult of any of these is conflict management. This is true not only for the newcomer, but for most of us who have lived in religious communities for years. Each time I am involved in a workshop on this topic with our candidates I am aware of how much more I must learn. It is so iinportant to be patient, firm, and to provide supportive gui.d:~ ance in this area. Above all, experienced community members must not fall into the trap of becoming the rescuer between two candidates or a can-didate and another community member who may have taken on the roles of victim ancl persecutor in regard to each other. Being willing to sit down and role-play situations or conversations is a valuable tool here. In sum, the skills of conflict management must be practiced, our limitations and weakness shared, if growth is to occur. ~ The "in-between" climate of the pre-novitiate community also pro-vides the space necessary for the candidates to adjust significant relation-ships in their lives. This is particularly important for candidates who come with a broad base of family, friends and work-related contacts. It takes time and the freedom to move in and out of community to make the decisions necessary to maintain some relationships, to let go of others', and to invest in new ones within the community or in a ministerial setting. This is no small task because it involves community members who can allow for free-dom but also who, through modeling and guidance, can gradually intro-duce the candidates into the obligations and time commitments that com-munity life can and must of its very nature demand. Providing opportunities for the community to get to know the family and friends of the candidate can be extremely helpful and enrichi.n.g for both. Visiting, inviting family members to share in celebrations, and other casual contacts are,just a few ways to do this. Again, grow,th must be suppprted by u,nderstanding, hon-esty, openness in dialogue, and willingness to search together for the best decisions. In these areas, too, we are dealing with choosing a lifestyle, with making decisions that are more and more--or less and less-~consonant with one particular life direction rather than another. Fitting In/Impacting For Change A newcomer to any group can be expected to ask the question, "What d6,.I have to do to fit in here, to be one of you?" He or she may also say "I have talents, gifts, a vision to offer that may call for some changes in our group. Will they be acce.pted?" The tension between the desire to "fit in" and the need to influence toward change is born in these questions. Tensions in Pre-Novitiate Formation / 349 There is, I believe, a very real sense in which a candidate in any religious congregation must "fit" if not "fit in." In an attempt to be "liberated" and "open" to everything, I think we sometimes try to deny the truth of that. Our congregations do .have living traditions, a heritage that must be experienced and to some extent learned. We each have a unique identity; whether we have articulated that or not, that is our founding gift, and it is that which mediates the Gospel to the members of our institute. The for-mation process takes place according to this founding gift.4 The community at large is very important in this aspect of the process. The Rite of Christian Initiation of Adults in number four states: "The initia-tion of catechumens takes place, step by step, in the midst of the com-munity of the faithful. Together with the catechumens, the faithful reflect upon the value of the Paschal Mystery, renew their own conversion, and by their example lead the catechumens to obey the Holy Spirit more gener-ously." Since the call to religious consecration is a call to the deepening of one's baptismal consecration, an analogy can be drawn between the pre-novitiate and the catechumenate, between the involvement of the faithful and the indispensable involvement of the religious community in which the candidates seek membership. Members of religious communities see in their initiates not only a renewal of their individual covenant relationship with the Lord, but also the hopeof the continued life of the congregation. Rejoicing in and affirming new members in their call is essential. It draws the candidates into a large~',.sense of belonging, gives them a sense of his-tory and furnishes them with many more individual touchstones of unique charism, as well as an experience of charism in the corporate sense. For those who are already part of the community at large there is not only the opportunity but the responsibility to participate in "handing on" the congregation's traditions, and of being a "welcoming presence." "Welcoming presence" says, "this is how we are." At times of celebra-tion, community prayer and working together, it is a presence that says, "This is the diversity of ways in which we express our common charism. For us, Sisters of Notre Dame, our charism includes a simplicity of life and an experience of the Father's provident care in our lives that is expressed in the phrase 'How good is the good God!'. These elements of our shared vision are concretized in a special family spirit, and in our efforts to min-ister to the poor, to bring hope to them through evangelization and catechesis. You are welcome to be with us and to bring your uniqueness to our vision." 350 / Review for Religious, May--June, 1987 Once again it is absolutely necessary, though, that the "welcoming" not become a welcome that demands immediate conformity. The com-munity must understand the "in-between" nature of pre-novitiate and the primacy during this time of confirming the choice of this particular lifestyle within the basic call to holiness. "Welcoming" also includes welcoming gifts and initiative. When I enter into a relationship with hnother, I invite the possibility of being changed by that encounter. I trust that the new vision that we come to share together is good and growth producing. This is true of the new members in community. "Candidate" is not necessarily equal to "'young" and "inexperienced." We need to remind ourselves of that at times, and let our welcome include the invitation to enter into our life in a meaningful and effective way. 'Practically, this means including our candidates in tl~6 significant events of our community: meetings, renewals, ;'futuring" ses-sions, preparations for chapter and the like. It means valuing their gifts and expertise, and accepting these when they are offered in service of the com-munity and of the Church. These men and women of today can help us in our struggle to find ways to incarnate our charism into our life and ministry and to meet the needs of our times in a realistic way~ There is a very healthy discomfort that we experience when we feel pulled in two directions, a discomfort that moves us to action, to choice. The tensions experienced by newcomers to religious life are opportunities for self-awareness, for growth and for authentic discernment of a lifetime commitment. Being aware that they exist, dealing with them in realistic ways and' soliciting the understanding and support of community members in helping candidates to live and grow with them can only be an invalu-able asset to any formation process. .~ . NOTES ~ Jean Vanier, Community and Growth: Our Pilgrimage Together (New York: Paulist Press, 1979), p. 5 I. 2 Ray Bradbury, Dandelion Wine (New York: Bantam Books, 1976), p. 27. 3 Essential Elements in the Church's Teaching on Religious Ltfe, n. 48. 4 lbid, n. 44. Beyond Frontiers: The Supranational Challenge of the Gospel Gerald A. Arbuckle, S.M. Well known to our readers, Father Arbuckle is the prime mover and designer of the summer workshop, sponsored Dy R~viEw Eon R~L~¢~OUS and St. Louis University's Department of Theological Studies, entitled: "Refounding Religious Life from Within: Strategies for Leadership." His previous article, "Mythology, Revitalization and the Refounding of Religious Life," appeared in the issue of January/February, 1987. Father Arbuckle's.permanent mailing address is: East Asian Pastoral Institute; P.O. Box 1815; Manila 2800; Philippines. Supra-nationalism is the ability and the willingness of individuals or groups to strive to id.entify with cultures and needs beyond the frontiers of their own country in ways that are both critical and non-exclusive. (Multiculturalism, on the other hand, is the same ability and willingness, but directed to other cultures within the boundaries of one's own country.) This identification with cultures, be it noted, is not blind or uncritical. The weaknesses, as well as the strengths, of cultures are recognized. Moreover, this identification is not exclusive. That is, supranationalists are open to still other cultures beyond those with which they are immediately con-cerned. Christ calls his followers to a basic supranationalism, They are them-selves to be reconciled with the Father through love, and they are to express this reconciliation in their relations with other peoples and cultures. With-out, this love of the Father, a gift of the Holy Spirit, the reconciling rela-tionship with those around us cannot be sustained. Selfishness and the desire for power over others will overcome us. Ultimately we are encour-aged in this struggle to be reconciled wi(h the Father and with one another 351 352 / Review for Religious, May~June, 1987 by the hope of the "new heavens arid a new earth" in the fullness of God's kingdom yet to come, "where; accordihg t6 his promise, the justice of God will reside" (2 P 3:13). " The world is fractured by ideological conflicts, pathoio~ical forms of nationalism and intercultural tensions. It is a world "groaning in travail" (Rm 8:22), desperately in need of reconciliation across and within national frontiers. ~ Inasmuch as many religious orders are stamped with an interna-tional character, the Church rightly expects of them bold evangelical initiatives in response to today's critical need for supranationalism.2 But are religious orders responding to this challenge to provide lead-ership not just to the Church but also to the world itself?. Or have some congregations settled into a comfortable, introverted type of "ecclesiastical nationalism"? What conditions are necessary for religious congregations to express in spirit and action a much-needed supranationalism? This article is an attempt to respond to such questions. I will - show how prejudice obstructs sup.ranationalism; - explain the New Testament call to supranationalism; - reflect on how religious orders have in the past responded to the challenge of supranationalism; - construct two models which religious institutes can use to mea-sure their own response to the challenge of supranationalism; - reflect on the role of ongoing conversion as an essential require-ment for supranationalism. Excessive Nationalism: the Obstacle to Supranationalism Nationalism is a complex word to define. It expresses a form of group consciousness, that is, consciousness of membership in a nation. In this lim-ited sense, nationalism is good. It gives people a sense of meaning and iden-tity, a respect for their past, the energy to work together for the common good. When, however, people begin to believe that they are superior to other peoples and cultures, then nationalism becomes excessive. People become unable to look beyond (supra) their national borders to learn from the values and experiences of other cultures. At the heart of excessive nationalism is cultural prejudice. Prejudice is an "attitude towards a person who belongs to a group simply because he belongs to that group and is therefore presumed to have the qualities ascribed to that group." 3 In brief, prejudice involves a predisposition toward a group of people that is not derived from adequate information. There are two aspects to cultural prejudice to be noted. Firstly, there is the meaning aspect or stereotype. A stereotype is ,a preformed image or picture or judgment about people, whether favorable or unfavorable: "The Beyond Frontiers / 353 Irish are prone to excessive use of alcohol." "All Italians sing beau-tifully." The second aspect is the feeling dimension. The prejudiced person sees only what he or she wants to see, even to the point of seeing things that are not there at all. The causes of prejudice are complex and many: fear of people who are different, a desire to exploit, a need to bolster one's personal and cultural self-esteem .4 Culturally prejudiced people can show excessive nationalism in one of two major ways. Firstly, they can seek to impose on "decadent and imper-fect cultures" their own "perfect" values and customs, coming to treat subject people like children---or worse. Secondly, a particularly insidious form of cultural prejudice is cultural romanticism. The foreign culture with which the individual wishes to identify is considered "perfect," and his or her culture-of-origin is thought to be thoroughly decadent. Often the romantic will seek to freeze the new culture in time, thinking any change will undermine its "perfection." This type of romanticism is alive and well, especially among foreigners working in Third World countries. Romanticism is also apt to show itself in overidentifying with nation-alist movements in those cultures or nations. Here, would-be agenis for change sometimes lose all sense of objectivity; they fail to see the violence and tragic effects of their overinvolvement in nationalist movements. Some-times more nationalistic than the locals themselves, they become severely condemnatory of the values and customs of their own cultures-of-origin.5 It is not easy for a person to become truly supranationalist. Supranationalism can only result from the ongoing personal struggle for truth and for the desire to respond to this truth. First one must face the truth about oneself: we are all prejudiced in one way or another. Self-knowledge is always extremely difficult. It also happens to be highly inconvenient, because as a result of a better knowledge of myself and my prejudices, I may have to do something about it. Human beings are highly skilled in avoiding truths about themselves; we are accomplished fugitives from our-selves. If I have the courage to discover my cultural prejudices, I then need a strong motivation to put them aside. It is much easier and simpler to ignore my prejudices! Supranationalism and the New Testament The heart of the Christian .message is that God "has reconciled us to himself through Christ" (2 Co 5:18) and his peace, a peace that can never come from mere human action (Jn 15:27), that we struggle to share with our brothers and sisters no matter what culture or nation they belong to (Rm :354 / Review for Religious, May--June, 1987 12:18). This peace, the fruit of love in the Spirit, motivates us to respect cultural differences and the just aspirations of people; it shows itself in "patience, generosity., mildness" (Ga 5:22f). It includes an openness to learn how God has worked in the lives and cultures of other peoples. There will be no jealousy for their achievements nor will there be a boast-ing over the accomplishments of one's own nation or culture (ibid v. 26). There will be ~he courage to challenge people of different cultures to face obstacles, for example, personal and social sin, that hinder or prevent them from achieving reconciliation with God and with each other. Followers of Christ know that they can avoid excessive nationalism in its various forms only if they remain truly open to the .Transcendent, allowing it to influence their lives in each one's particular cultural situation, even as they await the fullness of justice and peace ~n the world to come. Not surprisingly, Jesus directly confronted the excessive nationalism of his day, urging his followers to be supranationalists. At the time of Christ, Jews looked on Samaritans as uncouth, stupid, heretical. And Samaritans had similar views of their Jewish neighbors. As Scripture com-mentator, J. McKenzie, points out: "There was no deeper break 6f human relations in the contemporary world than the feud of Jews and Samaritans, and the breadth and depth of J~sus' doctrine of love could demand no greater act of a Jew than to accept a Samaritan as a brother."6 Those who heard Jesus speak would have been left in no doubt about the meaning of what we now call the Good Samaritan incident. The Samaritan is manifestly a supranationalist! Jesus' listeners are stunned to heai- him say "Go, do likewise!" (Lk 10:37). In a second story, this time a personal event in Christ's life, Jesus is an "international traveler" and exemplifies his own supranationalism in his relations with the Samaritan woman at the well (Jn 4). Not only does the woman experience Christian politeness for the first time, but she is told that eternal salvation is open to her through the love of the Father. Of all the early followers of Christ, Paul stands out as the model of supranationalism in evangelization. He had been a thoroughly fanatical sup-porter of Jewish culture, a rabid nationa~list, but underwent a dramatic theological and attitudinal transformation once he began to preach the Gospel in Gentile cultures. In Paul's epistles we see depicted the attitudes that must govern the evangelizeras he or she relates to different cultures. Firstly, the evangelizer must identi.fy as far as possible with the cultures of people to be e.vangelized: "I became like a Jew to the Jews in order to win the Jews. To those bound by the law I became like one who is bound (although in Beyond Frontiers / 355 fact Iam not bound by it), that I might win those bound by the law . I have made myself all things to all men in order to save at least some of them" (1 Co 9:20, 22). Secondly, identification with the aspirations of peo-pies of different cultures should be critical (Ga 5:1-6). Thirdly, the Gospel message is to be preached in its fullness; our struggles for justice and peace in this world are but the seed and the beginning of the kingdom of God here below; it will find its completion at the end of time with the resurrection of the dead and the renewal of the whole of creation (Rm 8:1 1- 21).7 Religious Life: Internationalism and Supranationalism .~ On one occasion, while doing research in a Third World village, I over-heard villagers speaking about the "Backhome Man." Each time they used the expression there would be hoots of laughter. I discovered the man who delighted them was an evangelizer from another coun.try who began sentences with the expression "Back home . . ." so often that the people nicknamed him the "Backhome Man." The evangelizer had the gift of internationalism, that is, he was prepared to live in someone else's coun-try, b.ut apparently he was slow to learn anything from the host culture. He lacked the gift of supranationalism; he was willing to give (on his terms), but not to receive. Our "Backhome Man" sadly lived a stunted religious life as well. For the true religious dedicates himself or herself totally to God, the Supreme Love. In a new and special way the religious makes himself or herself entirely over to God, to serve and honor him in and through the Church.8 The religious should seek to be an exemplary disciple of the Lord, to be one with him in his mission to the world.,The object of his. mission is the person "whole and entire, body and soul,',9 involving what we call today integral salvation. Supranationalism (and mu!ticuituralism) opens the way to this concern, for it relates to the well-being of both body and soul of the peoples of this world in their concrete reality. For this reason, because of their radical commitment to the Lord and to his Church, religious must be in the forefront in fosteringthe virtues of human solidarity and interdependence. Two questions are~to be asked: have religious congregations in the past fostered supranationalism? How are they responding to this challenge today? I will take each question in turn. Religious Life and Supranationalism before Vatican II There is no doubt about the involvement of religious congregations in internationalism over the three hundred years prior to Vatican II. Religious, 356 / Review for Religious, May--June, 1987 very often from newly formed congregations, moved into recently discov-ered countries, frequently braving, atrocious physical conditions, in order to spread the faith.~ While many individual religious aspired to identify with the cultures of the people they were evangelizing, rarely was the work of religious congregations themselves marked by the spirit of supranationalism within those countries which we now call the Third World. At the risk of grave oversimplification I will explain briefly why it was difficult for religious to express supranationalism, in evangelization. ~0 From the fifteenth century onwards, a marked inflexibility in the Church's rela-tionship with cultures, especially beyond Europe, developed. This inflexibility affected the missionary policies of religious Congregations. Prior to this period, most especially in the early centuries,o.the Church often related to cultures in remarkably flexible ways. Pope Gregory the Great's directive to Augustine of Canterbury 'in the year 601 about not destroying the temples of the gods, and,the need to place the relics of the saints in those same temples is rather symbolic of the flexibility of the period. ~ This openness, however, was not to continue; The Church became more and more culturally "Euro-centric" in its expression of the faith. In more modern times, as European colonial expansion developed, it was this Euro-centric Church that was to accompany it. As one commentator put it: "The missionaries--true children of their times--shared the intolerant and prejudiced views of the conquistadores on the native cultures and religions.''~2 The European Ch~'ch was to be planted in the new lands with-out change. The cultures of the people being evangelized were seen as unim-portant; priority was given to the conversion and salvation of individual souls: Rarely did missionaries see the need to understand local cultures-- or even at times to learn the local languages.13 There were vigorous, but eventually unsuccessful, reactions against this arrogant ecclesiastical/colonial European nationalism. From the Con-gregation of the Propagation of the Faith in 1622 there came a very force-ful condemnation of cultural prejudice: What could be more absurd than to carry France, Spain, or lt~l~,, or any other part of Europe into China? It is not this sort of thing you are to bring but rather the Faith, which does not reject or damage any people's rites and customs provided' they are not depraved . Let customs that prove to be depraved be uprooted more by hints and by silence., gradually without jolting. 14 People like the Capuchin Father Jerom Meroila in the Congo in the sev-enteenth century ~eriously endeavored to follow this advice. ~5 Jesuits in par-ticular, notably de Nobili and Ricci, led the movement for accommoda- Beyond Frontiers / 357 tion and adaptation with a flexibility characteristic of the early Church. 16 Tragically, these efforts to revitalize supranationalism within the Church were crushed with the rejection of the work of Ricci and his companions in the seventeenth and eighteenth centuries. In the late nineteenth century the revival of Thomistic Aristotelianism, which encouraged people to look for what is good and of God within cul-tures, sparked off a new movement that would many decades later lead to the return of the Churcl~'s early pastoral flexibility. Euro-centric prejudice in evangelizers was condemned. 17 At the same time there developed within the Church a vigorous support for the rights of all people in regard to their culture and national identity. ~8 But it would take a long time before the pas-toral implications of these emphases would be worked out. Many evangelizers yearned to revive the apostolic approach of people like Ricci, but multiple factors made it difficult for these dreams to be realized. Thus, for instance, as long as the theQlogy of the local church remained under-developed, it would be difficult to explore fully the pastoral implications of the relationship of evangelization to culture. Terms like "accommoda-tion" or "adaptation" became common in missiology. But theologically and pastorally they connoted not an exchange between the Gospel and cul-tures, but rather a process of.choosing what local value or custom could be used to express better the meaning of the faith. The local faithful, how-ever, were not to be involved in t.his process of choice. So, while the rhetoric favored flexibility, in practice the Church remained fundamentally Euro-centric in its evangelizing aims and methods. Understandably, religious life mirrored this ongoing European empha-sis. 19 This was evident in the rigidity with which Europ.ean forms and struc-tures of religious life were uncritically exposed and planted in other cul-tures. At times local vocations were not encouraged because it was thought the people were "just not ready and mature enough" to undertake the responsibilities of religious life. Moreover, the fact that Europe and America had what was thought to be an endless supply of missionary vocations removed.a good ideal of the urgency to discover what were the practical implications of the phrase "accommodating the faith to local cul-tures~" Religious congregations continued to become dramatically international, but rarely did they become supra-national. At times the internal structuring or method of governing missionary ven~ tures further reinforced the spirit and practice of the European colonialism. For example, some congregations favored the system of attaching mission-ary endeavors directly to particular provinces in Europe and America. Invari-ably, this meant that French missionaries were isolated in one part of a Review for Religious, May--June, 1987 "mission" land, Americans in another, and so on. Hence, a "little France" or a "little America" could exist in Third World countries, with no outside challenge to such assumptions of cultural superiority. In view of all these forces, therefore, it is not surprising that indigenous forms of religious life have rarely developed in the Third World; the mode.Is remain overwhelmingly First World in design.2° Reiigious Life and Supranationalism after Vatican II With Vatican II, and with subsequent reflection, religious life has been challenged to'its very roots by a revitalized theology of evangelization and of the local church. The relationship that should e~ist between the Gospel and cultures has been clarified. Evangelization is to be a "living exchange between the Church and the diverse cultures of people:''2t The Church, which ~s itself a culture, must be prepared, to chahge and develop new insights into how the Gospel is to be preached through a process of exchange and dialogue with the people being evangelized. This exchange process is what is now called inculturation. The expressions accommodation and adaptation do not quite convey this emphasis on exchange. Rather they imply that the Church gives to cul-tures, but does not receive. As historical expressions they were found to be dated; hence, the new word inculturation was developed in order to high-light the importance of exchange.2z Evangelization is not to be directed to the soul alone, but to the person--"whole and entire, body and soul.''23 "What mhtters," declares Paul VI, "is to evangelize man's culture and cultures [not in a purely decorative way, as it were, by applying a thin veneer, but in a vital way, in depth and right to their very roots].''z4 The search for justice in this world is not something secondary to evangelization, but it is a constituent part of the mission of the Church.25 However, as was pointed out above, the Gospel, and therefore evangelization, can never be exclusively identified with this or that culture, or with the pursuit of justice in this world alone. Evangelization must include the "prophetic proclamation of a hereafter, man's profound and definitive calling, in both continuity and discontinuity with the present sit-uation: beyond time and history, beyond the transient reality of this world ¯ . . beyond man himself, whose true destiny is not restricted to his tem-poral aspect but will be revealed in the future life.''26 In brief, evangelization must call people to a life of evangelical supranationalism. These emphases have serious ramifications for the religious who is an evangelizer. The evangelizer's task is to facilitate the dialogue between cul-ture and the Gospel. The religious must prophetically call people to this dialogue first, by the witness of his or her evangelical example, and then, Beyond Frontiers / 359 by the preaching of the Word of God. The dialogue to be aimed at is not merely intellectual. Rather it must be a faith interaction in which people are invited to interior conversion. To quote Paul VI again: "The Church evangelizes when she seeks to convert, solely through ttie divine power of the Message she proclaims, both the personal and collective consciences of people, the activities in which they engage, and the lives and concrete milieus which are theirs."zv Conversion is not brought about through author-itarian dictation, nor is it achieved through various forms of cultural romanticism. The religious, who in his orher zeal for :social justice overidentifies with nationalism or the protest movements of people against oppression cannot prophetically proclaim that "man's profound and definitive calling . . . [is] beyond time and history, beyond the transient reality of this world." Such a religious falls victim to the insidious power of cultural romanticism. Especially in parts of the Third World in which there is so much oppres-sion by the rich over the poor, massive injustices and corruption, the con-cerned religious is severely tempted to fall into a form of romanticism. Paulo Freire, the brilliant South American educator., has warned people to avoid the trap of romanticism. In order to remain objective and helpful to the oppressed, those who would be change-agents must, he says, undergo a profound rebirth. They must rise above the desire to overcome oppressors through the use of the same force that they used to subjugate the poor.28 The evangelizer, too, must at all times maintain the objectivity that is necessary to proclaim the fullness of the Gospel message with its power for salvation. St. Paul reminds us: "It was for liberty that Christ freed us. So stand firm, and do not take on.yourselves the yoke of slavery a second time" (Ga. 5:1). If the temptation in the past was for evangelizers to fall into the trap of Euro-centric cultural evangelization, then today's special temptation is to become slaves for "a second time" through cultural romanticism. Both forms of slavery obstruct our prophetic freedom. Religious specially should commit themselves to fulfill St. Paul's call for Christians to be ambassadors of reconciliation (2 Co 5:20). If religious overidentify with political parties, pressure groups or nationalist move-ments in the name for social justice, they jeopardize their prophetic role as reconcilers in Christ of all peoples--the oppressed and the oppressors. The chance to witness to the transcendent love of the Father for all is in danger. For example, if I as a religious join a political party, I become inevitably cut off in various ways from other sectors of society I seek to evangelize. I cease to be free to act credibly as an ambassador of reconcil-iation between all groups within that society. This fact helps to explain 360 / Review for Religious, May--June, 1987 John Paul II's insistence that politics should normally be left to lay people. In his address to priests in San Salvador (March 6, 1983) he said: "Remem-ber, my dear brothers, that--as I said to the priests and religious in Mexico~you~are hOtsocial directors, political leaders, or officials of a tem-poral power . " Religious are rather to foster among the laity a com-mitment to witness to the Gospel in the secular world as directors, leaders and officials. Though excessive nationalism is much less a temptation to evangelizers in the First World than in the Third, nonetheless these can still easily fall into other forms of cultural romanticism. For example, religious may become so involved in maintenance work in dioceses that they forget their prophetic and innovative role. Or, in their zeal to solve social problems, religious may turn to secular methods and values alone, ignoring or downgrading the supernational importance. We come to the second question: Are religious congregations respond-ing to the challenge given them by the Church today? Only through a process of discernment and reflection can each congre-gation. respond to this question. However, in order to aid this process I will offer two extreme polar models of religious congregations. These models can help religious to measure their own behavior and that of their institutes. It would be rare indeed if any particular congregation perfectly fitte~l either of ,the models described. Models in anthropological analysis are simple, abstract representations of human~' experience and interactions which are often highly complex in real life. Models are constructed~ to he!p under-standing, and to do so they emphasize major themes or characteristics and overlook details. It is up to the reader or researcher to modify, refine-~or even reject--models in light of his or her experience. Model 1: Internationalism/Faint Supranationalism ~ Anthropologists have discovered a type of society that is organized on the basis of segmentation.29 The society is divided up into segments for a variety of reasons, but these segments are not permanently divided, since they are united at other levels to form new and more inclusive segments when certain common needs require this. Total unity is very fragile and, like all levels of unity at any stage in the society, it disintegrates once the reason for the unity disappears. In brief, there are factors within the soci-ety that encourage people to form opposing groups, but there are counterbalancing factors that draw people in these groups together at other levels. Suspicion or potential/actual conflict or feuds divide the segments Beyond Frontiers / 361 Figure 1 Model I. Internationalism/Faint Supranationalism Factors Conducive to Internationalism/Supranationalism Constitutions/Mission Statements: -rhetoric favors supranationalism Commitment to supranationalism: -Weak in congregation Factors Conducive to Provincialism/Segmentation Commitment to provincial boundaries strong: Central Government: General Chapter: -symbol of unity; -rhetoric favors supranationalism General Government: -symbol of unity/internationalism -supplies bureaucratic needs, for example, dispensation --charism research Interprovincial-Regional Cooperation: -weak: last resort Apostolates: -in Third World for vocations/sur-vival. Formation: -international/interprovincial only in extreme need -inward looking vision -prophetic figures marginalized Provincial Government: -commitment to survival of prov-ince as the priority -suspicious of outside "interference," for example, General Government Apostolates: -Identification with diocesan main-tenance works -prophetic role weak -if clerical-religious, clericalism strong -weak involvement in multiculturalism Formation: -poor screening; concern for numbers -no training for multiculturalism/ supranationalism and are put aside only when common needs demand unity for survival. A feud can be defined as relations of mutual animosity among intimate groups in which a resort to violence is anticipated on both sides.3° The violence does not have to be physical; it can be verbal. Past injustices or misunderstandings are recalled to remind all concerned that the "out- 362 / Review for Religious, May--June, 1987 group" simply cannot be trusted to work with the "in-group." There may be an official leader in such a society, but the real power rests in the various segments, the lowest segment having the most power over its members. Oft-repeated rhetoric supportive of total unity is apt to so confuse the observer that it is thought that real unity exists, when, in fact, such is far from being the case. In Model ! of religious congregations that I am proposing the empha-sis is on internationalism, with a faint acceptance of supranationalism. A congregation of this type has the characteristics of the segmentary society or culture just described. In Figure 1, the major qualities of a segmentary congregation have been summarized. The official rhetoric is often power-fully supranationalist, as in general chapter documents or mission state-ments, but the ~-eality just as strongly contradicts this rhetoric. Internationalism exists inasmuch as some members live and work in for-eign lands, such as missionaries and general administrators. There may be a growing interest in the Third World countries inspired by the congrega-tion's rhetoric about the call to be at the service of the poor, but the really operative force would be the desire for vocations to keep the provinces and the congregation alive. The emphasis of recruitment is on numbers, not on the quality of the screening methods or the formation given. The formation remains culturally Euro-centric and paternal; the local cultures and their needs are ignored. Inculturation simply does not exist. Loyalty in the congregation imagined in this model is first and fore-most to the province to which one belongs, not to the congregation or its spirit.Whoever encourages congregational supranationalism would be thought a "traitor" to the province.3~ Cooperation exists between the prov-inces and with the general administration only when it is absolutely nec-essary- and even then fo~: the advantage primarily of the province. The gen-eral administration, for example, would be able to staff congregation-wide projects only through a process of bargaining, not dialogue. A province is prepared to release difficult personnel for such work, but not talented mem-bers, for the province's first obligation is to its own survival. "Talented people simply should not be released for work outside the province" is the overriding assumption. At international meetings of the congregation, pro-vinces look first to their own rights and their interests, not to those of the congregation. Suspicion and feud-like behavior colors the province's rela. tions with the general administration and with other provinces. Stories of past interference and misunderstandings on the part of general officers are gleefully recounted in order to maintain in the province a distrust of "out. siders." Beyond Frontiers" Apostolically, provinces in this model are strong supporters of main-tenance rather than of mission within the dioceses in which they work. A province takes its bearings all too exclusively from the internal ecclesiastical and socioeconomic structure of the countries where its apostolates are situated.32 There is little or no prophetic challenging of dioceses or diocesan administrations. Consequently, there is little room for other issues such as justice or multiculturalism/supranationalism. Individ-uals wh0do show interest are thought to be "somewhat odd," or follow-ing a "hobby," or just "wasting time." On the other hand, where involve-ment in the social apostolate is encouraged, its relationship with the Transcendent may be deliberately played down "lest one's identification with the Gospel hinder one's identification with those who struggle for social justice." In this model clericalism would be a dominant force in clerical insti-tutes. (Clericalism connotes "an authoritarian style of ministerial leader-ship, a rigidly hierarchical world view, and a virtual identification of the holiness and grace of the Church with the clerical state and, thereby, with the cleric himself.''33) Consequently, within community there would be little fraternity with lay members of the congregation who would be looked down upon as inferior and as "servants of the priests." Lay involvement in apostolic works of the congregation would be poorly encouraged. On the other hand, religious who might act against clericalism would overidentify with worldly values and with the customs of the ambient cul-ture on the pretext that this will "bring us closer to the people we are evangelizing." As regards the screening and formation of candidates, the approach in such a congregation would be colored by all the above characteristics. Can-didates would be encouraged to join the province if they are seen to have the qualities that would "fit them in" to the overriding inward-looking, weakly prophetic ethos of the province. Candidates would be jealously iso-lated from contact with those from other provinces lest they develop "dan-gerous ideas," supranationalism, or the feeling of belonging to a "con-gregation wider than the province." Formators of other provinces could not be trusted to direct the formation of candidates because they might decide that the latter have "no vocation to religious life." Hence, interprovincial and international formation programs would be severely discouraged. Model 2. Internationalism/Strong Supranationalism In Figure 2, I set out emphases that are seen in congregations which approximate the second model, Internationalism/Strong Supranationalism. 364 / Review for Religious, May--June, 1987 The members of such a religious congregation commit themselves primar-ily to the mission of Christ and the Church according to the insights of the founding figure. Administrative structures such as provinces exist to facil-itate the response of the congregation itself to the mission of Christ. The spiritual and human welfare of members of the congregation is considered of paramount imporiance. The congregation's administrators are alive to the ctiallenge given them by Paul VI that they take up the "double task of inspiring and innovating in order to make structures evolve, so as to adapt them to the real needs" of mission and personnel.34'Provinces relate to one another and to the general administration on the basis of their common mission and according to subsidiar{ty, dialogue and discernment. Apostolates are selected according to definite objective criteria: the pri-ority of needs in the universal Church and local churches, the mission of the Church, the charism of the congregation and the resources available. The congregation hesitates to accept parishes unless there is scope for mis-sionary and creative pastoral action. No matter what apostolate is selected, members of~ the congregation will attitudinally be influenced in all they do by the need to call the People of God to multiculturalism/supranationalism. Given the priority of needs internationally today, congregations may strive, where possib!e, to witness to supranationalism by establishing international teams. For these teams to be effective they need to fulfill various require-ments. Firstly, those selected must be capable of living internationally according to the principles of supranationalism. Not everyone has the abil-ity to live and work on an international team; there can be heavy d6mands on the psychological and spiritual resources of individuals as they are called to face up to the requirements of constant adaptation to new cultural con-ditions. Secondly, members of teams must be given the chance for adequate preparation spiritually and humanly in order that they can fit into challeng-ing international and intercultural situations. This means not only the acquisi-tion of linguistic skills, but also an awareness of key anthropological insights into the nature and power of culture, culture change, the role of catalysts in culture change, and so forth. In their training programs mem-bers will need to have adequate periods of living in cultures very different from their own. They will need to experience the shock of being "at sea" in a culture that is unfamiliar to them; they will need to discover for them-selves the richness of being humble and dependent on other people whose culture they do not know or understand. Their own cultural biases and preju-dices must be challenged, otherwise an insidious ethnocentrism will govern their relations with other team members and the peoplethey hope to serve Beyond Frontiers / 365 Figure 2 Model 2. Internationalism/Strong Supranationalism Loyalty: primarily to the Congregation which is at the service of the mission of Christ and Church. Apostolates: based on -priority of needs in universal Church (internationalism/supranationalism) and local churches (multiculturalism). -charism of congregation -available resources Administration: -at service of mission -provinces and general administration relate on basis of common mission/subsidiarity/ dialogue-discernment Formation: Initial: On _going. -based on mission/charism -emphasis on union with Christ for cre-ative response to demands of change. -training for internationalism/ multiculturalism/supr-anationalism -revitalization of commitment to: -Christ -Congregation -creativity/adapability in change pastorally. Thirdly, in the structuring of an international team, as far as is possi-ble no one culture should predominate. If one cultural group does predom-inate, it is likely to over-influence attitudes and policies of the group.35 If a culturally balanced team is not possible, the predominant cultural group must be especially sensitive to avoid obstructing the emergence of 366 / Review for Religious, May-~June, 1987 supranationalism in the team. From history, such international teams as I have described are apt to foster vigorous creativity pastorally and in religious life. As Raymond Hostie notes: Basic to all institutions that became remarkable for their explosive expan-sion is an initial heterogeneous core. Cistercians, Norbertines, Dominicans, Carmelites, Jesuits and Piarists, all emerged from groups whose members belonged to three nationalities, or even four or five. The initial group of Franciscans, CamillianS, Brothers of the Christian Schools and the Salesians was composed of men of very disparate social rank and cultural level. Heterogeneity is a necessary condition for activating effective fermentation.36 Initial formation in Model 2 is dictated by the demands of mission and the charism of the congregation. Hence, the programs are structured to foster in candidates a spirit of adaptability to constant change.37 Spiritual formation will be aimed at uncovering within candidates their own inner poverty and their ongoing need of strength from Christ: "He who loves his life loses it, and he who hates his life in this world will keep it for eter-nal life" (Jn 12:25). The process of initial formation is a delicate one requir-ing skilled people to accompany candidates through the journey of self-discovery. Though the formation program is spread over several years and may well involve experiences in different cultural situations, there will be formators to whom candidates are clearly accountabl~. In Model 2, forma-tion is not a haphazard arrangement. As with initial formation, the ongoing formation programs are structured on the basis of the needs of mission. Religious need oppor-tunities to revitalize their commitment to Christ and to their congregational charism. They need space to reflect on whether or not their commitment to multiculturalism/supranationalism is rhetoric or reality. Over time, reli-gious may have uncritically absorbed negative values from the culture in which they work; little by little their supranationalism and pastoral creativ-ity may have been undermined. In this model it is assumed that adminis-trative structures are so flexible that superiors are able to spot quickly the individual needs of evangelizers and offer appropriate assistance. This ser-vice to evangelizers is part of a much wider task of administrations, namely, the ongoing need to foster evaluation of the apostolic relevance and effectiveness of the teams. In this model apostolates aie hot permitted~ to drift without goals and without effective evaluations. Conversion to Supranationalism In J.R. Toikien's The Hobbit: Or There and Back Again, Bilbo Beyond Frontiers / 367 Baggins initially turns down an invitation to go on a journey. He is too com-f0rtable in his way of life to be bothered with the trials of an adventure. He finally accepts the challenge and even begins to enjoy it. The cultures and the people he meets both disturb and intrigue him. But he soon tires of the constant need to adapt to new challenges, so he turns for home and retreats from the world of adventure singing:."Feet that wandering have gone, Turn at last'to home afar. Eyes . . . Look at last on meadows green.-38 Most of us can identify with Bilbo. We commit ourselves to multiculturalism/supranationalism, that is to the preaching of God's love across the frontiers of cultures. Yet we are tempted at times to weaken our efforts, to seek the security of our own cultures and our prejudices. Inevitably we will give way to these temptations, thus losing our apostolic effectiveness, if we seek to rely on merely human motivation. There is needed that inner, ongoing conversion that comes~from being a new creation in Christ (2 Co 5:17). Only in the ongo.ing response.to this new life will we have the inner resources to become "all things to all men" (1 Co 9:22). The divine love within us gives us the evangelical muscle to keep struggling to be open to other p~oples "~nd their cultures: "Love is patient; love is kind. Love is not jealous, it does not l~ut on airs, it is not snobbish . There is no limit to love's forbearance, to its trust, its hope, its power to endure" (! Co 13:4,6). St. Paul uses the analogy of a runner when he explains the process of ongoing conversion. To stop runn.ing for the Lord is to fall back into purely human insights and comforts (1 Co 9:24-27). Constant discipline 6f the whole person is required: "Athletes deny themselves all sorts of things: . . . What I do is discipline my own body and master it; for fear that after having preached to others I myself ~.hould be rejected" (ibid). The discipline of conversion also involves the Struggle .to identify one's own cultural prejudices, and the battle to remove them. It is a never-ending struggle and battle! I recall a fine evangelizer working outside his culture-of-origin commenting: '~I th6.ught for years I was not prejudiced. I believedI deeply loved these people. One day ! discovered that I was highly prejudiced and this shocked me intense]y. I could get no good ser-vice in the local shops, the car was slow to be fixed, letters were not reach-ing me fast enough, the food tasted horrible! I found myself complaining aloud about the people, and I used all the stereotypes about them that I had thought I had long rejected: 'These silly people--they are lazy, deceitful. If only I was back home where things are really done rightly!' " This evangelizer is an honest person. He courageously recognized' his prejudices as grave obstacles to his supranational work of evangelization, and courageously struggled to remove them. He understands that self- 361~ /Review for Religious, May--June, 1987 discipline must be ongoing. When Yahweh called Abraham, he summoned him to leave the warmth of his familiar surroundings to begin a life's journey: "Go forth from the land of your kinsfolk and from your father's house to a land that I will show you" (Gn 12:1). R(ligious are to live out the same kind of call in a' spirit of faith. Bilbo, when he started out on his journey, sang "The world is ahead and home behind," but finally rejoiced when he could sing "The world is behind and home ahead." For we religious, unlike Bilbo, the ~hailenges of the world ahead are always with us; we can never say that we run out6f apostoli.c challenges or adventures. And our home is also ahead of u~. We await in hope for the ne, w Jerusalerrl (Ga 4:26). We can resist making this world our substitute Jerusalem only if we have Abraham's spirit of detachment and faith. Detachment comes from discov-ering in oneself one's own chaotic powerlessness to be supranationalist with-oiat the love and power of Christ. If we recognize our own inner helplessness, then we can say with'St. Paul: "And' so I willingly boast of my weaknesses instead, that the power of Christ may rest upon me . . . for when I am powerless, it is then that I am strong" (2 Co 12:9f.). Summary With St. Paul we say: "I do not run like a man who loses sight of the finish line" (1 Co 9:26). The ultimate finish line, in which there will be perfect justice and love, is to.be found when "the new heavens and the new earth" emerge at the end of time (2 P 3: I'3). In this waiting time we strive in faith to express this justice and love towards different peoples and cultures: "There does not exist among you Jew or Greek, slave or freeman, male or female. All, are one in Christ Jesus" (Ga 3:28). Religious esl~ecially commit themselves to this vision and its realiza-tion. In their lives and preachiflg they call people to look beyond this or that pressure group, political party, cultural group, tO the needs and insights of other people and cultures.39 At the same time they challenge people to avoid an unrealistic and ~i'~ous search for ~ perfect world here below, "for the world as we know it° is passing away" (I Co 7:31). Religious,. when confronted by the enormity of evil around them will be tempted to discouragement, skepticism or even the recklessness of despair. They will bc tempted to retreat into the security of their cultural prejudices and feel-ings of superiority. Recourse to merely human power, even violence, in order to achieve human justice may look very attractive. However, the moment a religious gives way to these temptations, he or she ceases to be apostolically supranationalist --indeed, apostolically effective. Beyond Frontiers I 369 NOTES ~ See John Paul II, Redemptor Hominis, 1979, par. 8. z See On Mutual Relations between Bishops and Religious, Congregations for Religious and Bishops, Rome, 1978, par. 12. 3 G. AIIport, The Nature of Prejudice (New York: Doubleday, 1958), p. 8. 4 See also D.L. Shields, Growing Beyond Prejudices (Mystic, Conn.: Twenty-Third Publications, 1986), pp. 149-176. 5 At times anthropologists, too, are guilty of romanticism. See G.E. Marcus and M.M. Fischer, Anthropology as Cultural Critique: An Experimental Moment in the Human Sciences (Chicago: Chicago University Press, 1986), passim. 6 Dictionary of the Bible (London: Geoffrey Chapman, 1986), p. 766. 7 See Congregation for Doctrine of the Faith, "Instruction on Christian Freedom and Liberation" in L'Osservatore Romano, 14 April, 1986, p. 5, par. 58. 8 See Lumen Gentium, par. 3. 9 Gaudium et Spes, par. 3. ~0 See G.A. Arbuckle, "lnculturation and Evangelization: Realism or Romanticism" in D.L. Whiteman (ed.), Missionaries, Anthropologists and Cultural Change (Williamsburg: Studies in Third World Societies, 1985), pp. 171-207. ~ See "Gregory's Counsel to Mellitus with Regard to the Heathen Temples in England" in A.J. Mason (ed.), The Mission of St. Augustine to England (Cambridge: CUP, 1879), pp. 89ff. t2 G. Voss, "Missionary Accommodation" in Missionary Academic Study No. 2 (New York: P. Faith, 1946), p. 17. ~3 See P. Duignan, "Early Jesuit Missionaries: A Suggestion for Further Study," in American Anthropologist, Vol. 6, pp. 725ff. 14 See S. Congregation for the Propagation of the Faith, "Instructio ad Vicariorum Apostolicorum ad Regna Synarum Tonchini et Cocinnae Proficiscentium," in Collectanea Sacrae Congregationis de P. Fide (Rome, 1907), Vol. I, p. 42. ~5 See M.D. Jeffreys, "Some Rules of Directed Culture Change under Roman Catho-licism" in American Anthropologist, Vol. 58, 1956, pp. 723f. ~6 See C.W. Allan, Jesuits at the Court of Peking (Arlington: University Publications of America, 1975), passim; and P. Duignan, op. cit., pp; 726ff. t7 See Pius XII, "Princeps Pastorum" in (ed.)R. Hickey, Modern Missionary Doc-uments and Africa (Dublin: Dominican Publications, 1982), p. 143. ~8 See Pius XII, AIIocution 6 Dec. 1953, in Acta

Issue 49.6 of the Review for Religious, November/December 1990. ; Liberation and thel~iturgical Year How to Read St. John of the Cross Lasting Friends Volume 49 Number 6 November/December 1990 REVIEW I:oa REL~GIOUS (ISSN 0034-639X) is published bi-monthly at St. Louis University by the Mis-souri Province Educational Institute of the Society of Jesus: Editorial Office: 3601 Lindell Blvd., Rm. 428; St. Louis, MO 63108-3393. Second-class postage paid at St. Louis MO. Single copies $3.50. Subscriptions: United States $15.00 for one year; $28.00 for two years. Other countries: US $20.00 for one year; if airmail, US $35.00 per year. For subscription orders or change of address, write: REVIEW FOR RELIGOUS; P,O. BOX 6070: Duluth, MN 55806. POSTMASTER: Send address changes to REVIEW FOR RELIGIOUS; P.O. Box 6070; Duluth, MN 55806. ©1990 REVIEW yon RELIGIO~S. David L. Fleming, S.J. Philip C. Fischer, S.J. Elizabeth McDonough, O.P. Jean Read Mary Ann Foppe Editor Associate Editor Canonical Counsel Editor Assistant Editors David J. Hassel, S.J. Iris Ann Ledden, S.S.N.D. Wendy Wright, Ph.D. Advisory Board Mary Margaret Johanning, S.S.N.D. Sean Sammon, F.M.S. Suzanne Zuercher, O.S.B. November/December 1990 Volume 49 Number 6 Manuscripts, books for review and correspondence with the editor should be sent to REVIEW FOR RELIGIOUS; 3601 Lindell Blvd.; St. Louis, MO 63108-3393. Correspondence about the department "Canonical Counsel" should be addressed to Eliza-beth McDonough, O.P.; 5001 Eastern Avenue; P.O. Box 29260; Washington, D.C. 20017. Back issues and reprints should be ordered from REVIEW roR RELIGIOUS; 3601 Lindell Blvd.; St. Louis, MO 63108-3393. "Out of print" issues are available from University Microfilms International; 300 N. Zeeb Rd.; Ann Arbor, M! 48106. A major portion of each issue is also available oft cassette recordings as a service for the visu-ally Impaired. Write to the Xavier Society for the Blind; 154 East 23rd Street; New York, NY 10010. PRISMS. As we come to the end of another calendar year, we also find our-selves bridging the end and beginning of our Christian liturgical year. November is like a summary or review month--a past looking towards a future. It always begins with the two days commemorating all the saints and then all the faithful departed; it closes with a Sunday celebration of the eschatological feast of Christ the King. With Advent and with the Christmas season, we listen and we look--listening anew to the words of biblical prophets and looking upon the Word become flesh. Perhaps we better describe it as a future looking to the present. The divine call of hope coming through the prophets and being enfleshed in Jesus touches the human heart. It rouses the deepest of hu-man desires--to experience oneself as free in a world which is free and to experience peace within oneself and peace without. Most of the arti-cles in this issue involve a looking back and a looking ahead. At the same time, they also touch the present--with our experience of peace in its vari-ous forms, and with our experience of freedom. The articles by Kennington, Rich, van Breemen, and Kerr take up various implications of what has been identified as liberation theology. The origins of liberation theology are found in the so-called Third World countries, particularly in theological writers of South America. More broadly used in the Church, this theology has become a studied way of understanding, articulating, and living out our Christian faith so that we may affect situations and policies which tend to breed injustice and un-freedom. Liberation theology can sometimes seem to condone or even advocate some kind of violence. But no theology can merit the name Christian which is not permeated with a peace which only God can give. Liberation ~theology, especially when viewed in its spirituality, is most of all a theology of the kind of peace sung about by the angels on that first Christmas night. Perhaps one or other of these articles will be a kind of Bethlehem star for us, leading us to a place of greater freedom and peace, either within ourselves or without. Of special interest to a number of our readers are certain upcoming anniversaries. With the feast of St. John of the Cross celebrated in De-cember, there begins the 400th anniversary of the death of this great mys-tic, 1591-1991. Steven Payne, O.C.D., editbr of the Carmelite journal 1101 Review for Religious, November-December 1990 Spiritual Life, provides us with some contemporary approaches to John's spiritual doctrine. Thomas Moore, O.C.D.S., tries to provide us with some basic directions to enter more profitably into the rich teaching of John. In celebration of another anniversary, our January/February 1991 is-sue will be unique in its focused selection of Ignatian spirituality arti-cles and book reviews. The year 1991 marks the 50th volume of REVIEW FOR RELiGiOUS, and the first issue of this volume will honor the Ignatian spirituality tradition, which is celebrating the combined anniversaries of 450 years since the founding of the Society of Jesus and 500 years since the birth of St. Ignatius Loyola. As we close out the first half century of this publication with this is-sue, the staff of REVtEW FOR RELmtOUS wishes all of our readers a Christ-mastide full of the blessings of peace and of freedom. David L. Fleming, S.J. Bethlehem Star: Spiritual Direction in Social Action Ministries Paddy Kennington Paddy Kennington is presently teaching literacy education in shelters for homeless people in Raleigh, North Carolina. With her master's degree in counseling and psy-chology and a graduate certificate in spiritual direction from Washington Theologi-cal Union, she also serves as an area formation director for the Third Order, Society of St. Francis, Episcopal Church. Her address is 2404-1C Bradford Dr.; Wilson, North Carolina 27893. Spiritual direction training and spiritual directors can become part of the praxis of social ministries. If the goals and purposes of social ministries are restricted to serving food, providing shelter, and legislative advo-cacy, worthy as those activities are, then God's wider plan of transform-ing grace and unity may never happen. The learning accumulated in spiri-tual direction training and experience can be part of the organization and spirituality of a social ministryin the Church. A graced life is not a pri-vate life. We are meant to become "breach menders and restorers of ru-ined houses" (Is 58: 12). One way to rethink thb relationship betWeen spiritual direction and social ministry as spirituality in action is to 'draw parallels between the two in the context of the concrete experiences of volunteers and street persons in a soup kitchen. This seems to me to be one method to dem-onstrate the thesis that spiritual direction has a role in social ministry. The Center for Spirituality and Justice in New York City has investigated the necessity to include an awareness of social consciousness as part of the spiritual direction relationship, t The reciprocity between spiritual di-rection skills and principles and social action is equally important in the daily hands-on ministries of shelters, clothing banks, and soup kitchens. 803 Review for Religious, November-December 1990 Two stories of volunteers and street people illustrate the need to include spiritual direction with social action. The Soup Kitchen Antonio In early 1983, four of us from the Social Apostolate soup kitchen in Savannah, Georgia, organized an emergency winter night shelter. The next year, we added an evening soup kitchen and health care. Eventu-ally, I became the first director. 1 met many men and women like Anto-nio who appeared one fall evening in our soup line. He was wearing an over-sized woman's coat. Antonio's suitcase had remained on the bus that left him while he was looking for food. What funds Antonio had in his pockets had vanished quickly into slippery street fingers. After visiting the health-care clinic in our building, we discovered Antonio was thoroughly infested with lice. We also realized he had a men-tal disability and with his friendly, innocent manner, was not able to cope with the violence of street life. Antonio arrived in town in time for the opening of our winter shelter. Luckily, we were able to get him off the street each night. After a few days, the local Catholic Worker became Antonio's tem-porary home. He was an outgoing person and tried to fit in with our com-munity at the soup kitchen and with the Catholic Worker family. Anto-nio wanted to work and contribute to his keep. But his attempts at typ-ing for us and for the health-care nurses were disastrous. One of the nurses convinced him to write to his family in New Jersey. We began to get frantic phone calls from them, and were able to persuade his fa-ther not to get on the first plane to rescue Antonio. One winter evening as the volunteers were converting the hall from soup kitchen to night shelter, Antonio and I sat next to the front door while we waited to take the names of that night's guests. He turned to me and with his eyes averted as usual, asked, "Paddy, what's this place really all about?" I thought a moment and then said, "It's like a bus station, Antonio. People get off the bus, out of the streets, for a little while. They stay with us until they get back on the bus and move on." He turned that over in his mind and said, "Yeah, that's right. That's what I did. I'm staying here and then I'll move on, too." Antonio did leave eventually but not before he had struggled with his reasons for suddenly running away from his home in New Jersey. I think he struck out on his own because he wanted to know if he could take care of himself. Antonio's parents were overly protective and his Spiritual Direction in Social Action Ministries / 805 brother pushed him hard to excel beyond his handicap. On the other hand, his disability did not keep Antonio from searching, questioning, and striving for what he believed to be his freedom. His questions and sense of independence may have taken a different expression from yours or mine. But the restless heart of St. Augustine was the same for Anto-nio as it is for all of us. In the spring while the azaleas and dogwoods were blooming, Anto-nio returned to his home and family. In the last letter we received from him, he told us about the computer course he was taking. One afternoon the following fall, a care-package of used jeans and winter shirts from Antonio arrived at the shelter. He had not forgotten those still on the bus. St. Teresa discovered after experiencing the prayer of union, that the Lord had been waiting many years for her "yes" to the Creator's gift of spiritual treasures and blessings.2 In his desire to d~cide the course of his own life, Antonio had said yes and gone out to find the courage to make his dream of freedom and independence come true. Bonnie I am always amazed at the intensity of emotion sometimes shown by volunteers toward the poor and street people. Initially, most soup kitchen volunteers are hesitant and even afraid. Few are prepared for the reality of human degradation, begging, and manipulation one is exposed to as part of the daily routine of providing minimal food to hundreds of hungry men, women, and children. Some turn away in tears or disgust; others are drawn to their fellow human beings through compassion, like moths to a flame. But sooner or later if they don't walk away, the inevi-table questions will arise. How can they live like this? Why doesn't the city do something? Where will they sleep tonight? They are all so sad; doesn't this get to you after awhile? Bonnie was a kind, loving woman from one of the many church groups that volunteer on a regular basis one evening each month. I had noticed Bonnie on her firsf day of volunteering while she was serving sandwiches. During her next few evenings in the serving line, she was withdrawn and reluctant to interact with the guests, as though she would rather be in the kitchen. Bonnie avoided any friendly contact except to plop a sandwich on a waiting plate. I had hoped for an opportunity to speak to Bonnie privately during the cleanup routine. "Well, how was it in the serving line tonight, Bon-nie?" I asked as dishes and pots were being scrubbed. She looked down at her feet and said anxiously, "Seeing all those men eating here really bothers me. My husband and I work hard for what Review for Religious, November-December 1990 we have. Why can't they get a job? Why am I expected to take care of them with my hard-earned tax money?" Clearly, Bonnie was torn emotionally between the teachings of Je-sus on love and charity she had heard all her life, and her present feel-ings of indignation, anger, and disgust. And the ~onflict inside showed on her face. This was not a time for reminders that we are to pray for God's forgiveness and strive for empathy for others. At that moment, what Bonnie needed was understanding and peace. I knew she could not yet be aware that coming to resolution about her feelings and attitude to-ward the soup kitchen guests meant that she herself would become the broken bread offered by Christ on the cross. Bonnie was too full of bit-terness and frustration. "I'd like you to meet one of our guests sometime, Bonnie," I said to her gently. "He's quite a character. And I hope you'll give us and yourself a second chance before you make up your mind about soup kitch-ens and street people." "I don't think I'll be back," Bonnie said. 'I just can't stand seeing all those lazy men ripping us all off, when they could be working and taking care of themselves." Her face was lined with anger and she pushed the broom even harder on the dining hall floor. I shared a few words of comfort but I did not push her to commit to another volunteer shift. Bonnie needed time to sort out her feelings. About two months later, I saw Bonnie walk in the front door with her church group. She still had a look of hostility and reluctance. I was afraid that if she could not get beyond her anger, she might lash out at one of the guests, or cause them to react to her in a negative way. "I'm glad you came back, Bonnie," I said. "Maybe you'd rather work in the kitchen instead of the soup line today." "No," Bonnie replied grimly. "I'm going to try the serving line one more time." "Maybe you'll get to meet Jim later," I suggested. "We'll see," she said. I was busy that suppertime and didn't get back to Bonnie until the end of the serving. I had Jim by the hand when we approached her. "Jim, I want you to meet Bonnie,'" I introduced them. Jim smiled a semi-toothless grin and shoved his hand toward Bonnie for a friendly shake. She shook his hand. I wondered what it took from her to give that little inch. "Jim is a regular here, Bonnie. He's been with us a long time," I explained. "Jim is one of the first guests we were able to help get off Spiritual Direction in Social Action Ministries / il07 the streets. Now he helps out with cleanup and carrying in heavy food boxes." I backed out of the conversation as Jim was bending Bonnie's ear about his latest fishing exploits. Later Bonnie found me in the laundry room. "Jim's a real charac-ter and I realize why you brought him over to me," she said. "I haven't changed my mind about the rest of the men. But I do see that there may be more to the soup kitchen and the guests than I've been willing to admit," Bonnie confided. "I guess I need some time here to figure it all out." "All of us had to begin somewhere, Bonnie," I replied. "Maybe a place to start is thinking of the guests, volunteers, even the food--the whole soup kitchen--as sharing God's love. I would be glad to listen any-time you want to talk through your frustrations," I said encouragingly. We exchanged a hug. Bonnie gave me a big grin when she left with her friends. As a shelter and soup kitchen director, I found I needed to be teacher, counselor, community organizer, and peacemaker. But there was also a greater need than crisis intervention and social work referral for housing and health care. In the context of providing meals and shel-ter in a church social ministry, people were drawn closer together. They were forced to interact, ask questions, and struggle with conflicting emo-tions and injustices. I saw the need for a guide who had been exposed to the tradition and teachings of spiritual directipn. One who has lived enough of his or her own spiritual journey to be able to recognize oth-ers' struggles and to offer spiritual leadership beyond cooking, cleaning, and begging would be a good job description. Spiritual Development and Social Ministry Antonio, Bonnie, and many others in the soup kitchen have shown me that there is a lot more to hands-on church social ministries than giv-ing out sandwiches, collecting clothes, and providing shelter. I had scarcely been at St. Luke's soup kitchen (Atlanta, Georgia) two months before I realized that volunteers' needs were as critical as those of street people. Having worked with a large number of soup kitchen participants in the last eleven years, ! have seen that they often progress through spiri-tual growth stages. These stages generally correspond to the spiritual de-velopment outlined in the writings of such spiritual masters as St.-Ter-esa of Avila, St. Ignatius, St. Augustine, Thomas Greene, and Bernard Lonergan to name a few. 1. Awakening:3 Soup kitchen volunteers and guests are spiritual seek-ers in much the same way as directees are in spiritual direction. The soup Review for Religious, November-December 1990 kitchen director must establish an atmosphere which nurtures the possi-bility that all participants might be seeking spiritual growth along with advocacy, washing dirty dishes, and consuming numerous cups of sugar-filled coffee. Often the food sought and given is as much spiritual as physi-cal. The social ministry as a community needs to encourage the devel-opment of relationships as brothers and sisters rather than helpers and de-pendents. The Holy Spirit prods us all and no less so in the serving line of a soup kitchen. One of the most frequent comments from new soup kitchen volun-teers is one of surprise. They cannot wait to tell me, "I never knew it would be like this." The new volunteers sometime become so enthusi-astic they want to solve all the social ills and problems at one time. In their hurry to do something, they fail to let the totality of the soup kitchen experience filter into their inner depths. The impact of the similarity be-tween their own lives, hopes, and desires and those of the street people may elude them. Street people would seem to come to a soup kitchen because they need to eat, get out of the rain, or read the newspaper for a job. All of these reasons are usually true. But many also come from spiritual and psychological hunger. They need to be affirmed as human beings. They want friendship and to know that someone cares about them in the midst of their loneliness and alienation. And like everyone else, they have dif-ficulty in asking for what they want. Anger, manipulation, begging, pro-crastination, and even lethargy can mask a more basic plea for the love and compassion that cannot be found on the hostile streets. Casting volunteers and guests as mutual seekers of God's love helps to lessen the artificial line between dependent and provider. However, raising the awareness of both that each has gifts to offer the other may carry some risk. Life in'the streets dictates survival at all costs and is a set of learned behaviors. This might mean guests are immersed in the violence of poverty and substance abuse. Emotional problems, poor so-cialization skills, and mental illness are magnified by the stress of not knowing where the next meal or bed for the night will be found. Volunteers may come to a soup kitchen to play out an unhealthy need to dominate. They may see themselves as rescuer or savior. Volunteers can even burden already embtionally drained street people with their own consuming need for acceptance and love masked by acts of charity. These are reasons enough for soup kitchen managers and volunteers to have some training in lay qgunseling and spiritual direction. Meager funds for supplies and staffing and lack of housing, jobs, and Spiritual Direction in Social Action Ministries services may force participants into a negative emotional drain and the constant crisis of problem-solving. The stereotypes of despair and dis-ease of social distance can be lifted from guests and volunteers. Despite a naive or discouraging beginning, guests and volunteers can progress beyond the initial stage of being locked into a give-and-take, us-versus-them, relationship. The community's life depends on its ability to jug-gle logistical and physical demands with emotional, psychological ones. An awakening to the spiritual life of the soup kitchen for both volunteers and guests is enabled by the continual return to the wellspring of hope, the Holy Spirit. 2. A Hard Look: After the introductory experience, the volunteer usu-ally begins to ask, why? Why are so many people living on the street? Why are the mentally ill and sick not hospitalized? Why am I expected to take care of the lazy? And then, why am I going home to comfort when these people have so little? Why does not somebody do something? This may create conflicted feelings for those who see themselves as car-ing, religious people. The good intentions of even the most dedicated vol-unteer can fade into frustration and resentment. But in spite of these dif-ficulties, questioning becomes the seed of opportunity to widen one's ho-rizons and allow a graced transformation. If questions arise and expectations are challenged for volunteers, they are doubly so for guests. Even the most dejected and apathetic of the poor hold their dignity and self-worth as a jewel more valuable than food or shelter. A bowl of soup or a sandwich firmly thrust back to a surprised volunteer will attest to a guest's rejection of real or imagined insensitivity. While many long-term street residents have given up ques-tioning injustices or reasons for their meager living, just as many will talk for as long as anyone will listen to a recollection of past slights, in-dignities, or woes. We all need to tell our stories. And once in awhile, some thought-provoking wisdom and insights can be the reward of the patiently attentive volunteer. The volunteer's emotional struggle with the realities of soup kitchen and street people can be everything from threatening to enlightening. Con-fronted with painful feelings, the need for empathy with guests, respon-sibility, and sometimes guilt, some soup kitchen volunteers turn away. They seek other ways to express an option for the poor. Others find ex-cuses to reject the homeless. They blame the victim. Barriers may be erected; barriers of power disguised as benevolent decision-making and anger as righteous indignation. Still other volunteers begin to realize the humanity and humility they share with all peopl+ as children of God. The Review for Religious, November-December 1990 same compassion that emerges from questioning and consciousness-raising impels these volunteers to seek a deeper understanding and ex-perience of the wounded Christ-of-the-streets. 3. Judging--the Bottom Line: Volunteers who persevere join the regu-lars in the social ministry community. They adopt a favorite job or rou-tine of doing the various daily tasks. They come to accept the dilemma of soup kitchens and street life as having no comfortable answers nor neat solutions. Success becomes enough soup or sandwiches for a day's meal, finding eyeglasses for a guest who needs them for work, or locat-ing temporary housing for a young family with children. Old hands be-come well acquainted with the idiosyncrasies of particular guests. Friend-ships develop. New, bewildered guests are shepherded through the soup kitchen routine which has over time become the bricks-and-mortar of daily operation. Success in social change is also expected. Volunteers point with pride to street people who attain middle-class goals: jobs, apartments, sobriety, and normalcy. Experienced volunteers begin to draw parallels with some of Jesus' teachings and parables: the Good Shepherd, those who are last will be first, and workers paid equally for differing times of service. More enthusiastic volunteers may take on the task of main-taining the organization with fund-raising and building renovation proj-ects. The disparity between the homeless people who remain jobless, clothed in rags, and in need of food and shelter and coworkers and fam-ily who enjoy a more comfortable lifestyle is less a focus than getting the job done. Many of the poor who have lived on and off the streets are way ahead of new volunteers in a spirituality of detachment and interior search-ing. Destitute and lacking the basic necessities of food and shelter, they. are forced to fall back on inner resources. Some street survivors exhibit an inner depth of understanding and resilient wisdom of Jesus as Libera-tor. They reflect an unshakable faith and contemplative spirituality. I sometimes wish I could be as in touch with my dark side as they seem to be. However just as often, incredible stress, fear of violence, and physi-cal and mental deprivation block the development of these means to over-come depression and despair. The rhythm of daily life of the soup kitchen community rises and falls with the extreme heat of summer, winter cold, Friday paydays, and surplus holiday charity. Volunteers and guests come and go. When guests do not meet expectations of a middle-class work-ethic or a period of sobriety or mental stability ends, volunteers may become discouraged Spiritual Direction in Social Action Ministries and leave to find greener pastures and better shepherds. But the very rest-lessness that seems to hinder an inner, spiritual examination is also an invitation to challenge preconceived ideas of what is success in a social ministry. The soup kitchen and night shelter offer daily opportunities to let go of cultural or popular false standards of guests' worthiness. 4. Light from Darkness: Volunteers who get beyond the questioning stage and embrace the compunction that follows a realization of their so-cial and inner blindness witness to an enlightened conversion. Their pri-orities change. They begin to view themselves, their families and friends, churches and institutions, and most of all, the guests, with changed hearts and minds. Ragged clothes, disagreeable behaviors, and unwashed bodies fade from importance. Guests are no longer bums and derelicts but James, Mary, and Charlie. "I've been given so much more than I could ever give" is the comment most often heard. This social conversion is possible because participants have experi-enced nurturing community with other volunteers and guests. They have shared in the applied collective wisdom of spiritual guides and masters conveyed by effective social ministry managers and leaders. The soup kitchen manager/spiritual director must focus on community building that encourages everyone processing through the four steps of spiritual growth. After facing the disheartening reality of streetlife poverty and violence, volunteers and guests come to realize through the attentive di-rection of experienced ministry leaders that their only meaningful re-sponse must be one of being as well as doing. Social ministry teachers can model a definition of being that elimi-nates the artificial yardsticks that manipulate and shape people's lives in ways our Creator never intended. Being comes to mean accepting the brother or sister, volunteer or guest, who chooses self-defeat or an un-sympathetic and often critical, closed mind. And most of all, being means seeking the Psalmist's humble and contrite heart in the midst of rejection and the temptation to put distance between self and other. A simple illustration is the end piece from a loaf of bread. Uniniti-ated volunteers might toss the heel into the trash without a second thought. Seasoned veterans however, make use of every scrap by turn-ing the heel outward. They remember lean days of not enough bread for the many sandwiches needed. They have seen men, women, and even children go hungry. Not only are they grateful for our daily bread but they appreciate their own helplessness in the face of grinding poverty and suffering. These volunteers have come to see God face-to-face in the eyes of the poor. Every gift of Creation has become precious to them. Review for Religious, November-December 1990 This is only one of many daily lessons the soup kitchen community can teach and the conscientious director can encourage. Success in the soup kitchen is God's gift to define and to give. Bib-lical personhood and scriptural freedom empower a realization of our need to be vulnerable to each other. We bring all we are, past and pres-ent, to the soup kitchen serving line. Through our relationships, our hearts are stirred to question and search our inner selves and to reach out to our neighbors as to God.4 After finally co.ming to understand and em-l~ race Jesus' meaning of Go.spel poverty, the point of conversion for the social ministry activist becomes the same as the contemplative/directee: the unitive experience. Antonio and Bonnie taught me through their searching and struggle that social ministry can be as much a place of spiritual seeking and guid-ance as my experience of spiritual direction. I saw that people in soup kitchens and shelters were asking for what spiritual direction had to of-fer. God's love for us and desire to be with us through the gift of Son and Spirit is the eternal constant. Our task as both spiritual directors and spiritual guides in social ministries is to be willing to struggle for con-tinued openness and vulnerability to that gift brought to us by guests and volunteers. Soup Kitchen Managers and Spiritual Directors The previous illustrations invite practical ways to integrate action and contemplation, the personal and the social, in soup kitchens and spiri-tual direction. The work of both soup kitchen manager and spiritual di-rector is a good example of the interconnection of spirituality and spiri-tual direction with social ministry. Volunteers and street people usually do not ask for spiritual direction from soup kitchen managers. And di-rectees do not often associate social ministry with their prayer life un-less encouraged to do so by their spiritual directors. But hunger of the heart and searching for God's love and guidance pervade both environ- I am suggesting that soup kitchen managers and spiritual directors must examine the opposite side of their area of expertise to lead to a more balanced ministry and to be more open to God's promise for justice and mercy. However, social ministry managers need not become spiritual di-rectors nor directors, soup kitchen managers. The interactions between a soup kitchen manager, volunteers, and street persons are not the same as those in spiritual direction or intervention. The methods of social min-istry organization and management, schools of spirituality (Ignatian, Fran-ciscan, Carmelite, Augustinian), socio-political thought, and even life Spiritual Direction in Social Action Ministries goals for directees, volunteers, and street people may vary widely. But these two activities have more similar than dissimilar aspects. Identifying the importance of spiritual direction and social action as part of an integrated whole in both ministries is the concern of effective managers and directors. The issue is the recognition of the reciprocal con-nection between the two ministries. The question is not whether the soup kitchen responds first to physical or spiritual needs. Nor is it whether con-templative prayer or an awareness of social consciousness predominate in spiritual direction. There are several points where spiritual direction and social mifiistry coincide: A. Holy Spirit: Our ministries and our lives must flow from Holy Scripture and the indwelling Spirit of Christ. The guidance of the Holy Spirit must always be foremost in our own paths and our involvement in the journeys of others. Discernment of that guidance is discovered in community with others in both individual spiritual direction and in so-cial activities such as soup kitchens. We need to support and nourish each other in our experience of and search for God's gift of love. B. Purpose and Goals: Any spiritual director will admit that before a working relationship can be established with a directee, a determina-tion of what the directee desires from direction must be explored. The goals and purpose of direction must flow from the life, prayer, and ex-periences of the directee. A soup kitchen is no different. On the surface, the purpose may seem to be distribution of food, social work, a sympa-thetic ear, and hopefully, the strength to go on another day. But the mo-tivations of the volunteers, manager, and street people in the soup kitchen community must be considered as important and basic as pro-viding soup, sandwiches, and even friendship. Unconscious messages about worthiness, authority, manipulation, and social statements can creep into the daily life of any hands-on social ministry or spiritual direction relationship. We must be clear in what we are about as helping people and .as concerned, activist communities to-ward those who seek direction or bread. The consequences can be the perpetuation of the suffering and oppression of the poor, a hindrance of the spiritual unfolding and growth of direct.ees, and a floundering for guid-ance by volunteers and workers. The ministry can become part of an on-going or potential problem instead of an instrument of God's peace. Openness to seeing God in my neighbor is fostered by encouraging healthy interaction between guests and volunteers. Joint meetings of both provide insights for planning, alleviate misunderstandings, and build com-munity among participants. Goals clarification and the scriptural basis Review for Religious, November-December 1990 or theme of the soup kitchen needs to be discussed and reiterated through training sessions with volunteers and in meetings with volunteers and guests. Quarterly soup kitchen orientations can offer the opportunity to learn communication and listening skills, positive ways to vent anger and frustration, and sharing feelings of sadness and pain. Attention to detail can encourage the mandates of the Gospel good news, peace and justice for the people of God. Trained volunteers who mingle ';vith guests during mealtimes can facilitate a calm release of the pain, rejection, and dehumanization of street life. Colorful banners do-nated by supporting churches or made in guest/volunteer sessions help to illustrate and affirm the soup kitchen's scriptural themes, such as the Good Shepherd, Matthew 25, and the Bread of Life. Seasonal celebra-tions, monthly birthday recognition, and encouraging on-site social ser-vices help to foster a family-oriented environment. We must live what we believe especially when becoming open to an awareness of the real-ity of the peace and justice of Jesus. C. Street People and Directees: People who live on the streets in ab-ject poverty are God's children in crisis. The wounded, hungry bodies that line up each day for food are also wounded spirits who directly or indirectly seek the fellowship that feeds the heart. All participants in the social ministry community, volunteers, staff, and street people, need to be aware of and be sensitive to the friendship needs as well as physical needs of the other members. The requirement goes both ways amongst volunteers and guests. Soup kitchen managers can no more ignore the Gospel good news of empowerment for the poor than can a spiritual di-rector become heavy-handed with advice and admonitions for the di-rectee. This sensitivity is necessary if everyone is going to move beyond lim-iting their efforts to subsistence needs and toward the mandate of Jesus, friendship, peace, and justice. Tho.ugh the goal of personal and commu-nal empowerment of poor people may seem distant and unobtainable, it is our Bethlehem star. If we do not keep in our awareness and striving the justice promised by God and echoed by Mary in her song, the Mag-nificat, our ministry, faith, and words will become St. Paul's metaphor, the clanging cymbal. The guidance and leadership for discernment to-warc~ this justice most often falls to the manager and spiritual director. Likewise, with directees, the spiritual director has a responsibility to dispel the myth of our tradition that the experience of God and the love of Christ can be a personal, private affair.5 The totality of a graced, trans-formed life is not for the benefit of the directee. St. Teresa of Avila re- Spiritual Direction in Social Action Ministries / ~1"15 minded us that we are meant to be the eyes, hands, and feet of Jesus in the world today. The Center for Spirituality and Justice has demonstrated a social-consciousness aspect to spiritual direction that must be part of the journey of director and directee if there is to be true discernment of .God's will~6 D. Volunteers: Church social ministries can be an extension of Je-sus' example to share ourselves and the fruits of the earth, food, shelter, and resources, with those in need. A deeper responsibility and outgrowth of the working of God's grace in everyone's life is stretching out a physi-cal and spiritual hand in friendship and unity. But for many middle-class volunteers who have never experienced the poverty, degradation, and suffering of those who live on the streets, a first-time exposure can be unnerving and challenging to their comfortable lives. Street people are not the only soup kitchen participants who experi-ence emotional crisis. Seeing firsthand the suffering and dehumanization of street life, many volunteers are distraught when they connect their rela-tively comfortable lives with the misery of homeless people. When food, clothing, an offer to listen, or a smile is refused with unkind words, vol-unteers may feel confused, rejected or angry. A misunderstanding be-tween guest and volunteer can result in "yes" instead of "no" as the answer to an inappropriate query. Just as street people bring their emotional baggage in the front door, volunteers can unload psychological traumas, too. Unresolved sexual needs, psychotic disorders, substance abuse, and authoritarian domi-nance can cause serious problems in the soup kitchen, community. Even though volunteers' emotional issues can't be compared to the sufferings of street people, a soup kitchen manager having some training in lay coun-seling and spiritual direction is helpful for the emotional and spiritual di-lemmas faced by volunteers and guests. For the social ministry manager just as for the spiritual director, their own spiritual direction and a peer group providing support, wisdom, and guidance needs to be part of the organization of the ministry. E. Leadership: Managers and Directors: The relationship between a soup kitchen manager and volunteer or street person is not identical to that of a spiritual director and a directee'. However, the responsibilities of the manager and director in regard to the spiritual foundations of their work with others and their own spiritual journey are so similar that com-parisons can be made. If a soup kitchen 6r.any social ministry is not to become a sterile institution, the guidelines or working plan of operation must be thoughtfully and prayerfully discussed and discerned over time. Review for Religious, November-December 1990 "What is God's will for me" in spiritual direction is parallel to and comparable with "What is God's will for us, volunteers and street peo-ple," in a soup kitchen. The spiritual director and the direction relation-ship provide the backdrop against which the directee wrestles with his or her issues in listening to a loving God. Likewise, the basic rules and logistics of feeding hundreds of people daily must be wrestled with so that dignity and the love we show each other are not compromised using the excuse ofjoblessness, smelly clothes, or efficacy in operation. While including the poor and powerless in decision-making roles can be threat-ening, it is the fulfillment of Jesus' Good News. The soup kitchen manager and the spiritual director are responsible not for the success of the kitchen, the progress of the directee, or even determining what connotes that success or progress. One who seeks to lead must be a follower; a manager or director must create an environ- " ment whereby volunteers, street people, and directees seek their own spiri-tual journey with support and guidance for discernment of God's will for them. The outward emphasis may differ from soup kitchen to spiritual direction but for the director and the manager, the spiritual task is the same. Conclusion There is value in drawing parallels in principle and practicality be-tween contemplative spirituality, spiritual direction and social conscious-ness, and the theological and spiritual organization of social ministries. Flexibility and imagination are necessary to compare the leadership and organizational abilities of a soup kitchen manager with the skills and train-ing of a spiritual director. We can show that the experiences of the vol-unteers and street people can follow a pattern of spiritual development. And directees and their spiritual directors can explore the social as well as personal experience of the Holy Spirit in their lives. In the face of violence, learned dependency, ignorance, and biased prejudices, hearts and minds as yet unawakened are waiting for the power of God's transforming grace: Spiritual direction and social min-istry are not two journeys originating from disparate starting points. Each of these spiritual paths flows from the other and back to nourish those who find themselves to be both contemplative and activist. Spiritual Direction in Social Action Ministries NOTES i D. Bernsweiger, D. McCarty, and L. Rhodes, Eds. Spirituality, Ministry, and Field Education: Theological Field Education, Key Resources, Vol. V. (San Francisco: Assn. for Theological Field Education, 1986), p. 52. Research by the Center for Spiri-tuality and Justice, Bronx, New York, on spiritual direction and social conscious-ness. "Social consciousness" as based on Peter Henriot's, (S.J.) thesis that the re-ality of the human person must take into account the individual, interpersonal, and public dimensions of human existence (p. 5 I). A person is simultaneously engaged in intense intrapersonal activity and consciousness, ongoing interpersonal relation-ships, and living out her or his life within a set of established and defined structures and institutions in the societal area (p. 52). 2 St. Teresa of Avila, The Collected Works of St. Teresa ofAvila: Vol. One, trans. Kieran Kavanaugh, O.C.D. and Otilio Rodriguez, O.C.D. (Washington, D.C. : ICS Pubs., 1976), p. 125. 3 Bernard Lonergan, Method in Theology. (New York: Seabury Press, 1972), pp. 8- 20. The four stages of enlightenment for soup kitchen participants is based on Lon-ergan's transcendental method. '~ Karl Rahner, "Reflections on the Unity of the Love of Neighbor and the Love of God." Theological Reflections, Vol. VI. (New York: Seabury Press, 1971), p. 232, p. 239. 5 lbid, pp. 242-244, 246. 6 Bernsweiger, McCarty, and Rhodes, pp. 53-54. Morning Office Here in my house of silence I stand beside you, Zachary. The song you cannot sing Trembles on your lips;. My song Pours in wordless rivers From quiet eyes. We stand together Lonely, waiting to sing Our canticle. Suzanne Zuercher, O.S.B. St. Scholastica Priory 7430 North Ridge Chicago, Illinois 60645 Living Our Liberation Through Justice and Spirituality Linda Rich, C.D.P. Sister Linda Rich, C. D. P., is a graduate of the Institute of Pastoral Studies at" Loyola University of Chicago. She currently works as part of the administrative team of NET-WORK, a national Catholic social justice lobby in Washington, D.C. Her address is 806 Rhode Island Avenue, NE; Washington, D.C. 20018. In the past one hundred years, and more vocally in recent years, part of the Christian community is specifically addressing social problems through systemic and structural analysis and applying Christian value prin-ciples to these problems (for example poverty, war). In the North Ameri-can and European culture, theologians, bishops, and the Vatican are do-ing this analysis and reflection by developing social ethics and a large written corpus of Catholic social teaching. In other cultures, Christians are interested in finding ways to make the Gospel real through experiencing liberation from injustice. This in-dicates that the developing social ethics need a lived reality, an experi-enced spirituality if we, as a whole community of the People of Go~l, are to respond to this recovered Gospel of social justice. That void is now being filled in and fleshed out. The writers and think-ers in the fields of spirituality and social justice are beginning to coa-lesce, to meet on mutual ground. Liberation theologians are now writ-ing about the spirituality of liberation: for example, Spirituality of Libera-tion: Toward Political Holiness, Jon Sobrino, Orbis Books, 1988, and The Way of Living Faith: A Spirituality of Liberation, Segundo Galilea, Harper & Row, 1988. North American spirituality writers are now speak-ing of how spirituality is intimately linked with social transformation: for example, Social Re~,elation: Profound Challenge for Christian Spiritu- 818 Living Our Liberation Through Justice and Spirituality ality, James E. Hug, S.J. and Rose Marie Scherschel, Center of Con-cern, 1987, and Spirituality and Liberation, Robert McAfee Brown, West-minster Press, 1988. Grass-roots movements within the Christian community are also bring-ing spirituality and justice together. The Catholic Worker movement con-cretely lives out social spirituality as envisaged by Dorothy Day and Pe-ter Maurin more than fifty years ago. They feed the hungry and welcome the homeless, while at the same time challenge the social structures that create this reality. As such, they speak against the national budget pri-orities for weapons instead of a priority for food and housing, for exam-ple. They are joined with others in the peace movement, the feminist/ women's movement, and the racial and economic equality movements, which all have collectives of people who are motivated and sustained in this activity by the Christian call to discipleship and by other spiritual values and beliefs. While these manifestations of justice spirituality are all happening within the Christian community, the message of the social justice dimen-sions of spirituality have not yet been carried into the mainstream, how-ever. A new theology and practice of spirituality needs to be unfolded, articulated, and fostered in the Christian community-at-large. A new un-derstanding of how spirituality is, and needs to be, vitally connected with justice will then begin to emerge for the average Catholic in the pew. Donal Dorr comments: "Perhaps the most effective way in which the Church can influence human behavior is by promoting a particular kind of spirituality." ~ Personal and Social Transformation Spirituality and social justice are closely related, both being trans-formative processes. Spirituality, as I am using it here, is our process of personal transformation. Through spiritual practices (meditation, prayer, liturgical ritual) and through the living out of the fruits of these in our lives, we become better persons, more loving, more congruent with the values we profess. We grow and mature as persons and become psychologically and spiritually integrated. Justice is the process of bringing social groups into right relation-ships with each other. It is the transformation of legal or violent enforce-ment of the domination of one group of people over another (men over women, rich over poor, one race over another). Justice transforms domi-nant/ submissive relationships into partnerships.2 Oppressive violence is transformed into peace and freedom when justice is present. Both justice and spirituality are journeys into freedom, moving from 820/Review for Religious, November-December 1990 being bound to a more free state. There is movement from being en-slaved by forces outside our control to having choices about our lives. This movement happens (and power is shifted) by our being able and will-ing to take up the struggle for freedom and undergo the suffering re-quired. "There is no transformation of person or society without suf-fering, and the suffering which brings about such change is truly re-demptive.' ,3 And so, it is very important to discern and determine which particular path leads to greater life through death and which path leads to dead ends, defeat, and a conquered death. Each choice, whether stay-ing with things as they are or choosing for change, has its own risks and consequences. These must be carefully considered. And as in any authen-tic journey, there are risks and perils along the way. Courage, persever-ance, and support from others are required for both the personal and so-cial transformative journeys. We can see some parallels between justice and spirituality. There is also an integrity present that is often missed. Both are needed in con-junction with each other to have true justice and true spirituality. This is so because either of these in isolation from the other is destructive. Historical examples include the way the Church sometimes has pro-moted an escapist spirituality which accepted injustice for other operat-ing benefits by the political powers that be. On the other hand, in socie-ties that have repressed spirituality and religion, great violence has been done in the name of social equality. This also plays itself out within the Christian community where division is created, with splits of "devout" and "activist" factions who distrust each other. Experience shows that spirituality and social justice are a graced dynamic, and split off from each other render both ineffective, irrelevant, and destructive. When these two are integrated, however, the world and the Chris-tian community are graced with life-giving energies. There are many ex-amples in our North American experience. Pax Christi, a Catholic peace organization, uses a threefold approach of prayer, study, and action, com-bining the elements of spirituality and activism. They are in the forefront of efforts to promote a vow of nonviolence, a wonderful way of rooting a committed life of peace within a rich spiritual tradition. The commu-nity of Sojourners (Washington, DC), as part of the Christian evangeli-cal tradition, ministers through their monthly publication, neighborhood organizations, justice resources, and organizing national days of prayer and nonviolent resistance. NETWORK is a national Catholic social jus-tice lobby that attempts to influence the formation of public policy in the interest of the poor and powerless. It lobbies members of Congress to Living Our Liberation Through Justice and Spirituality enact laws providing access to economic resources, fairness in national funding, and justice in global relationships, Another facet of the relationship of personal and social transforma-tion is that these two are not necessarily simultaneous or synonymous; one does not automatically follow the other. A liberation scholar states it this way: Social change by itself does not create a new person, in the same way that transforming persons do not automatically induce a new social or-der. The creation of a new person and a new social order takes place within a dialectical interaction.4 So we can see that a conscious link needs to be made between our spiri-tual growth as transforming persons and our justice work of transform-ing society, or that link will not be made. Some people who invest time and money in the human potential move-ment for personal psychological and spiritual growth make the social con-nections beyond themselves, and some do not. Those who fail to con-nect their personal growth to a wider social vision will probably become shortsighted, turned in on themselves (stunted), and "whistling in the dark while the world goes to hell in a hand basket." Likewise, some so-cial activists who spend tremendous amounts of personal time and en-ergy organizing campaigns for justice do so from the fruits of their spiri-tual growth, and some do not. Those who fail to connect to a spiritual source will probably fall victim to burnout, cynicism, and self-righteous-ness. It is essential, I think, to recognize the inherent integrity of spiritu-ality and social justice within a "both/and" holistic framework. Too often they have been split apart, to the detriment of both. This dichot-omy needs to be healed and is being healed in the coming age. Conversion and Social Liberations In my experience, the education and consciousness-raising of justice work begins to effect a real transformation process in individuals, and in groups of people. This journey of transformation and liberation is one of conversion, a qualitative change, a living of life in new ways. Con-version (whether religious, intellectual, individual, or social), involves a three-part process of !) dying to the old, 2) an in-between period, and 3) a new orientation. Initially we feel confusion and conflict, we experience a resultant in-ability to continue living as we have been, and we know the need to find ~199 / Review for Religious, November-December 1990 new ways of living. Once this process is entered into, things will never be quite the same again. (You cannot put the toothpaste back in the tube.) We find that we may creep slowly or may suddenly leap into a different frame of reference. We are brought into a whole new level of relating-- with a social consciousness~to God, to ourselves, and to others. Albert Nolan describes our growth into social consciousness in four stages.6 (He addresses this to the specific problem of poverty, though the principles can be applied in regard to other oppressed groups of people as well, it seems to me.) The first stage is characterized by our compas-sion, brought about by exposure through experience or information re-garding the sufferings of the poor. This compassion is generally ex-pressed in two kinds of action: relief work (distributing food and alms-giving), and simplification of lifestyle (voluntary poverty). The second stage is entered when we acknowledge the structural prob-lems as social in.justice. Things are the way they are because social struc-tures are set up to serve the interests of some people over others. Anger and guilt may arise when we become aware that poverty is largely a re-sult of oppression. Now our charity of the first stage is joined by justice in the second; both are necessary. In the third stage, we join humility with service to the poor. We need the poor for our liberation, also, and often we are unaware of the gifts they are and have for us. It is this humility (owning our own poverty) that tempers our "doing for the poor" into befriending them. At the same time, one hazard here is to put the poor/working class on a pedes-tal, to idealize them into something they are not. This can lead to disil-lusionment, disappointment, and burnout when we discover the illusion of our own making. The fourth and last stage is one of.real solidarity. This is the experi-ence of recognizing the faults and weaknesses of the poor as well as of ourselves, and at the same time, knowing that we can be on the same side against oppression. Now we experience the struggle of liberation to-gether. The second major aspect is that social consciousness is an essential part of conversion, not the results of it. Socioeconomic life is not a corollary to our relationship with God. It is not simply the arena in which conversion and love of God flow out into love of neighbor--if God so leads us. Social concern and work for jus-tice are not just the outgrowths of Christian conversion. Prayerful involve-ment in socioeconomic life and reflection on it are prerequisites to know-ing and relating intimately with God, not the results of it.7 Living Our Liberation Through Justice and Spirituality/ This concept is rife with implications for the i~ntegration of social con-sciousness into our spiritual life. If we discern God's revelation to us ex-clusively in our interior movements (within ourselves), then "we receive only a partial, distorted image of God. We are ignoring part of the reve-lation of God. We run the danger of fostering, . . a selfless, dedicated and energetic service of the status quo with aH its unjust institutions."8 Our spirituality, without the social revelation component, will most likely, though unwittingly, serve the continuance of injustice. A third connection between conversion and the transformative pro-cess of justice is the image of liberation for the spiritual process. Rather than relying exclusively on the traditional image of union and intimacy with God for spiritual growth,9 we may well include "conversion as lib-eration" as a complementary image. For truly all conversion is a liber-ating experience from our false selves and an enlivening and freeing ex-perience of our true selves. As the image of spiritual union speaks to the part in each of us that seeks attachment, belonging, and inclusion, the image of liberation speaks to the part in each of us that seeks freedom and autonomy. For people who are victims of others and/or society, for people who feel enslaved interiorly by addictions or by life circumstances, this lib-eration process imaged and named as such can be a tremendous motiva-tion and empowerment for change in personal and spiritual development and for social activism. Paul proclaims: "The world itself will be freed from its slavery to corruption and share in the glorious freedom of the children of God" (Rm 8:21). Implications A great challenge lies before us. World crises every day remind us of how fragile and precarious our planet and our common situation is as human beings. We can deny and numb ourselves to this reality. We can let it in and live in despair and be crushed by it. Or we can forge new ways of living, "ministering to the breakthrough" (as named by Pat and Gerald Mische of Global Education Associates) of a surviving and just world. Members of religious congregations can be in the forefront of this breakthrough, on the prophetic cutting edge a's it were. We have a pub-lic role in the Christian community and many congregations are interna-tional. More than one congregation now has Non-Governmental Organ-izational (NGO) status at the United Nations. These and other innovative ways to minister to the breakthrough can be communally explored and implemented. Though each congregation faces the lack of personnel and 8241 Review for Religious, November-December 1990 finances in a different way, we can continue to be supportive of those people and organizations that integrate faith and justice. The integration of spirituality and justice is a key component of min-istering to the breakthrough. It requires a change in thinking as well as in acting, in theory as well as in praxis. Only the combined strength of the theory and practice of spirituality and justice will carry us through into the future. NOTES ~ Donal Dorr, Option for the Poor: A Hundred Years of Vatican Social Teaching (Ma-ryknoll, N.Y.: Orbis Books, 1983), p. 59. 2 Riane Eisler, The Chalice and the Blade: Our History, Our Future (San Francisco, CA: Harper & Row, 1987), pp. 198-203. This shift is elaborated on in depth here. 3 Carolyn Osiek, R.S.C.J., Beyond Anger: On Being a Feminist in the Church (Mah-weh, N.J.: Paulist Press, 1986), p. 83. '~ lsmael Garcia, Justice in Latin American Theology of Liberation (Atlanta, Geor-gia: John Knox Press, 1987), p. 80. 5 See Osiek, Beyond Anger, p. 44-63, for an insightful development of conversion and transformation in a liberation context. 6 Albert Nolan, O.P., "Spiritual Growth and the Option for the Poor," Church (Bal-timore, MD: National Pastoral Life Center, 1985), Spring issue. 7 James E. Hug, S.J., and Rose Marie Scherschel, Social Revelation: Profound Chal-lenge for Christian Spirituality, (Washington, D.C. : Center of Concern, 1987), pp. 22-23. 8 Ibid, p. 23. 9 In Francis Kelly Nemeck, O.M.I. and Maria Theresa Coombs, The Spiritual Jour-ney: Critical Thresholds and Stages of Adult Spiritual Genesis (Wilmington, Dela-ware: Michael Glazier, 1987), union and intimacy image is used throughout. Spirituality of Liberation Peter G. van Breemen, S.J. Father Peter G. van Breemen, S.J., author of well-known books such as As Bread That Is Broken and Called By Name, has most recently been serving as Jesuit tertian director in Berlin. His address is Peter-Faber-Kolleg; Postfach 220018; Am Schwemmborn 3a; D-1000 Berlin (Kladow); West Germany. Much is being said and written nowadays about Theology of Liberation. The deliberate alteration to Spirituality of Liberation suggests a shift to-wards a less controversial and a more meditative approach. Spirituality The word spirituality stems from spirit. In the Old Testament it re-fers to the ruach as the divine source of human life, and in the New Tes-tament to the active presence of the Holy Spirit in our everyday personal and communal life, where it renders our faith concrete in our actions and behavior. The word spirituality also intimates that life has come to a cer-tain harmony and synthesis: what could remain a fairly objective and sometimes even abstract doctrine has become a source of life and inspi-ration; it has become integrated and operative. Spirituality is lived in the community and becomes fruitful within it, since the Spirit 'is given pri-marily to the community, and to the individual only in the community. So much about the first word of our title. Liberation The word liberation has generally more political overtones than the related word redemption. When Gustavo Gutti6rrez coined the expres-sion "Theology of Liberation" and used it as the title of his book (Lima, 1972), and when a number of his Latin American colleagues took over this expression, they wanted to make redemption more down-to-earth 826/Review for Religious, November-December 1990 and more relevant for the struggle for life. There should be no real doubt that the theologians of liberation want to articulate the Christian faith-- drawn from Scripture, received from Jesus Christ, and handed on through the Catholic Church---even though the Instruction of the Sacred Congregation for the Doctrine of the Faith "On Certain Aspects of the 'Theology of Liberation,' " published in 1984, had a number of criti-cal remarks and even though one of its leading theologians (Leonardo Boff) was silenced for a year. In fact, that very Instruction plus another one of March 22, 1986 basically approve and praise the Theology of Lib-eration. It is not surprising that the rapid development of the Theology of Lib-eration in the last two decades has led to a variety of meanings of the word liberation. What unites, however, all the different schools of lib-eration theology is that--in various ways--they are all inspired by and support a movement, a dynamic, in which the poor and the underprivi-leged draw strength from their faith to fight for their dignity and against unfair exploitation. The heart of the Theology of Liberation is to be found in this movement; it is lived before it is articulated. Undoubtedly this theology (and this movement) began in Latin America, but it is equally certain that they are to be found in other parts of the world as well, like the Philippines, South Africa (Kairos document), India (State-ment of the Indian Theological Association), and other countries. What these countries have in common is obviously their great need for libera-tion, but also that Christianity is fairly recent there. Quite often, with a touch of humor, the Church in these countries is compared with a young woman, hardly twenty years old, in which comparison the Church in Europe is portrayed as an elderly lady. Along with their youth, these Churches also stress their vigor and their hope. It is a little touchy, though not unfair and not disrespectful, when they describe the climate in the European churches as winter and in theirs as spring. Let me just conclude from these remarks that a spirituality of liberation and the di-vine virtue of hc~pe go together. Pope Pius XI (1922-1939) was the first Pope tostress the place of indigenous churches. In 1926 he consecrated in St. Peter's in Rome six Chinese bishops, the first non-white bishops since the early Church. That is less than seventy-five years ago! Whereas all the Fathers of the First Vatican Council (1869-1870) were natives of Europe or North America, the Second Vatican Council gave a completely different picture. Thus it is not surprising that Vatican II speaks highly of the variety of local churches with "their own discipline, their own liturgical usage, and their Spirituality of Liberation own theological and spiritual heritage" (Lumen Gentium 23). "The Chair of Peter, it is said, protects legitimate differences, while at the same time it sees that such differences do not hinder unity, but rather con-tribute to it" (LG 13). Though not without friction and pain, this shift of the center of gravity from the Western world towards other continents goes on speedily. The prognostic indicates that in the year 2000 thirty percent of the world's Catholics will live in Europe and North America, and seventy percent in the southern hemisphere (that is, Latin America, Africa, Asia, and Oceania). We live on the eve of a new equilibrium of the Church. One sign of this is that non-western schools of theological reflection arise. They form a challenge and offer a chance. They can en-rich the people of God immensely. Covenant In a spirituality of liberation, the covenant plays a vital role-- indeed, the covenant is the very origin of our liberation. This may sound rather paradoxical, since covenant denotes a bond that binds us, which looks like the exact opposite of liberation that sets us free. Yet, Sacred Scripture is basically the long story of human liberation, precisely be-cause it is the history of the Covenant of God with his people--first with the Jewish people in the Old Testament and later in the New Testament with all God's people. From the bond of this covenant true freedom springs. This brings home to us the important truth that freedom in the Bible is not unbound, arbitrary, individualistic or irresponsible. Freedom does not mean that one can do what one likes; on the contrary, truly free per-sons are not governed by likes and dislikes, but act according to their inner convictions and conscience--in short, their true self. Freedom im-plies honesty and courage, transparency and authenticity, maturity and responsibility. Sometimes God is called the deepest Ground of our being. Even though the expression may be rather recent, the idea is not new at all. The classic phrase of St. Augustine "God is closer to me than I am to myself" says basically the same thing. If God is the deepest Ground of our being, then it is only in union with him that we can be our true selves and act freely. God is not constraining, but it is only in and through him that we come to life and freedom. Modern psychology confirms this view. It is only in a basic trust in another person (normally the mother) that the child reaches self-confidence. It is only in the security which the mother gives to the child that the latter finds the courage and even the ability to reach out. The 828/Review for Religious, November-December 1990 greater the confidence in its parents, the more open the child will be. What we can observe very clearly in children reveals a characteristic which remains through the whole of life. A person who is secure in the love of someone else can afford to go out into the ever widening space of life and to respond to the world's ever growing challenges. True freedom is the fruit of true love which one has experienced and/ or is still experiencing. I shall not dwell on the sad and often tragic as-pects of the counterpart of these psychological data, but rather state that for me these psychological insights point to God as the ultimate fulfill-ment of our basic need. Of course, I am aware that I make a jump from the level of psychological experiences to the level of faith. I am not try-ing to prove anything, only to suggest and to hint. It is in the covenant that God gives his chosen people the security we are talking about. "I shall be your God and you shall be my peo-ple" is God's summary of the covenant. God binds himself to his peo-ple; he is their support and guarantee. In doing so, he invites the people to bind themselves to him in faithful obedience. When the people accept this invitation, the bond of the covenant is the basis of their freedom. At an early stage of the Jewish history this mighty care of God as the origin of their freedom is exemplified in the exodus from the slavery in Egypt. In fact, one can say that the Exodus is the beginning of the Jews as a nation; up until that moment they were no more than a gang of slaves, who were exploited in unbearably hard forced labor (Ex 2:23). It is in the miraculous event of their liberation from Egypt and their pas-sage through the Sea of Reeds that they become a people. God reveals himself as their God, their liberator, the origin of their national identity. From generation to generation they keep celebrating the marvel of their liberation as the outstanding evidence of the covenant. It is in the context of this liberation from slavery that God reveals his name: Yahweh. Volumes have been written about the meaning of these four Hebrew letters, yet the scholarly research of centuries remains inconclusive. Is it a sign of God's transcendence or of his sense of hu-mor (or of both) that his name remains mysterious in its being revealed? So much seems certain that the name Yahweh is existentially a boundlessly affirming word and intellectually just as boundlessly com-prehensive (that is, not to be grasped). He is there, absolutely reliable and absolutely incomprehensible. In their exodus the Jewish people have experienced their God, whom they gradually discover to be the God of all nations and of all creation. In their exodus they have learned that God hears the cry of the poor and takes their side. We meet here the begin- Spirituality of Liberation ning of a strand that runs through the whole of Scripture, stressing God's care for the poor and the needy, the orphan and the widow. Eventually this will lead to some sort of identification of God with the weak and the little, for example, Psalm 91:15 and Matthew 25:40, 45. In their exodus it was also brought home to them that Yahweh works through people: God. has no hands but ours; compare Exodus 3:8 with 3: 10. In their history with Yahweh they discover that he is "always greater." That is indeed a very pertinent characteristic of God. No mat-ter how great we think of him, he is always greater. No matter how much we have experienced of him, he remains always greater. That keeps us always on the move in our relation with God. The chief expression for human life in Hebrew means: to wander, to travel, to hike. The early Christians called themselves "the people of the way." Thus the exodus is a basic distinction of true religion, not an exodus once and for all, but ever so often repeated. And so freedom is not only the fruit of our exo-dus, but also its prerequisite, Liberty is both gift and demand. That is to say how much our faith is a religion of liberation. In apostolic reli-gious life unconditional pliability with respect to the will of God which can never be predicted and never be fixed takes shape in a continually adaptable apostolic availability. Paschal Mystery So far the name of Jesus has not been mentioned. It is in him that God became incarnate; it is in him that liberation receives hands and feet, a body and a voice and a face. His name, in Hebrew Yehoshua, means "Yahweh saves." Jesus embodies the saving God. He embodies this sav-ing God in a concrete, historically, sociologically, and politically well-defined situation. The incarnation of the eternal Son of God implies the taking-up of a human life with all the specific conditions of a particular society in a particular time. Perhaps the most striking feature of Jesus' dealing with the people of his time and country is how free he is as a person and how free he renders others (Lk 4:!8). This freedom is not simulated, but has deep roots. He is free, because at the same time he is one with the Father. What we found as the true source of freedom of the Jewish people, namely the covenant with Yahweh, we find infinitely more in Jesus of Nazareth. He was bound with Yahweh in his very person: "one in be-ing with the Father" (see Jn 10:30). Accordingly, he always did what pleased the Father and called the will of the Father the food on which he lived (Jn 4:34). That made him a free man and enabled him to free others. Review for Religious, November-December 1990 The miracles he works are presented by the Evangelists, especially by John, as "signs," which point out who Jesus is and what God stands for. Though accepted gratefully and often enthusiastically by many con-temporaries, the signs are rejected by the political and religious leaders. They decide to kill Jesus. The prospect of his suffering and death meets with a profound inner resistance, which in Gethsemane brought a terri-ble distress over him; yet he is free enough to say yes to his passion and crucifixion (Jn 10: 17). Jesus dies on the cross as a consequence of his mission. But God stood by his Son, in and beyond his death. God raised him to new life, a life over which death has no more power. We call this the paschal mystery, in analogy to the passover-event of the Old Testa-ment. The liberating event of the Old Testament was the exodus from Egypt; in the New Testament it is the death and the resurrection of Je-sus. The paschal liturgy from its earliest origins considered the crossing of the Sea of Reeds as a prefiguration of Jesus' passing through death to the risen life, so much so that among the many Old Testament read-ings of our Easter Vigil Exodus 15 is the only one which is obligatory. Here we touch the heart of the saving and liberating mission of Je-sus. In the various forms of our creeds we confess about Jesus: his in-carnation, and then omitting every other event of his life, his passion, death, and resurrection. No miracle, no sermon, no teaching, no contact with any person, no feature of his personality, not one event of his hid-den or public life is mentioned. In every creed one jumps from the birth of Jesus straight to the paschal mystery, which constitutes the core of our faith in Jesus. The paschal mystery is like a tunnel, that obviously has two ends which are connected and thus make the one tunnel. So death and resur-rection are two sides of one mystery. It is of the essence of the gift of faith that one can see the one side of the mystery in unity with the other: the passion in the light of the resurrection--the risen Lord with the wounds of his crucifixion. It is precisely the unity of these two events, crucifixion and resurrection, that makes us free. Jesus is savior and lib-erator because he is at the same time the suffering servant of Yahweh and the glorified Lord. The tunnel leads into the realm of freedom, like the passage through the Sea of Reeds led the Jewish people into the prom-ised land. The Gospels are written from this certainty. They narrate the events of Jesus' life, but in the light of the resurrection. It is this per-spective that we call inspiration (see Jn 8:28; 12:32). It reveals to us not only the redemptive and liberating thrust of Jesus' life, but it also takes us up into that same dynamic. It is the mystery of the grain of wheat Spir!tuality of Liberation / which yields fruit only by dying in the ground (Jn 12:24). It is the call of Jesus, not to hold on to one's life, but to lose it for the sake of the kingdom (Mk 8:35). Fulfillment These words are not meant to glorify human misery nor are they to be used as a cheap consolation to those who suffer. Rather we ourselves in the first place are to take them to heart, if we want to follow Jesus and to be apostolically fruitful. Every human person strives for fulfill-ment. This is perfectly in line with God's purpose, for example, John 15:8. But there is a way of striving after self-fulfillment and self-unfolding which is not in line with God's intention. As soon as one for-gets or denies that true Christian fulfillment goes through renouncing one-self and taking up one's cross (Mk 8:34) and dying like a grain of wheat, one is moving on the wrong track. Then my own physical well-being, my settling into a comfortable lifestyle, my need to be appreciated by those with whom I live and deal, bonds of friendship, my desire to make the most of my talents, success in my work, and so forth begin to play too great a role and stifle my religious and apostolic life. Since this topic is not only very vital indeed, but also very delicate, let me stress that the values mentioned are positive and good. However, as Christians we believe that we truly obtain these values when we do not hold on to them, but are willing to lose them for the sake of Jesus and the kingdom. This brings about the attitude of freedom, in the evangelical sense of the word. An essential aspect of Jesus' freedom was his readiness to accept suf-fering and to lay down his life (Jn 10:17), even though he agonized when the actual passion began. Similarly, a disciple of Jesus cannot follow his or her master without this freedom to give up precious personal human values (Lk 14:33). The Bible gives us many examples of negative experiences which eventually turn out to be quite positive. It is the lesson which Jesus in a remedial class brought home to the disciples of Emmaus (Lk 24:26). It is the lesson which Moses was taught in Exodus 33:18-23. It is the les-son that the evil is far worse than we admit, but that the good is also much greater than we dare to hope and even can bear. It is the lesson which all of us have learned in life: what at the actual moment was felt like a great loss, often revealed itself in hindsight as a real grace. The biblical message, confirmed by our own life experience, may help us to become more free in regard to our own life and more free in our apos-tolic service. 839 / Review for Religious, November-December 1990 It is, of course, a platitude to say that only those who are themselves liberated can help to liberate others. But this platitude is also a little sim-plistic. It seems more nuanced to say that as the Father wants us to be creative with him, likewise the Son wants us to be redemptive with him and wants to continue his work of liberation in and through us (Gaudium et spes 34 and 67). In this way we point out more clearly that our own liberation is a lifelong process and that it is only God who can work true freedom in ourselves and in others. We have to complete th'is statement by saying that God can work this true freedom only through us. So it is our mission to help the people experience the liberating God. In his encyclical Evangelii Nuntiandi (1975), Pope Paul VI stressed that evangel-ization proclaims and tries to realize liberation. This evangelization and this liberation aim at the whole person, .as the same Pope wrote already in an earlier encyclical Populorum Progressio (1967). Respect I suppose this renders respect a key concept in our service of libera-tion: a great respect and regard for the dignity of each human being, that is to say, of ourselves and of others. Respect is the heart of love, and in many ways the word respect is more meaningful than the word love (which, alas, is sometimes used so vaguely and glibly). Respect means to acknowledge the worth of others as other, that is, to relate to them not as we want them to be, not as we think they should be, not as they fit into our plans, but as they are. It also means to discover in these real people their defects, and to accept them. There is a wise and dense say-ing of C.G. Jung: "One can only change what one, has accepted." What we reject or condemn or repress goes beyond our reach; we cannot do anything with it nor for it anymore. I am convinced that the lack of respect does a tremendous harm in our communities, in our apostolate, in our Church, and in our world. If we could come to a basic attitude of respect for each human being, the world would become a so much better place to live in and the Gospel-message would become so much more real and convincing. This respect should not be an aloof, detached, disembodied attitude. If it is, it contradicts itself. Clodovis Boff expresses the opinion that Euro-pean culture tends to screen itself from the "two-edged sword of the Word" (Heb 4:12) with a highly developed, but spiritualistic, exegeti-cal, and sociological sophistication. "Europeans only?" one might ask. As our respect for each other has to be integral, so has the liberation we work for. We cannot restrict it either to the spiritual or the political realm. Spirituality of Liberation / 833 The Poor The word integral can also be understood as including all men and women, though the word universal might be more appropriate in this case. With that meaning in mind, integral or universal liberation requires a special concern for the poor and the weak. This is certainly in line with a trend that runs through the whole of Scripture. God shows a preferen-tial love for the poor, which leads to a certain identification with the poor-est, as mentioned above. The cry of the poor is heard by God, yes, even the curse of the poor (Si 4:5; Ex 22:22). As for the New Testament, the cry of Jesus on the cross is sometimes said to continue in the cry of the poor. That cry comes from the seventy percent who are underprivileged and undernourished--the majority of whom can hardly survive, let alone live in dignity. The Bible demands our solidarity with them. They are the present-day locus where we meet Christ. It is in them that Jesus is to be found. We may need a conversion of heart and a radical change of our lifestyle in order to live up to this demand of the time. There is a use of the word freedom which is meant to deny just that. Nuclear weapons are claimed to protect freedom, which, in fact, means only "our" freedom, and that, in turn, stands really for our power and affluence. These self-interests, however, are maintained at the expense of other people's lives, and their "protection," therefore, runs counter to the actual demands of the Gospel. Integral or universal liberation requires that the poor are not the only ones liberated, and that liberation is not understood only economically. There may be certain biases sometimes, which do harm to the integrity or wholeness of liberation. It shows the greatness of a theologian like Leonardo Boff, that for example, in his volume Jesus Christ the Libera-tor he writes some pertinent pages precisely to denounce such a bias. Structural Sin Recently another aspect of integral liberation has come to the fore, namely, liberation from "social sin" or "structural evil." Of course, Christians have always known of sins in the social sphere, and also of the social aspect of every sin. It is new, however, to call social struc-tures themselves sinful. It has taken some controversy to clarify that the word "sin" in this expression is used in analogy with the personal sin we had known hitherto. Both good and bad actions can embody and per-petuate themselves in structures, which are accordingly good or bad, and, once established, are the source of further good or evil. So certain structures are called sinful, while they originate from and in turn lead to personal sin. They definitely restrict our freedom and often they ten- Review for Religious, November-December 1990 der us unfree to a considerable extent. The individual is in those cases often both cause and victim. Those who create these structures or main-tain them or profit from them or even in complicity tolerate them are guilty. This social sin is part of the mystery of iniquity that cries for libera-tion towards the Lord of history and brings out the human race's need of redemption. It is by no means easy to admit this sin for oneself, to free oneself from its entanglement, and to work for liberation of others on this level--far more difficult usually than in the sphere of personal sin. One can be certain that attempts towards changing these structures will bring 'with them many personal inconveniences, hardships, threats, loss of friends and relations, in certain countries imprisonment, torture, and even death, as many have found out, especially in the last decades. When I interpreted freedom as a readiness to accept suffering, I had these kinds of situations in mind. A person who is not free to suffer cannot think of working for liberation from structural sin. Vulnerability is a genu-ine assurance that we are in touch with reality, truth, and love, not self-interest. Here, more than anywhere else, it is important to realize that God is the chief agent in overcoming evil, and that we are cooperators with him, instruments in his hand, branches of the vine. Without this con-viction coming from faith, the challenge would overwhelm us. A Church which is too much concerned about itself, its own image, and its own problems cannot tackle this task, just as an individual who is too egocentric cannot engage in it. The Church has to proclaim the Lord Jesus, above all in his paschal mystery of death and resurrection, and not proclaim itself. Liberation in its many aspects requires the over-coming of all self-centeredness, both in the individual and in the Church. The more the Church is focused on the person of Jesus and not on itself, the more the Church will be able to discover what men and women of other religions and other visions are doing for liberation, and to cooper-ate with them. It seems to be a special task of the religious to help the Church to focus on our Lord and Savior and thereby to be open to all people of good will who pledge themselves to liberation. Obviously, we can only help the Church in this by doing it ourselves and by being loyal to our Church. Dangers Much praise has been sung to the spirituality of liberation in this ar-ticle, and rightly so. Some dangers must be mentioned also. Not to cool down our commitment, but to safeguard it. I do not want to elaborate on these dangers, yet it seems unfair to me to pass them by completely. SpiritualiO, of Liberation / ~135 So let me just give the headings as I found them in an article ("Como Fazer Teologia da Libertac~o," published by: Vozes, Petr6polis, Bra-zil 1986) written jointly by Clodovis and Leonardo Boff: - a neglect of the mystical roots - a rampage of the political aspects - a stifling of the faith through too much discussion - a tendency towards exclusiveness and absolutism - an exaggerated emphasis on the discontinuity with the tradition and an underestimating of the continuity - a negligence of a serious dialogue and discussion with other spirituali-ties -a lack of care to make the theology of liberation understandable and pal-atable to the authority in the Church, which delays the conversion of the Church to the poor. After having rushed through these dangers, let me close with a quota-tion from the encyclical of Pope John Paul Redemptoris Mater and with a word of hope. Mary "Drawing from Mary's heart, from the depth of her faith expressed in the words of the Magnificat, the Church renews ever more effectively in herself the awareness that the truth about God who saves, the truth about God who is the source of every girl, cannot be separated from the manifestation of his love of preference for the poor and the humble, that love, which, celebrated in the Magnificat, is later expressed in the words and works of Jesus. The Church is thus aware--and at the present time this awareness is particularly vivid--not only that these two elements of the message contained in the Magnificat cannot be separated, but also that there is a duty to safeguard carefully the importance of 'the poor' and of 'the option in favor of the poor' in the word of the living God. These are matters and questions intimately connected with the Christian meaning of freedom and liberation. 'Mary is totally dependent upon God and completely directed towards him, and, at the side of her Son, she is the most perfect image of freedom and of the liberation of humanity and of the universe. It is to her as Mother and Model that the Church must look in order to understand in its completeness the meaning of her own mission' " (Nr.37). Hope It is common among the theologians.of liberation to stress the hope Review for Religious, November-December 1990 that is manifest in their movement. To work and to struggle for libera-tion for any length of time is impossible without authentic hope. This hope is not identical with optimism. Optimism emphasizes the positive aspects and draws attention away from the negative, tends to underesti- ¯ mate the latter, and even to repress them. It may be a pleasant attitude, but it is often not quite realistic. Hope, on the contrary, faces the difficulties and the pain, yet does not lose heart. Hope is more than an impulse. Hope makes us faithful and persevering. Hope discloses a great strength, which is beyond us. Hope is able to sail its own course with every wind, even with head wind. Charles P6guy portrays hope as a little girl between her two big sisters who hold her by the hand. It looks as if the two big ones lead the little one, but the opposite is true. It is hope that keeps faith and love alive, young, and vital. The basic communities and the other groups that embody the libera-tion movement are centers of hope. This hope is not an acquired, but an infused virtue--that means beyond us and yet in us as a divine gift, as a fruit of the paschal mystery. "Through him (Christ) you have confi-dence in God, who raised him from the dead and gave him glory, so that your faith is hope in God" (1 P 1:21). Compline Salvation danced In the dark Of Mary's womb, Was paid with blood On a black hill, Then rose for all From death's dead tomb. So I must trust Your grace unseen Till from life's grave I, too, am freed. Kathleen T. Choi 1706Waianuenue Avenue Hilo, Hawaii 96720 Liberation and the Liturgical Year ¯ Susan Anderson Kerr, Ph.D. Susan Anderson Kerr is an Oblate of St. Louis Priory in Petersham, Massachusetts. Her address is 4209 Avenue F; Austin, Texas 78751. When we observe the culture around us and see the emptin~s_.s of living apari ~?o~m ]he liturgical year, we see that the liturgical ~ar is hot some pious preoccupation of people with a taste for the archaic. It is a ques-tion of survival, of urgent importance for an age hungry for liberation, and respectful of those who survive. It is a question of freedom, of vast relevance for our culture which reveres freedom, struggles with addic-tions, and seeks personal liberation from materialism, sexism, racism, and a host of enslaving isms. In an age of decline and disintegration such as ours, many people turn to the inner life to exert the yearning for goodness and truth and beauty which in another era would have had a greater possibility for ex-ternal expression in politics or art or education. The pain of the loss of knowing how to do things--how to accomplish civic reforms, how to com-bat drugs and violence, how to overcome the hedonism and cynicism of our time---can send people on a spiritual quest. So we have an outpour-ing of books on the inner life--Jungian psychology, individual prayer techniques, popularizations of the great works of Catholic spirituality. But if we attend only to our individual spiritual growth while neglect-ing liturgical spirituality, we try to walk to the heavenly Jerusalem on one leg. The Lord does not intend for us to so hobble. Part of the reason we neglect the liturgy is that it effects our healing so circuitously, circling like the rings around the trunk of the tree. We want results now; we are on fire with intentions. Romano Guardini once observed that liturgy is much more like a forest where one wanders than a gymnasium where with fixed purpose one exercises certain muscles. 837 Review for Religious, November-December 1990 Another reason we slight the liturgy is that those great masters of the spiri-tual life--St. Teresa of Avila, St. John of the Cross, St. Ignatius of Loyola--who are such help to us wrote at a time of liturgical decadence when desiccated liturgies were an obstacle to spiritual growth. When we try to walk on both legs, liturgical as well as individual prayer, other saints will help us, saints who wrote when liturgy and spiri-tuality were not at cross purposes, saints in the monastic tradition, like St. Benedict and St. Gertrude. The Vatican documents of the renewal of the liturgy are also useful in correcting our understanding of the value of liturgy. Personal prayer is a logical place to begin as one searches for encoun-ter with God, but to linger there is to remain a spiritual adolescent. To relate the liturgical year to the individual's private life of prayer is to ad-dress a practical question: why pay attention to the liturgical year? If I am learning centering prayer, or the Jesus prayer, or my Enneagram num-ber, or how to relate to my anima or animus, why do I need the liturgi-cal year? Is this not a formal structure which has nothing at all to do with the rich spontaneity and diversity of my inner life? "Blessed be the Lord, the God of Israel; he has come to his people and set them free," the Church sings each morning. And so God has. The liturgical year invites us into liberation in three areas: freedom from chronos and cyclical time, freedom from nature, and freedom from the tyranny of our unconscious. First, the liturgical year helps shape our understanding of the mean-ing of time. It removes us from the pagan sense of time as repetition, nature's cycle endlessly repeating itself, and from the atheist's concep-tion of time as pure chronos. It introduces a.God-ward momentum and shaping of time, an upwardly moving spiral. Empty repetition and end-less succession are replaced by repetition at higher levels on the spiral, by kairos punctuating chronos, or chronos building to and being shaped by kairos. Like a lovely shell, the liturgical year has been extruded cen-tury after long century as the Church needed more space in which to dwell. The liturgical year gives us a common memory. This happens on sev-eral levels: on the cosmic level, as Pierre Teiihard de Chardin describes, the Church evolves towards the omega point; on the historic level as the Church organizes time before and after our Lord's death; on the personal level as our individual existence takes its place in this great spiral flow-ing towards God. Intimately linked with our common memory of the liturgical year is Liberation and the Liturgical Year the common authority which establishes it. The Church has to maintain the central focus on the life of Christ, balancing between a proliferation of feast days which would result in a loss of shape to the Church year, and the impulse to celebration which led one desert father to exult "Life is an eternal festival." Second, the liturgical year frees us from romantic identification with nature. But what does the liturgical year express about our relationship to nature? Partly organized around the sun, partly around the moon, the liturgical year demonstrates as Odo Casel remarks, the maxim "Grace builds on nature." The week evolved from divisions of the lunar cycle, for the Hebrew festal calendar, like the first calendar cycles of most primi-tive religions, was lunar. The Jewish lunar months were divided by sab-batical weeks; the Mosaic sabbath is based on 7 as a perfect number, ex-pressing completion and fullness. The Easter celebration evolved from the Jewish liturgical cycle which had gradually replaced nature rituals with festivals commemorating Israel's history of salvation. Unlike the polytheistic peoples around them who made the powers of nature divine, the Jewish people came to see nature as a tool and im-age of the spiritual. The feast of Pesach had nomadic roots, for it is cele-brated at the first full moon after the vernal equinox when a young male lamb is sacrificed, roasted, and eaten. But its central focus is the reen-actment of the deliverance of Israelfrom the hands of Egypt. When Je-sus transformed this feast by identifying himself with the sacrificial lamb, he lifted it from its local origin and universalized it into the feast of the salvation of all human beings of every time. But Easter does not thereby shed its lunar and historical associations. Thus the cyclic observance of the vernal equinox is lifted first into the hope of renewal in human history recalled in the Passover festival, and then universalized in the.final eschatological hope of Easter. We see a similarl appropriation of ~natureir~ the use of the sun in the liturgical year. Jesus, as the light of the world, was identified with the sun. His birth is celebrated at the winter solstice, transforming and uni-versalizing the pagan festival of the sol invictus. His conception is thus celebrated nine months earlier near the vernal equinox, March 25. Since according to Luke 1:26, John the Baptist was conceived six months be-' fore Jesus, his conception is observed at the autumnal equinox, and his birth, by extension, at the summer solstice June 24. Thus the two equi-noxes and the two solstices are brought into the Christian year and trans-formed from cyclic rituals to feasts of the birth of life and light into this world's darkness. ~140 / Review for Religious, November-December 1990 John the Baptist's feasts are also associated with the sun's activity; in the fourth century they were seen as cosmic confirmation of John's own words "He must increase; but I must decrease" (Jn 3:30). The prayer of the Divine Office is also organized around the sun; the two most important hours occur when the sun rises and when it sets. Here the beginning and ending of the day are bound up with the life of the Lord: the sun's rising is an image of his rising from the dead; vespers, when the sun sets, the beginning of a new day, is eucharistic in charac-ter, full of thanksgiving for the light that has been. The Church uses nature as the basis for sacred time, but does not re-main encased within natural rhythms. The liturgical year steers the Chris-tian away from romantic identification with nature, from new age senti-mentality about its saving power, as well as from Gnostic fear of the ca-pacity of creation to convey divine purposes. Like an enormous tree nour-ished with roots deep in our personal and collective unconscious, it also teaches respect for natural processes, for slow growth, for rhythms be-yond human control. Finally, the liturgical year unfetters our freedom from the tyranny of our unconscious. When Moses stood before the burning bush aiad saw that this was holy ground, he entered a new place to live. That place is prayer; it is man's response to God's holiness and comes into existence only in communion with God. We can compare this to the common ground that exists between two friends; when I get to know someone, drawn by mutual interests or complementary personalities, a territory of shared experience grows between us. As the holy ground between man and the divine extends in time, so is born the inner liturgical year. "Moses, Moses, take off your shoes, for the place on which you stand is holy ground" (Ex 3:5). Liturgy must be interior as well as exterior for it to be whole. The structures of worship which ancient Israel built in response to Moses' ex-perience of the transcendence of God--first the altar of sacrifice, later a mobile tabernacle, and the Sabbath--were images of inner freedom, of the oblation of self to Yahweh, to Being. The early Church absorbed the Jewish sabbath into a festival of the Lord's day, Sunday, a day to celebrate the Resurrection of Christ, the fulfillment of the Incarnation which was implicit in the assent to crea-tion celebrated on the sabbath. The Documents of Vatican II remind us "The Lord's Day is the original feast day, and it should be proposed to the faithful and taught to them so that it may become in fact a day of joy and of freedom from work" (Vol. I p. 29). Liberation and the Liturgical Year In Sunday is the seed of all later festivals. We encounter Sunday first in the gospels, for this is the day of the Resurrection, the day the Lord appeared to Mary Magdalene. Also in Scripture we find the first repeti-tion of Sunday, for it was one week later after his Resurrection that the Lord appeared to Thomas and the company assembled in the upper room and breathed his peace on them. Thus, in the book of Acts, the early Church observes Sunday as a day to celebrate the Resurrection; not a day of rest, not a continuation of the Jewish sabbath, but a new day, an eighth day, of completion, and a first day of rejoicing in creation. To celebrate Sunday witnesses to our busy and harried society of the freedom and goodness of the Christian vision of life. A reform of Sun-day can only come from within the individual life; the era of puritanical prohibitions has done its job of proposing to us what a day of rest would look like, and now it is up to us to practice an asceticism of time so that shopping, banking, errands, and office work can be laid aside for one day. A day to affirm the goodness of creation means a day for play, for friends, for music, for nature. This is a gift from God. Accepting it wit-nesses to the eternal festival latent behind the celebration of this special day. The Christian who observes Sunday as a day of joy and freedom from work learns the interconnectedness of time, for such a Sunday be-gins the night before. As the Jews began to observe a holy day with the vigil of the preceding night, so the Christian liturgical year interweaves all time around this structure of the week, each festival held in place by the surrounding times. Liturgical memory looks backwards and forwards as it draws strength for the present. Sunday looks back to divine assent to creation, and forward to the heavenly rest we anticipate. Celebrating Sunday nourishes our freedom to set aside work and worry and simply be. Liturgical memory forms the whole memory. People who can set aside their personal agenda and enter into the communal celebration, or who make the communal agenda their personal concern, are the ones who then can place their individual psychological problems in a wide con-text. They are not locked into the present, because they are formed to see it held in a web between past and future, nor are they confined to their own personal viewpoint however fully it might be absorbing them. In other words, the liturgy is a school of detachment, a word which in English sounds cold and lonely. I am told the German equivalent, abgeschiedenheit, would be translated as "serene freedom of the spirit filled with utter trust in God." That is the result of a memory formed 849 / Review for Religious, November-December 1990 by the liturgy. But it is accomplished not directly and didactically, but symbolically and by example. Thus the liturgy teaches us that every feast must be preceded by a period of preparation: no Sunday without week-days, no Christmas without Advent, no Easter without Lent, and plenty of ordinary time to allow the mysteries of Christ to be absorbed and di-gested. Here is delayed gratification made visible. But this is more than just training in patience for high points. St. Cath-erine of Siena once said "All the way to heaven is heaven." That is what the liturgy says tool Advent and Lent, ordinary time, all the small roots of morning and evening prayer absorb water for the tree's growth which is celebrated at Christmas, Easter, and Pentecost. In the liturgical year, the Church has given us not only a survival strat-egy, but a place to grow as well. Aidan Kavanaugh wrote "Liberators accomplish only half their task then they liberate. The other half of their labor is to provide a normal place, a free place, on which the liberated may land." That normal, free place, that place out of the reach of the forces of the enemy, of the trendy, the selfish, the trivial, is the liturgi-cal year. Morning Praise At my window the willow filigrees the gold of dawn and hangs it on my wall; trembling fronds lose themselves in the sudden glow that,starset and sunrise trace upon the morning. I, too, in this hour am lost in grace-gold shower that spills upon the desert of my heart. Sister Elizabeth deSales Dee, S.S.J. St. Joseph Convent 7300 Torresdale Avenue Philadelphia, Pennsylvania 19136 The Vowed Life as a Peace Story to Be Told Patricia McCarthy, C.N.D. Sister Patricia McCarthy, a member of the Congregation of Notre Dame, has worked with the poor in the field of education, particularly with homeless and abused chil-dren, where the ministry of nonviolence is a daily challenge. Her address is Congre-gation of Notre Dame; 41 Cole Street; East Providence, Rhode Island 02914. Among the international travel ads which I faithfully read, I have noticed recently a new type of tour being offered. It is possible to visit northern Europe on a special story-telling trip. Imagine going from thatched roof cottages to desolate moors and dangerous harbors, and all the time lis-tening. The accents would change with the landscapes, and both would change the stories. Just listen and hear the true nature of the countries and its people come out in ways more real than through the products at the duty-free shops in the airports. Then I began to wonder. Will we be able to t~il stories that will en-thrall and inspire? Do we live passionately enough to be sources of hope and interest for future generations? Will others tell and retell with drama and humor the stories of our lives? Thomas Hardy said: "A story must be exceptional enough to justify its telling. We storytellers are all ancient mariners, and none of us is justified in stopping wedding guests unless he has something more unusual to relate than the ordinary experiences of every man and woman." I continue to wonder. What stories in our generation will justify their retelling? Could it be that when the story of peace is told, religious men and women will be talked about? When storytellers explain poverty, celi-bacy, and obedience, will they tell the tales of people so in love with God and with their'brothers and sisters that they wrapped this love in freely 843 Review for Religious, November-December 1990 chosen vows? When the listeners ask what gave these religious such passion and why were they so free to love, will the storyteller have to risk entering into mystery? Will the story become one with the story and mystery of Jesus? There is no reasonable explanation for a God who loved so passion-ately that he came and lived among us. He taught us and healed us and blessed us. Finally, he gave himself on the cross for our redemption. Will the story of religious life make sense only within this context of aban-donment? Is not religious life the lived expression of Jesus' surrender to God for love of us? Gandhi said that Jesus Christ's offering of himself on the cross for the redemption of the world was the only perfect act of nonviolence the world has ever seen. Since the very nature of religious life is to be inti-mately united with Jesus, the vows can be considered in light of his su-preme act of peacemaking. The vows can be seen as living realities that transform people into peacemakers for our fragile world. We search high and low for ways of being peace in the midst of hostility and violence. Perhaps if we go deeply into the vows we will see not only the founda-tion of religious life but the foundation of peacemaking as well. Freedom In Poverty We begin in poverty. Scripture has always put God in the midst of the poor. In the Old Testament, Yahweh compassionately watched over the anawim. To the childless, children were given; to the homeless, a chosen land; to the hungry, manna in the desert; to the lost, visions and dreams to follow. When the fullness of time came, a wretched stable was the birthplace of the Son of God. His first experience of life was as a refugee in a foreign land. And his first teaching began, "Blessed are the poor in spirit." We choose poverty because Jesus did. Poverty and want are evils when people are denied the necessary elements of survival. It makes no sense to embrace a vow of poverty. The vows do not make sense, they make love. We risk letting go of material security as a source of com-fort and happiness so that Christ can be our only fulfillment. What does this have to do with peace? Everything. If Christ is our wealth, we have nothing on this earth to defend, including our own lives. Lack of desire to defend one's possessions or life would make war improbable and unnecessary. Wars are usually started for economic rea-sons. Either an aggressor is greedy for the acquisition of land or eco-nomic control, or an oppressed people revolt against the denial of their The Vowed Life as a Peace Story to Be Told / 845 right to a decent standard of life. The slogans of freedom cover the at-tempts ~to maintain or increase power. During Texas' war for indepen-dence, a young soldier wrote home to his family: "If we win, we'll all be rich. If we lose, we will have died for freedom." Greed-induced vio-lence leaves millions of shattered and broken lives in its wake. Bring into this picture an army of people vowing poverty. It would remind one of the pages from a pre-primer book where the child has to pick out what is wrong with the picture. What does not fit in with every-thing else? A vow of poverty is countercultural when greed is the ear-mark of the culture. Why would someone with nothing to defend go to war for the purpose of defense? Of course, war is merely the outward extreme expression of the daily violence abiding in the human heart. It is, therefore, from the heart that the message of peace must come, not from a treaty or constitution. It is also within the heart that the vow of poverty must be embraced and shaped. If we can say that as individuals we own nothing, then whatever we use or manage is done in the spirit of stewardship. And then if some-one asks for our coat, we do not fight; we give the scarf and hat as well. If people are hungry and we have food, we share what we have with them. A vow of poverty should lead us to the reality that all we possess is gift. Because we know personally the Giver of all gifts, our poverty seeks expression through trust in God and willingness to share with the children of God. Fidelity to the vow is not marked by having nothing, but by desiring nothing and by a willingness to share freely whatever we have. Conscious today that too many of our brothers and sisters are starv-ing, we should be willing to live a poverty more radical than anything that has been seen for decades. The world needs our example and our leadership in order to break the cycle of a few using for themselves alone the natural resources intended for all. Strong statements about sharing the fruits of the earth are necessary in a world so consumed by the ac-quisition of wealth. We distort and falsify Christ's plea to us not to worry about what we are to eat or wear when we stockpile the necessities of life. We can do that and have what we think we need day after day, but we miss out on even knowing how beautifully we would have been dressed and cared for, as the lilies of the field and the birds of the air. It is a small step from stockpiling consumer goods to stockpiling arms. Emptying our hands does not automatically produce a disarmed Review for Religious, November-December 1990 heart, but clutching hands certainly will prevent us from having one. We need the practice of trusting God for our daily bread so that when the time comes to trust in God for our very lives, the surrender and faith will be there. Our times are crying for people with disarmed and trusting hearts. Our times are crying for those of us who have vowed poverty to embrace it radically. Our times are crying for us to live out daily the reality that our only need is God. This is what a life of poverty calls us to. This is the truth of a vow of poverty. Gandhi used to live "experi-ments in truth." It was his way of learning. By this he meant an unin-terrupted progression from insight to action to insight, and so forth. He would get an idea, try it out in practice, refine his first idea because of the action, then go to another action, and so on. Poverty is a lifetime ex-periment in truth. We feel inspired to trust God a little and release our hold on something. This leads to more trust and the release of something else, and so on. It's lifetime because we will never run out of things to let go of! The wonder of our God is that we never miss the small insignificant tokens we have parted with. We are showered with the very life of God and have no needs outside of this. We learn to yearn for God alone, not merely the gifts of God. Even when God seems absent from us, we have no desire to seek consolation from any other source. Perhaps, then, we receive our dearest treasure, a poor heart, totally dependent upon God for everything. Only then, when we have nothing left to defend, will we have been formed into peacemakers after the model of Jesus. In our communion with each other and with those who came before us, we see that the peacemakers who stand out in any century were peo-ple of great poverty. Francis, the poor man of Assisi; Mahatma Gandhi, the Hindu ascetic; Thomas Merton, the trappist; Dorothy Day, the bow-ery dweller. They are not remembered because they were deprived, they are remembered because they had so much to give. Passion ,in Celibacy If a generous heart is the sign of vowed poverty, then a passionate heart is the sign of vowed celibacy. The vow of celibacy is at the core of the consecrated life, just as surrender to the passionate love of Christ is at the core of peacemaking. We cannot expect people to give up their arms of defense against other people and to be vulnerable to human ha-tred, unless we have first taught them to let go of their defenses against God and to be vulnerable to infinite love. The vulnerability of passion-ate love embodies an act of complete trust in God, of counting on God The Vowed Life as a Peace Story to Be Told to never abandon us or leave us unprotected. Celibacy calls us to this surrender of our very bodies to the love of God. By this vow, we witness in flesh to the power of God to fulfill us and protect us. This same passionate surrender is required of all peace-makers. They need not be celibate, but they do need to enflesh the pri-macy of the power and love of God. It is this primacy of God which is the clear witness of the vow of celibacy. It is the same primacy of the love and power of God to which Christ surrendered. Peace is not within our grasp without the act of redemption of Christ on Calvary. No matter how selfless or sacrificing we might be, the ability to take on and endure violence in order to heal it is the work of God. We share in this work, we are the hands and feet of Christ to-day, but he is the source and fountain of all life, of all power, and of all power to endure violence without retaliation. The clearest and most visible example of this power of God taking flesh is Mary, the virgin Mother of God. Mary trusted so completely in the power of God that she surrendered in faith to bear the Son of God in her womb. Within her body Mary carried Jesus Christ who was con-ceived by the Holy Spirit. "The Holy Spirit will come upon you and the power of the Most High will overshadow you" (Lk i:35). "The fact that she conceived without human means is the sign that she conceived by the power of God. And in this she is a sign to us of our own radical de-pendence on God and on our union with him in grace in order to bear fruit or to do anything that is divinely life-giving on earth "(David Knight, Mary in an Adult Church Memphis: His Way Communications, 1988, pp. 22,23). We see in Mary the cost and the fruit of faith-filled trust in God. We see in Mary a woman confident of God"s continual care and boundless love. We see in Mary a woman whose heart was turned into a furnace of love by the Holy Spirit. We can expect the same care and mercy from God, we can expect to receive the same fire of love from the Holy Spirit. Belief in this fact alone should put us in the front lines of peacemaking. If God is the power of our lives, we do not put our trust in other earthly powers. We have vowed celibacy, consecrated our bodies to virginity. This is a visible em-bodiment of receptivity and of openness to God's working with us and through us. It is a physical expression of total surrender to the loved one; it is the abandonment of all defenses and reserves in the presence of the beloved. It is a matter of the heart. Gandhi taught that nonviolence, also, was a matter of the heart, not 848 / Review for Religious, November-December 1990 to be arrived at by an appeal to the brain: that it was a matter of passion not of policy. Celibacy is not an intellectual thing but a passionate physi-cal stance. A life vowed to celibacy, within which we surrender in love the essence of our being, forms a heart capable of understanding and em-bracing nonviolence. A heart can be formed in many ways. Some of the ascetical prac-tices that used to accompany a study of the vows can be seen now as fash-ioning hearts for peacemaking. Fasting--one of the oldest practices in religious tradition---can be undertaken as a concrete expression of the pri-macy of God in our life. It is far more an act of worship than an act of discipline, To live the reality that God is the power of our lives, at times we freely abandon or fast from food or other material things. When the needs of our bodies call out, we turn ourselves over to God in whose pres-ence we abide. It is not the abstaining from food which is holy, but the turning of our attention and desires to God. Prayer becomes the love language of the celibate. When we love someone, there is no end to the variety of ways in which we say it. All the different prayer styles and prayer methods are merely different ways of giving and receiving love. Celibacy is about our bodies, and when we use these bodies to kneel in prayer we give expression to the reality of the vow. Just the act of kneeling is in itself a commitment of our body, a sign of intimate surrender to God. Such signs are important to us and to God. We are human and we yearn to give human expression to our desires; and God is pleased to see us using the gift of our bodies in worship. As important as these signs of surrender are, we go beyond them, we move from sign to reality when we participate in the Eucharistic celebration of Calvary. Union with Christ in the Mass is the commitment of our body to receive his Body. We share in Christ's moment of intimate surrender to his God. We offer ourselves with Christ to be transformed more and more into his Body. In this union we find the fulfillment of our celibacy. Out of this union, we are sent in service to our brothers and sisters. And this can be the passionate physical expression of love that physical penances were to some of the saints. Physical forms of penance are not outdated; they have j.ust changed style to adjust to the times. One (~f the saints stood in ice water up to his neck one winter's night, doing pen-ance for a friend who was considering sinful choices. Standing in the cold at the water's edge for hours in protest at a nuclear submarine base can be our modern day version of the same experience. Patiently endur-ing the irascible tempers and dispositions in a shelter for the homeless The Vowed Life as a Peace Story to Be Told or a soupline can be the discipline of the senses in this age. The ideal of self-sacrificing love can be applied to living within the noise and dan-ger of inner cities in order to be with today's anawim. Especially for those overcommitted and overworked religious who give beyond their limits, the ascetism most expressive of a loving re-sponse to God might be to fast from work one day a week. Work is any-thing that we think has to be done. Let it all go for a day. Keep holy the Lord's day. If we believe God is our source of power, let our bodies and minds and energies show it by giving the time to being, not doing. It is possible .this practice could be far more productive than ceaseless days of activity. Surely, a day of rest with God is a practical act of trust, one that might lead us to become even more practical and venture into the constant trust required for a vow of obedience. Stewardship of Self in Obedience Having emptied our hands through poverty and surrendered our hearts in celibacy, we receive from God through obedience the assurance that all is done in accord with the divine plan. Every peacemaker must be obedient, but religious have the value of a vow. This vow does not just mean doing what someone else tells you to do. Doing what some-one else tells you is simple; it may not be easy, but it is simple and un-complicated. That is not what the vow of obedience calls us to. Obedience calls us to listen to God's designs for us, to listen to God's desires for us. Obe-dience calls us to stewardship of the gift of God that is ourselves. If we value the goods and fruits of our fragile earth so much that we h01d them in stewardship, how much more should we value ourselves and hold our-selves in stewardship. We are a gift of God, to be treasured and used ac-cording to the plan of God. Obedience encourages us to take seriously this call to stewardship of self. The first step of the obedient peacemaker is to listen to this call. It will be unique to each person. No one else can listen to it for us. Per-haps the most common sin of disobedience today is not the failure to do what is asked by lawful authority, but the failure to do what, over and above this, is asked by God. Probably few of us consciously, explicitly deny God. But do we consistently hear God's requests and calls? When we are consumed by plans and activities of our own, are we willing to change and to let God move us in another direction? If we have vowed celibacy and said that God is the source of power in our lives, are we able to live that out by listening for .the delicate, unobtrusive voice of God day after day and abandoning all our ideas and hopes to the ideas Review for Religious, November-December 1990 and hopes of God? How do we hear God? We open ourselves to being vulnerable and receptive to all the known and unknown ways God speaks: our own in-stincts and desires, needs of others, realities of life over which we have no control, requests from our communities, and decisions by those who minister through authority. It would be easier if we were the only judge of what is the desire of God. We have been created for community with God's people, and in community we hear and discern the will of God. We pray in our rooms and in our churches and in our workplaces. We seek the face of God, alone and with others. Obedience is not a private vow, it is a communal one. In the base communities of Latin America, private prayer and com-munal reflection on the word of God precede any action for justice. Peo-ple do not act on their own instincts alone; plans for action are submit-ted to the reflection and discussion of the community. There is always a person or group to whom every individual is accountable. This is a cru-cial factor in these communities, a factor which is most difficult for groups in North America who have tried to model the base community style. The same principle of responsible accountability was applied by Gandhi in his struggle for freedom in India and by Martin Luther King, Jr. in his struggle for freedom from racism in America. In their actions for nonviolent resistance, both men taught their people to begin with prayer and fasting. Individuals were prepared step-by-step for the action that had been decided upon. Not everyone was permitted to participate if the leaders thought they were not ready. Obedience to the plan was crucial. Today when civil disobedience is done correctly, all those partici-pating should have another person or group to whom they are responsi-ble. If that person or group tells an individual to discontinue the action, that person is expected to obey. If we are serious about the work of jus-tice then we had better be serious about obedience. Civil disobedience for individuals with vows of obedience is a won-derful opportunity to exercise the vow. Civil disobedience must always be an expression of personal commitment, not just of association with a just cause. For a religious to accept the call to steffardship of self so seriously that there may be a time when the law of God takes precedence over the law of society, a process of discernment should be a prerequi-site to the action. Prayer, study, and discussion should operate on three levels: personal, local, and provincial. Discernment on all three levels The Vowed L

Issue 3.3 of the Review for Religious, 1944. ; MAY 15, 19,44 ~Voi~UME,.III Ri VI, I W' FOR :i I LIGIO,,US .VoLuMEIII :" MAY 15, 1944 ~ NUMBER3 ° ONTENTS GOOD CONFESSIONS AND BETTI~R CONFESSIONS--r ~ 'Gerald Kelly, S.J.' ; . 145 THE-QUEgTION OF VOTING Edwin F. Healy, SIJ . 158 CONCERNING BOOKLETS . . . . . THE CARE OF SICK RELIGIOUS Adam C. Ellis. S.3 . " 1"67 WE SALUTE THEE. MARY'. MOTHER OF GODT William B. Fah~rty, S.3. " ' .,'175 WHO IS THIS RODRIGUEZ? Augustin~e Klaas, S.J. " " 181~ ,TWO HYMNS TO ~MARY" -F~ran¢is N. Korth.-S.J . . 1.92 COMMUNICATIONS .(On Retreats and Vocations) . : 198 BOOK REVIEWS~ (Edited by Clement DeMuth S.3.)-- The Man"from Rocca Sicca: Subdeaconship~ Masyk.noll Mission Let~ .tars: Cardinal Mercier's Conferences: Venerable Vincent Pallotti: "Con- " , ,else Catholic' Dictionary: Lourdes Interpreted by the Salve-Re~ina; Teaching Confraternity Classes: Publlc,Speaking . ! . . ~ ¯ . 204 DECISIONS OF THE HOLY SEE OF INTEREST TO" RELIGIOU~ ~210~ BOOKS -RECEIVED . 2110 QUESTIONS AND ANSWERS 2-1. Redecorating Stations of the Cross . x . '.;. ~ . . . : 212 22. Visit Required for Gfiining Indulgence . 23. Use of Standard Time for Eucharistic Fast . 213 "L24. Voting in Chapter Elections . 214' ' 25. ,Co~frat~rnity of Pil~rim~ " " 2"15 26. Religious Attending Motion Pictures ~. . . : . ". 215 bUR CONTRIBUTORS " ' " . '. ' REVIEW FOR RELIGIOUS, May, 1944: Vol. III, No. 3. PubliShed bbmon~hly: January. March, May, July, September; and November at the,~College, Press. _606 Harrison~Street, Topeka, .Kansas, by St. Mary's College, St. MarTs, Kansas, with' ecclesiastical approbation. E~tered as second class matter January 15, q9~2, at the Post Office, Topeka, Kansas, under'the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine~,Ellard, S.J., ~erald Kellyl S~.3,.~ Copyright, 1944, by Adam C. Ellis. Permission is hereby granted for quotations .6f reasonable length, provided due ~:redit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S.A Before writing to us, please consult notice on ins;de back cover. ood Con essions and Bet: :er Cont:essions Gerald Kelly, S.J. ~'~ELIGIOUS not infrequently exp.eo~ience a vague sense |'r~ of dissatisfaction with their conKssions. They must confess .weekly, generally at a certain time, even though they are not in the mood. At times they must make a rather hasty immediate preparation for confession. Their sins are usually "small sins"; in fact, it is often difficult to fodus on any really, definite sins to confess.A certdin 0 amount of routine seems unavoidable; yet routine confes-sions are strongly condemned by many spiritual writers. Finally, most religious have read or heard of the many advantages of frequent devotional confession, and the~. want to reap some of these fruits ~:or themselves. Yet, despite their holy desires, they sometimes fail to see any good effects of their confessions; they are even inclined to wonder if their confessions are not entirely fruitless. Very likely there is no absolute remedy for a sense of dissatisfaction in those who are striving for perfection. Some dissatisfaction is natural, even helpful. But this holy sense of dissatisfaction is different from discourag.ement, worry, or a vague feeling of uneasiness. As much as pos-sible, the dissatisfaction should be clearly defined, because only then can it be used constructively as a stepping stone to the attainment .of one's ideals. My purpose in the present article is to propose a few rules that may help religious to clafif.y any dissatisfaction they may feel with their confessions ~nd to give some defi-nite direction to their efforts for self-improvement. The" rules enunciate nothing new. No doubt most religious- 145 GERALD KELLY ,. Review for Religious know them well; yet I believe that some fail to apply them and that the results of not applying them .are a waste of effort, a lack Of perfect peace of mind, and sometimes dis-couragement. If all religious, from the novitiate onward, would observe these rules faithfully, they would be'much more satisfied, with their confessions and would reap many definite advantage~ from them. Four Rules In formulating these rules, and in commenting on them, I am limiting the subject to the devotional confession, as this is the type of confession that. religious most frequently make. Keeping this in mind--namely, that we are speaking only of the devotional confession--we can state the rules as follows: Rule I: Be sure to confess, at least ;n a 9eneral way, some real, subjective s;n that you have cerfainly comm;Hed. Rule 2: Have genu;ne, supernatural con÷r;÷;on, a÷ least ;mperfecf, for some s;n ;nclucled ;n your confess;on. Rule 3: Be willincj to accept and to perform anyjustly ;reposed penance. Rule 4: Try to sanctify yourself ÷hroucjh confess;on by cult;vaf;ng a more e~fecfive purpose of amendment. It may be well to call attention immediately to the decided, difference between the first three rifles andthe fourth rule. The first three express minimum essentials; the fourth .expresses an ideal. A penitent who observes the first three rules makes a good.confession; a penitent who keeps not only the first three, but also the fourth, makes a better confession. This is an important distinction. Our. ideal, of course, is to make the better confession; but there is a great deal of consolation and peace of mind in knowing that our confessions are good, even though they could be better. A good confession o~ devotion always produces some grace in the soul. 146 May, 1944 GOOD'CONFESSIONS AND BETTER CON~ESSIONS A GOOD. CONFESSION It would be a wise policy .fob every religious to have a two-fold aim in making hisconfessions: first, to make a 9ood confession by fulfilling all minimum essentials; and °secondly, to make his confession even better by the use of some practicable plan for applying the fourth rule. In keeping with this two-fold aim, I am dividing the remain-der of this article into two parts, which treat respectively of a 9ood confession and a betterconfession. Confession of Sins On the part of the penil~ent, three things are requirgd for the reception of the Sacrament of Penance; confession of sins, contrition, and satisfaction. The first of our rules enunciates the minimum essentials for thd first of these acts. It is certainly not difficult for anyone to fulfill this rule in a d~votional confession. It is sufficient to confess any or all of the venial sins comm.iyted since, the last con-fession, or any mortal sin or venial sin of one's past life: A penitent can even fulfill this rule by alv~ays confessing the same sin from his past life: for example, he once culpably missed Ma~s on Sunday, and since, then, in his devotional confessions, he never mentions anything specifically but that one sin. "There's nothing special since my. last confes-. sion, Father,-" he says week aftgr week,. "but in my past life I once missed Mass through my own fault." Finally, the penitent does not have to do even as much as that in a devo-tional ~onfession. It dan b~ sufficient if he simply includes his sins in a general way: for example: "There's nothing special since my last confession, but I want to include all the sins of my life." ,The repetition, week after week, of the same sin of the past life, without confessing any new matter, is not, of course, the ideal. Nor is it the ideal to make a merely gen- 147 GERALD KELLY Review for Religious~ eral accusation. Yet such accuations are, strictly speaking, sufficient in a devotional confession, provided the.penitent has the requisite contrition--as will be explained in the comments on-the second rule.1 I have referred to such accusations, not to encourage their use, but simply to indi-care how easy it.is to live up to the demands of the first rule. Despite the fact that it is comparatively easy to.observe the first rule, it is also possible for well-meaning penitents-- even religious--to violate it and to make unintentionally fruitless~ confessions. Perhaps a few sample confessions-- entirely fictitious, of course--will serve to illustrate what I- mean. A religious is preparing for confession. To him, as he examines his conscience, the past week looks.biack enough. On Sunday, when he,assisted at Mass he had certainly done everything that the Church requires for the complete ful-fillment of the obligation. Yet he had been no seraph at Mass; he could surely have assisted more.devoutly. On Monday, he had felt a strong inspiration of grace to pass up the butter at one meal: and on Tuesday he had felt an equally strong inspiration to spend a half-h0ur of his free time before the Blessed Sacrament. He had neglected both these divine:"invitations. Finally, despite the fact-that his rule ordered that all. should make their beds before the morning meditation, he had three times ~put off this dis-tasteful action until after breakfast. Of course, 1~is insti-tute states explicitly that merely disciplinary °rules, not involving the vows, do not bind under pain of sin; liuf 1The unnecessary use of the merely generic accusation, without mentioning anything in particular (e.g. "There's nothing special since my last confession,. Father; but I want to include in this confession all the sins of my life"), is particularly to be dis-couraged. By reason of a more or less general custom iri the Church, penitents who make devotional confessions are expected to mention some particular kind of sin, either from their past life or conimitted since their last confession. ~For the benefit of students of theology who might read this article, let me say that in speaking of the confession of devotion I use the words "fruitless" and "invalid" indiscriminately. The valid devotional confession must, I believe, be fruitful. 148 Ma~l, 1944 GOOD CONFESSIONS AND BETTER CONFESSIONS this, he tells himself, is no excuse for him. He enters the confessional and accuses himself as follows: "Since my last confession I was negligent in my prayers; I was ungrateful to God; and I was disobedient. That's all I can remember, Father." Another religious] in preparing for confession, note~ that he has often felt strong resentment against someone who had offended him; that he has 10ad many distractions during meditation; and that 6n one occasion he made a re-mark that hurt someone's feelings. He might note also that the feelings and distractions were not voluntary find that the offending remark was unintentional; yet these excuses do not occur to him. He confesses as follows: "Since my l'ast confession I was uncharitable in thought and speech and was distracted in my prayers. That'll be all, Father." A third religious has had a really trying time of it since his last confession. He has been literally besieged by a strong temptation to impurity of thought; in fact, the temptation has been so strong that he really does not know how he stands before God. He decides to go to confession "just~to be safe." In confession he says: '.'I had a very strong temptation against purity, and I want to accuse my-self in ~o far as I am guilty before God. Th~re's r~othing else bothering me, Father." I have chosen these three fictitious confessions because ."they illustrate defects which, thot~gh very likely uncom-mon, could make a.confession unintentionally fruitless. In the first confession, only imperfections,, not real sins, were confessed. In th~ second confession,, the things mentioned might have been sins, but there was no subjectioe guilt; the uncharitable feelings and distracting thoughts were invol-untary, the offending remark was unintentional. In the third confession there was no certain matter: the penitent may have been guilty of mortal or venial sin, but he may 1,49 GERALD KELLY Review for Religious have committed no sin.at all. All of these confessions are at least probably defective. Yet all could be saved from fruitlessness by the intelligent use of a concluding accusation such as "I include in this confession all the sins of my life"; "I want to include all the sins of my past life"; "For these, and fdr all the sins of my life, especially for . . ., I ask pardon from almighty. God and penance and absolution from you, Father." It is true that accusations like these can become purely mechani-cal and practically meaningless, yet they are infinitely bet-ter than such conclusions as: "That's all I remember"-- which adds nothihg to the confession.; "That'll be all,"-- which sounds like a person burring groceries ; -and so forth. It is hardly advisable to force religious to make subtle dis-tinctions between imperfections and venial sins; but it surely is advisable for all penitents who habi'tu'ally commit only small sins to have some concluding accusation which covers up a.possible insufficiency of matter in their con-fessions. " As I said, these confessions are purely fictitious. If they occurred in real life, a confessor would generally note the.deficiency and ask a question or two that would save the confessions from invalidity. Yet this might not always be ,the case; and penitents should be tiained to make goo.d confesiions independently of questions by the confessor. Contrition The second rule givei the minimum essential for con-trition in the devdtional confession. Here again, it is important to distinguish between the ideal and the essential. Of all the acts of the ,penitent, contrition is the most important; and everyone's ideal should be to have a pro-- found and effective contrition. Yet the confession can be good, even though contrition be far from the ideal. The 150 May, 1944 GOOD CONFESSIONS AND BETTER CONFESSIONS ideal, even in a devotional confession, is perfect contrition; yet imperfect suffices. The ideal is that the contrition extend to all.sins confessed: yet it~ is sufficient if the contri-tion applies to any sin included in the confession.8 The ideal is that contrition be deeply moving, like Magdalen's; yet it is sufficient if the contrition be as unemotional as paying the rent. Important though it is, it is not extremely difficult, to haye sufficient contrition for a fruitful devotional confes-sion. A penitent who has once committed a mortal sin, has repented of it, and now includes that sin in his confes-sion, either by mentioning it by name or by including it in a. general accusation, may take it for granted that he has sufficient contrition if he continues in his good resolve to avoid all mortal sin. A penitent who has committed a delil~erate venial sin in the past and who now includes that sin in his confession, either specifically, or at least in his gen- . eral accusation, ha~ sufficient contrition if he renews his good resolve to avoid that sin in future. Even a .penitent who includes only the "smaller" venial.sins in his confes-sionmthe semi-deliberate sins, as they are sometimes called--has sufficient contrition, if he is sincerely resolved to try to do better in some way, for example by eliminating one kind of sin or a certain class of sins, or even by reducing the: number of his small sins. We generally speak of contrition for sin as if it were one simple act. In reality it seems to involve a rather com-plicated process. It would not be worth our while, in a, aWhen I say that it-is sufficient if the contrition applies to only one of the gins confessed, I mean that this is enough for the absolution and the reception of grace through the sacrament. This does not mean that all the other venial sins are for-given. Sins for which there is no repentance at all ar~ not forgiven either in con-fession or outside of confession. For example, a penitent who has committed two venial sins, has true sorrow for one, but no iorrow for the other, would receive grace through the sacrament but not forgiveness for the one unrepented sin. His confession would be fruitful, but it could be more fruitful. 151 GERALD KELLY Reoietu for Religious pratti.c.al article of this nature, to go deeply into this proc-essl " But it may be useful to indicate here that, in making aft. act of contrition, a penitent should pay particular atten-tibn to two dements of the psychological process: namely, to motivation .and to purpose, of amendment. If these two elements are present, one may safely assume that an act of contrition is good; if either one is 1~icking, there is no real cogtntion. ¯ Motivation is not contrition, but it. is a necessary pre-lude td it. The sinner must realize the evil of his acts before he can truly repent Of them. And he must see this evil ~hrough the eyes of faith if his contrition, whether in or out of confession, is to be supernatural and effective. As we know, faith supplies us with a variety of motives f0r.repen~ance, some more perfect than others. It shows Us sin as contrary to the will of God and therefore some-thingagainst God's infinite holiness and goodness; it shows Us: the Son of God suffering on the Cross for our sins; it reveals sin as ingratitude to God~ o.ur.supreme.benefactor; it tells us of theo richness of heaven, of the terrible fate of hell, of the punishmen.ts of pu.rgatory, and of the temporal purlishments for sin in this life. All penitents shOuld keep in mind that the motive for their contrition should be applicable to the sins for which they wish to be sorry. In particular, it is necessary for those who Want to make an act of contrition for venial sins to remember that not all motives that apply to mortal sins are applic~ible to venial sins. Despite the fact that many books speak of venial sins in the most thunderofis terms, venial sin js not mbr~al sin. Mortal sin destroys the likeness of God in the soul; venial sin dods nbtt Mortal sin breaks the l~0nd.gf friendship between the soul and God; venial sin does not. Mortal sin is deserving of hell; venial sin.is not. In recalling these differences I am not trying to 'belittle Ma~l, 1944 GOOD CONFESSIO~IS AND BETTER CONFESSIONS venial sin. I simply insist on the necessity 9f seeing such sins in their true perspective in order to elicit a genuine act of contrition for them. It is only by stretching words far beyond their obvious connotation that one can make an act of contrition for venial sin "because of the fear of hell." This motive is applicable only in a roundabout way: for example, because venial sins may lead to mortal sin,. which is deserving of hell. On the other hand, there are many motives which do apply directly to v~nial sir/s, even to thd smallest of them. Venial sins are contrary to God's holy will; they defeat His wise plans for our sanctification and for our attainment of a certain degree of heavenly glory; they manifest a failure to appreciate His gifts; they are a shabby return fdr what our Lord did for us; they are deserving of some punishment in this life or in purgatory. It would be well for those who make devotional confes-sions to meditate occasionally, especially during the time of retreat, on motives such as these so that they can briefly and intelligently recall appropriate motives when preparing for confession. From the point of view of motivation, therefore, it is perhaps easier to make an act of contrition for mortal sin than it is for venial sin. At least it is easier to see the evil of mortal sin. As for the purpose of amendment, less is required for venial sins than for mortal sin. No matter what mortal sins a penitent has committed, he has not sufficient contrition unless his purpose of amendment extends to all mortal sins. He must will to avoid all mo]:tal sins in the future. Thus, the ordinary definition of a purpose of amendment as "a firm purpose to sin no more" applies quite literally to mor-tal sins. But this does not seem to be strictly necessary with regard tovenial sins. In facL.with regard to all the smaller sins. taken together, it is hardly possible. Rather, in the 153 GERALD KELLY Review for Religious case of sorrow for venial sins, the essential thing is the sincere will to do better. This distinction between mortal and venial sins, with respect to purpose of amendment, is based on the ft~nda-mental difference between these two kinds of sin. Mortal sin, of its nature, implies a rejection of God's friendship; hence one cannot will to gain or continue in God's friend-ship unless he intends to try to avoid all mortal sin, with-out exception. But one who commits only venial sins is already a friend of God; and this friendship admits of many degrees and of continuous growth. There is no con-tradiction in willing to a~coid some venial sins, but not others, or in willing to reduce the total number of one's venial sins, without proposing to avoid venial sin entirely. _ Satisfaction The third rule enunciates' the minimum essential for the third act of the penitent--satisfaction. I stated this rule ¯ merely for the sake of~omplete.ne~s. The rule itself hardly requires comment or explanation, except perhaps to remark --what is probably obvious--that there is a difference between willingness to accept a penance and the actual per- ' formance of the penance. The willingness is required for the validity of the confession; without this disposition a confession would not be good. But the actual perform-ance of the penance does not pertain to the essence of the Sacrament but only to the integrity of it. A BETTER CONFESSION The first three rules, as I said, express the minimum essentials of a fruitful confession. All who make a devo-tional confession, even religious, should make it their first aim t6 keep those rules. But religious, in particular, should not be content with that. Their aim should be to ,make 154 May, 1944 '" GOOD" CONFESSIONS AND BETTER CONFESSIONS their confessions better, especially througl'i the observance of the fourth rule. ¯ Books and articles on confession offer many suggestions for improving our confessions. I .should like to suggest ¯ here merely one workal~le plan for.using confession as an instrument 6f self-improvement; and I think I can accom-plish my purpose better by an example .than by a long dis-cussion. A religious is. making his annual retreat. In surveying the past year he notices that he has committed many small sins. He.wants to correct th~se, and in particular he wants ¯ to correct two habitual~.faults: uncharitable -speech and small sins against poverty. He, determines:what mearis.he willtake to'avoidthese fatilts, and he makes his resolutions accordingly. When his program:is .all prepared, he sud: denly re.alizes,- with a.twing~ of conscience, that he has made :such resolutions in previous refreats and that in a very sh6rt ¯ time they were either badly mutilated or completely ignored. He knows that during the retiea~ hehada sincere.purpose ¯ of amendment; what helacked was something .to sustain that purpose of amendment thiough the year .follow~i.ng the retreat. . Confronted with the vexing problem of an unsustained pubpose of amendment, thereligious decides to solve it.by effecting a union betweenhis retreat .resolutions and.his weekly confeshions Of the coming year; : :.: ¯ .'. The retreat ends; the daysgo by till it is time for.the weekly confession." . In examining his conscience, the rdi-gious looks first .to ~his retreat resolutions. He has kept them this week. He thanks God for this, renews his good resolutibn and, having finished his examination of con-science, he confesses as follows" "Since my last confession ¯ have ' I accuse myself of these and ot: all the other sins of my life, especially uncharitable speech and sins 155 GERALD K~LLY Reoiew for Religio~e against poverty." Another week goes by, with the same results. The "examination of conscience and the accusation of the two special kinds of sin are made in.the same way. In the third week, there is a weakening. Before confession the religious recalls the motives for avoiding these sins, asks pardon for his falls, and renews his good resolution. In confession he accuses himself as follows: "Since my last confession I was uncharitable in speech twice and committed one small sin against poverty. In my annual retreat I determined to cor-rect these faults, and I want to ask pardon for them now and to renew my purpose of amendment. I include in this confession all the sins of my life." Enough for the example. In giving it I do not mean ¯ that evdrything must be taken literally. Ten penitents might follow the same general plan, yet use ten slightly differing methods in applying it. The important thing is the general plannthe linking of the retreat resolutions .with the subsequent confessions. The plan that I have suggested may not-be suitable to all; but, in the absence of a better . one, it is worth trying. It offers definite help along the lines 'of motivation and of concentrated effort at amendment of faults. Retreat is a time of great grace; seldom Will our motivation be nobler .or.more clearly perceived. Any plan which wili continually recall that motivation must be profitable. And I think it is a truismthat in the spiritual life, whether on the nega-tive ok the positive side, there must be some concentration of effort. We cannot rid ourselves of all faults at once;. we cannot acquire all virtues at once. I iealize that this plan involves "monotony"; but I do, not know of any plan for spiritual progress that'does not involve some "monotony." If more variety is really .required, the objectives can b'e changed occasionally, for ¯ 156 " Ma~l, 1944 GOOD CONFESSIONS AND BETTER COlqFESSIOBIS instance, from monthly recollection to monthly recollec-tion: but I think it is important .that we should never get away entirely from our retreat program unless we are faced with entirely new difficulties that demand our undivided attention. Some may object that the plan is too "negative." To this I can answer only that confession.is sfipposed to deal with the "negative" side of our lives and that I have not proposed this plan as a complete enunciation of our spir-itual ideals. And I might add that, if used perseveringly, the plan is very positive in its results. It makes for a great increase of grace through the Sacrament, for increasing purity of conscience, and, incidentally, for helpful spiritual direction by the confessor. MARIAN LIBRARY Some time ago plans were formulated for the organization of a Marian Library at the University of Dayton. The purpose of the project is to collect all known books on the Blessed Virgin, thus honoring Mary, Patroness of the United States, and establishing a center of research on Marlology in this country. If~ you wish to help in the project or wish further information concerning it, write to: Father Law-fence Monheim, S.M., Director, Marian Library', University of Dayton, Dayton 9, Ohio. BROTHER RICHARD PAMPURI Brother Richard Pampuri was a physician and surgeon, a member of the Hos-pitaller Order of St. John of God, who died in 1930, at the early age of thirty-two. The Brothers of St. John of God now publish a small pamphlet containing a sketch of Brother Pampuri's life and some vocational information about their order. For further information apply to: Rev. Brother Master of Novices, Brothers of St. John. of God, 2445 South Western Avenue, Los. Angeles 7, California. PLEASE~Somo subscribers have not yet sent us their Postal Zone numbers. If yours is not on the wrapper of your copy, will you please send it? ,. 157 The Question ot: V0t:ing Edwin F. Healy, S.J. 44| N WHAT ways may a citizen help in maintaining .a genuine democracy?" asks a Civics' Catechism; and, in the answer, first place is given to "voting at elec-tions." The reason for thus stressing the .importance of voting is ~asily understood when one realizes that the bal-lot can fashion the whole superstructure of our govern-ment. The justice of our laws and the effective and impa.rtial administering of them depend upon those who elect to office our legislators and our administrators. Responsibility for the quality of our government thus lies, to a large extent, in the hands 0f our "voters. The citizens of a nation have the obligation of pro-. m0ting the general welfare of their country. This obliga- ¯ tion is one ot? legal justice. BU( what exactly is legal jus-tice? Legal justice is a virtue which inclines citizens to render to their community what is its due. Men are intended by nature, not to live as hermits, but 'to dwell ' togetl~er in groups or communities. Living in groups, they enjoy many benefits. They are thus aided in developing themselves spiritually and intellectually. ~ They thus par-ticipate in the joys of varied companionship. They feel the protective strength of large numbers bound together for a common purpose. They Share in the improvements made possible by the industry and ingenuity of their associates. They have access to~ commddities, forms of XFather Healy wrote this article at our request. It seemed to us that ~uch an article. might be necessary, or at least very useful, at this time. During election year teach-ers are frequently asked questions about the duty of voting, and religious themsel~,es face the personal problem of judging the utility of their voting and their duty to do so. We believe that in some places ecclesiastical superiors" give specific instructions concerning the fulfillment of this duty. In the absence of such particular guidance, religious should find Father Healy's general explanation helpful.reED. 158 THt~ QUESTION OF VOTING entertainment, facilities for travel, and so forth, whic.h would be undreamed of if all were recluses. All this is just as nature intended it. Human society, then," is a natural institution and it,has certain claims on the members of the community. As Pope Leo-XIII wrote in his encyclical Christian Democracg, ".No one lives in a community only for his personal advantage. He lives for the common good as well." A country, a State, or a city, has the right to ¯ deman'd of its citizens whatever is, necessary to promote the general welfare. A citizen, therefore, must fulfill the duties which correspond vcith these rights of the community. The virtue which inclines citizens to live up to these obligations is calle~d legal justice. Legal justice, for example, prompts one to defend.his country, even though this involves facing the devastating gun-fire of the enemy. Legal justice dis-poses citizens to observe the just laws of their State, to con-tribute a fair. share to the.financial support Of the govern-ment. It is legal justice, too, which imposes on citizens the duty of p.romoting the common good by means of intel-ligent voting. The common welfare is greatly furthered by the con-scientious use of the ballot. Member.s. of a community.,' then, should reflect upon the vital importance of exerc!sing this power that is given them by virtue of their citizenship. Intelligent, competent, honest leade~rs are needed by our country. This fact is brought home to us when we realize that our public officials manage, not only political affairs, but matters which may intimately affect the religious activi- " ties, the educational system, and the whole social and indus-. trial life of a city, or State, dr country. A communistic governor or president, for example, could accomplish much towards u~dermining our democracy. A militantly bigoted mayor could do much harm to the Church. Judges who 159 EDWIN F. HEAL¥ are guided by a false philosophy will injure the community in which they live~ One can, therefore, readily understand how much is involved in the selection of those who conduct the public business of our country. It is regrettable that, in spite of its importance, not all who are entitled to the ballot exercise this privilege. It has been estimated that as many as one half ofthose who were .eligible to vote have absented themselves from the polls in some election§ of the past. This was true ev.en in impor- .tant presidential elections. In elections of less general inter-est it has happened that only about one-fourth of the elig-~ ible voters appeared at the polls. Moreover, in primary elections, which select the candidates for o~ce, this apathy in public affairs is often far more pronounced. Such indif-ference ¯ to matters which concern the common welfare encourages corruption in our government. Many of those emp~owered to vote fail to do so because of laziness, or because of some slight inconvenience Which is involved in their particular case~ It requires fair weather to lure some citizens to the polls. Others refuse to vote because they are dissatisfied with the choice of candidates offered by our political parties. Others, again, feel the futility of trying to-defeat one who' is supported by a powerful, well-organized political machine. Often enough citizens excuse themselves from their duty of ~roting on the assumption ¯ that their single ballot will make little difference in the final o results. Although it is possible that one vote may change :the outcome of an election, one must admit that this is highly improbable. Let us suppose, however, that thou-sands of uprightcitizens were to excuie themselves from voting on the plea that "My vote won't matter".--cou,ld not the resulting loss to the desirable candidate easily bring about his defeat? This point should be remembered-by those who honestly desire to fulfill-their civic duty.¯ At 160 May, 1944 TNE QUESTION OF VOTING times, moreover; one is inclined to forget that his failure to east a vote will, in many cases, be equivalent to casting a Vote in favor of a candidate who will harm the public welfare. Althougl~ the common good can be advanced so much by the honest voting of the members of the community, there are a great many cases ~where the choice made at the polls is not dictated by conscience. Not a few of our citi-zens, it is said, sell their votes to the highest bidder. Besides this, there are no doubt many thousands who write their ballots according to the instructions which they have received from some ward boss who has befriended them in one manner or another. A.petty politician obtains votes for his candidate in various ways. He procures jobs on the city payroll for certain ones who will be able to influence the opinion of many acquaintances. He protects Others who are running a business which is forbidden by the law. He "arranges" matters with a friendly judge for thosewho have been arrested for violating minor city ordinances. At election time a dollar here and .a few dollars there buy va!u-able votes. Vo~es which are delivered to the ward boss because of a favor .received do not represent the genuine preference of the v6ters for the candidates selected. They represent merely the preference 6f a single individual, namely, that of the petty politician who has gained control over these votes. Frequently enough the ward boss is quite dishonest. Biibery, lying, injustice are common tools by which he "gets results."~ He has but one choice in any election' and that choice is the candidate that has 'been selected by his political party. Be that candidate good or bad, the ward boss will support him by every means available. We can re.adi!y understand, therefore, that the ward boss's choice may turn out to be one which will be quite injurious to the ¯ ¯ 161 EDWIN F. I-ii~gi.~ :" '/tevie~o ¢or. i~et.,'gio,,s~ go~d of the community. If we recall to. mind the thou-sand~ of those whose purchased votes are merely the rubber-stamped selection of some w~lrd boss, we shall realize what an unfair advantage an unscrupulous candidate may have over one who is honest. Thousands of voters, it appears, are influenced at the polls by one c0nsideration:."What immediate advantage will this'person's election, bring to me?" They seem never to give thought to the effect which the candidate's victory may have on the State or country as a whole. They focus. their attention on some petty benefit which they them-selves will receive. Ordinarily the major consideration for them i~ the question of jobs. Many of those who are employed by the ~idministration which is in power vote for that administration's candidate as insurance against the. iossof their.jobs. They realize that, if the candidate of another p~rty is elected, in all probability he will replace then~ with those who have proved their political allegiance .to him. Th~ere is; of course, no fault to be foun~l with men anal' wom~n-Who endeavor to protect themselves against the loss of their jobs, but it should be evident that .such Pr0.tectiOia .mustnot betheir primary consideration. It should not inteifere Wi~h the fulfilment of.~ their duty .to p.".r0mote thi~: ~0mmon good: Hence;" if.:a 'certain candidate is unfit .for o~ce, he sh0uld: not be. Voted for, no~ matter what patter loyalty might dictate. . " -~ . ¯ . :- . An0~her"~ype 6f citizeri~ ~hat concerns. .us- :in this queso: tion is the one who a~cepts his duty of voting very lightly. Hema~r be an Upright and an intelligent'pe.rson. He may .be irreproachably honest in all his de.alings.with his neigh-boi. He may be a generous contributor to charitable insti-tutioiii. But he fails to do his sha~e in the task of electing competent public officers. With men 0f this type, there is .no pretence ~t making a serious effort to !~arn the qUalifi- 162 Ma~t, ~19 4 4 THE QUESTION*OF.~ VOTING cations:of the candidates listed on the.ballot. They kno~" little of the good qualities or of the bad ones of those: who are running for office. They may .base their opinion of the candidate on such superficial points as that of a winning personality, a magic voice, social standing, the nationality ~ of his parents, and so forth. They form snap judgmentSOf the candidate's ability and do not b~ther, to investigate the soundness of their conclusions. They accept a party plat-form at the value given it by its defenders'and refuse ~to read the arguments of its opponents. " When one recalls, then, the large number of those who are guided in voting by unfair influences and by superficial considerations, the importance of the honest, educated, conscientious voter becomes apparent. " Consequently, it.:is not too much tO expect that especially th6se whoare ¯ blessed with sound 'Christian. training and with at:,least average intellectual gifts employ these benefits' at election time to promote the common good. They should ex~rcise 'all the influence in their power to protect the less fortunate, who are being.exploited by unsciupulous political .bosses. From what has beenexplained above,-it is' deaf,.then, that ci(i'zens~ are obliged :in conscience to, fulfill ~the"du'ty 6f voting. Is this 6bligation a serious one? .Yes, it is, ff0n~e.'-s vote will probably defeata candidate for.office who -would bring? graveharm :to the. comi-fi:unity. A very indompetent. person~ for example,. or-one who'is strongly anti-religio~s~ wouldbe such a candidate. Ordinarily,,however, in this country,' this condition is not verified, .and so the duty to vote is, not grave. Moreover, there is no obligation at :all - ¯ , to vote: (a). if I am certain that my vote would have no effect on the final results of the election; or (b) if ~¢6ting -. would prove seriously'inconvenient or gravely injurious to me. Hence, ,if I were quite sick, and going to the polls would increase my illness, I should be excused from the 163 EDWIN F. HEALY . " Review f.or Religiou~ duty of voting. Even though one's vote would clearly riot affect the course of an election, nevertheless, it is preferable that one go to the polls anyway, in order to give to others the g6od example of taking interest in civic affairs. This, of'course, applies, particularly to persons of authority, whose actions are a guide to many. Besides, my vote is not altogether useless, even if my candidate has no chance of winn';ng the offce, for his. prestige will be increased by each additional vote which he receives. With reference to the duty ofv0ting it should be noted that one' is obliged to vote bonestl~l, that is, he must be guided in his choice of candidate by his genuine desire tO furthe~ the common, welfare. He must select the candidate wh~ is bes~ fitted for the office. The one voted for must l~e qualified to carry .out the requirements of the position sought. It may be that a man is morally blameless, but if he 'is inefficient, inexperienced, dr poorly gifted intellec-tually; his election .would. not be to the best interests of the community. Moreover, one must vote intelligently. He must make sure that he does not waste his vote. A vote is wasted if the ballot is not marked in accordance with the directions given, because such a ballot will be discarded without being counted. An erasure, or blots, or blurs, or -some sign that may be interpreted as a distinguishing, re.ark, . can invalidate the ballot. Writing in ink, instead of pen-cil, marking an "X" outside the prescri.bed box or circle, voting for several candidates for an office when only one may be selected--these are some of the ways in which one can waste his ballot. Not infrequently it happens that the shortcomings of a candidate for some public office are reviewed in detail in newspapers and magazines. The charges made-against candidates by a news organ of an opposing political party are at times very damaging. What is to be said of the moral- 164 Ma~ , 1944 THE QUESTION OF VOTING ity of the practice of exposing the faults and errors of one who is running for a public office~ To call attention to the mistakes and misdeeds ofthe candidates can be a service to the community. The men and women who are seeking publicoffice are thus revealed in their true light, and so the voters are able to judge whether or not the election of such candidates would prove to .be injurious to the common welfare. It is, of course, forbidden to exaggerate a candi-date's deficiencies or to make slanderous statements about him.However, it is altogether licit to mention certain facts in his life: faults, past crimes, evidences of favoritism, dangerous tendencies, examples of inefficiency, ignorance, bigotry, dishonesty, and so forth, when these are of a pub-lic nature. Even hidden crimes or defects may be pub-lished, if these render the candidate unfit for such an office. The reason is dear. Candidates give up their right to keep secret what the common good requires to be known about them. Moreover, those who hold public positions can be said tacitly to consent to the open scrutiny .of their official acts. They are, after all, but the agents of their constitu-ents; hence those whom they represent have the right to demand an acc6unt of their official conduct. The realiza-tion that their actions will thus be analyzed in newspaper and magazine may perhaps exercise a restraining influence against violations of duty. Since, then, writers are allowed. publicly to review the faults and misdeeds of candidates for office, such articles of theirs may be' read without scruple. Not many years ago a certain socialist urged that all nuns be deprived of the right to vote. The argument adduced to justify this recommendation was, we believe, that such women have no interest in civic affairs. In reply to this suggestion it should be made clear that religious men and women, as a rule, have very much at heart the common welfare. Moreover, their interest is not merely an aca- 165 EDWIN F. HEALY demic one, for by their daily lives of prayer and sacrifice and good example they greatly benefit the community in which they live. Because they love their country and ever seek its best interests, they are eager to have only candidates of ability and integrity elected to office. They cast their votes in accord with the dictates of their conscience. Who would deny that their choice at the polls is as carefully considered and as intelligently weighed as that of the average citizen? CONCERNING BOOKLETS The Congregation of Holy Cross is publishing a revised edition ofDirections for Nooitiates of the Congregation of Holy Cross, written in 1895 by the saintly Father Gilbert Francais, Superior General of th~ Congregation from 1893 to 1926. The book contains a simple, fervent set of instructions designed to help novices in the various exercises of the novitiate. Though the book is really the Family Bool~ of the Congregation of Holy Cross, masters and mistresses of novices of other in-stitutes should find it useful. Paper-bound: 182 pages; $I.00. Published by The Ave Maria Press, Notre Dame, Indiana. The Holy Cross Brothers publish a very attractive and informative booklet en-titled Holy.Cross Brothers. This booklet may well be held up as a model of clear, simple, verbal instruction on the life of a Brother and of the apt use of photographs to illustrati the text. The Brothers will send a copy to any priest or religious who is interested. ~Write to: Director of Vocations, Sacred Heart ,luniorate, Watertown, Wisconsin; or tb: Direcior of Vocations, St. 2oseph ,luniorate, Valatie, New York. Similar to the booklet on Holy. Cross Brothers is anew brochure, Jesuit Life, prepared by the' Jesuits of the Missouri Province. This province comprizes Colo-rado, Illinois (south and west of Springfield), Iowa, Kansas, Minnesota, Missouri, N. ebrask~, North Dakota, Oklahoma, South Dakota, Wisconsin, and Wyoming. Residents of this territory mas; secure copies bf Jesuit Life free by applying to: Reverend Father Provincial, 4511 West Pine Blvd., St. Louis 8, Missouri. An Army of Peace is the title of an unusual historical pamphlet--"The Story Of the Sisters of Loretto at the Foot of the Cross as told by Modern Youth." This pamphlet was originally planned and written by the American History Class, Loretto Academy, Kansas City_,. Missouri. "1941. Two years later it was revised by the students of Loretto Heights College, Loretto, Colorado. The illustrations (very "cute"--if you don't mind the word) are the combined work of students of Web-ster College, Webster Groves, Missouri. 48 pages. 10 cents each; 11 for $1.00; 50 for $4.25; 100 for $8.00. Order from: Loretto Heights College, Loretto, Colorado~ 166 The C~re 0t: ~ick Religious Adam C. Ellis, S.J. BECAUSE of the regularity of their lives, their simple but wholesome diet, and the peaci~ of mind resulting from serwng God, rehg,ous usua.lly enjoy remark-ably .good health. It ~s mewtable; however, that there be some sick rehg~ous. These should be looked upon.as bles-sings in a community, and they shoulld be given proper care, both physical and spiritual, according to the letter and the spirit of. ecclesiastical legislation. . Phgsicat Careof the Sick ¯ The Code of Canon Law contains nip specific legislation regarding the physical care of. the sick. This is provided for ¯ in ~he constitutions of individual lnst~tutes, ~which in ~turn are based upon the. provisions laid down ~n the Normae issued by the Sacred Congregation of Bi,~hops and Regulars, June 28, 1901. We may, therefore,' tal[e these latter as.the .basis for our remarks:. ¯ . ¯ Art. 183 requires that each religious, house,., as 4:ar.as. possible, shall have a special place for an in~, rmarg. Though it is impracticable in a small communit~ to reserve aplat~ in the :house for occasional sick members, it is customary-to have a well-eqmpped ~nfirmary ~n the motherhouse, ~n the novitiate, in the house of studies, as w~ell as in all larger communities. These places should b~e kept bright and cheery, ~vithout, however, introducin~ luxuries not in keeping with '.religious poverty. - Art. 184 states that one or more re'embers of the com-mun~ tg, should be set aside for the care ]of the sick. These persons should be endou~ed u~itb all tb le qualities necessar~l 167 /~DAM C. I~.LLI$ Review for.Religio~s f~r the proper fulfillment of their office, and should be -noteworthg fo~ their Fraternal charitg. It is their dutg, under, the direction of superiors, to provide For atl.the necessities of their sick charges, with regard to nourishment and other remedies. In modern times no religious institute should find. any difficulty in having one or more of its members trained as .professional nurses. Many of our Catholic hospitals have training schools for nurses, and religious are always wel-come to go there for training in a religious atmosphere. Every large infirmary in a religious house should have its own diet kitchen in which the special dishes required for the si~k may be carefully prepared either by the religious-nurse in charge or by an assistant. We may remark here in passing that it is not contrary to common life to give a special diet in the community refectory to those religious who need it, ~ven though they are well enough to carry on their work. In many com-munities it is customary to l~ave a special table in the refec-to. ry for those who are on diet, thus saving unnecessary steps for those who serve at table. Art. 185 tells that when necessar!l a doctor should be called, and his prescriptions should be FaithFullg carried out. All things considered, the community doctor should be chosen by reason of his understanding of the nature of the religious life in general and of the special work performed by the community in particular. Then he will know more readily the circumstances Of his patient, and will not be inclined to prescribe extraordinary remedies which are . usually available only to the wealthy. Superiors should be generous in providing for the needs of the sick members of their community. It seems to have been a special characteristic of many founders of religious institutes that they were most solicitous for the care of their 168 Mag~ 1944 THE CARE OF SICK RELIGIOUS sick members. Such a tradition should be carefully pre-served. For major operations, as well as for the cure of.certain diseases, it will be advisable to send a religious patient to a hospital. Ordinarily religious should be taken to a Cath-olic hospital where they will .receive the loving care of other religious and will not.be deprived of the religious atmos-phere. Both superiors and religious nurses should be familiar with the laws of the Church regarding exemptions from fast and abstinence, Sunday Mass, and other like matters, so as to be able .to quiet any scruples on the part of their charges. Spiritual Care of the Sick Art 186 of the Norm~e prescribes that the spiritual needs of sick religious should be attended to no less. ear-nestlg than their material needs. The principal :spiritual needs include confession, Communion, and Extreme Unc-tion. On all these matters the Code of Canon Law con-tains some explicit provisions, on Which it may be helpful to make a few comments. Confession: Sick religious should have the opportunity of going to confession whenever the community 'does, that is, weekly to the Ordinary confessor, on occasion to ,the extraordinary confessor, though they should be asked first whether they wish to avail themselves of these opportuni-ties, ,and should not be forced to do so. Special provision is made in canon 523 for religious women who are ill: "'All religious women when seriouslff ill, even if not in danger of death, mag, as ofte/~,as they u3ish during their serious illness; invite an~t priest whatever to hear their confession, provided that he be approved to 169 ADAM (2. ELLIS- Review [or Religious bear the confessions of women, no? can the superioress either directly or indirectly pre~ent them from doing so." It may be well to note that the canon does not require that the religious be in danger of death, but it suffices that she~be seriously ill in order to use the privilege.The judg-ment as to the seriousness of the illness should be left to the doctor or to a competent nurse. The very fact that it is deemed necessa.ry to callo the doctoi would generalIy be a sufficient indication that the illness is serious, since it is not customary for religious to summon a physician for slight ailments. Again, a patient who is running a fe.ver, or who. is obliged to be in bed for a week or more because of illness, would certainly come under the canon. In case of doubt ¯ about the seriousness of the illness, the sick religious should be given the benefit of the doubt. Sick religious on their part should be reasonable. It would hardly be in keeping with the spirit of the law to call for a confessor wholives a long distance away from the community, thus involving expense for the community and .grave inconvenience for the priest in question. It should also be kept in min~l that the 'canon impose~ no special obligation on the priest who i~ called to answer thd summons,.and the sick religious should be patient and resigned if the priest is delayed incoming or does not come at all. 'Holy Communion: Let us. first recall .that the reception of Holy Communion is a privilege and that, while the Church urges her. children,' especially religious, to use this privilege frequently, even daily, still there is no obligation to do so, except during the Paschal. season. Hence a reli-gious, whether sick or. well, who abstains from the recep-tion of Holy Communion, should not be looked upon as singular, This is a matter which is strictly personal, and one which should never be commented upon in commun-ly0 May, 1944 THE .CARE OI~ SICK :RI~LIGIOU$ ity life. As to sick religious, theremay be many reasons w.hy they do not wish to receive Holy Communion on any specified day. Hence the practical rule to be followed is to ask them each evening whether they wish to receive On the following morning or not. They should be given the opportunity of communicating daily Should they wish to do so, but they should ne.ver be made to feel that they are obliged to do so, much iess forced to do so. Dispensation from the Eucharistic Fast. Canon~858 § 2 makes a partial exception to the law of the Eucharistic fast for certain sick persons. "'The sick who. have been .in bed for a month without cet~tain hope of a speedq recooerg maq, with the prudent advice of their confessor, receive Holq Communion once or twicea week, even though theg ma~] have taken medicine or something b~t toag of~.tiquid food beforehand." . The sick who have.beenin bed for a mot~tb. This does not exc!ude:the patient's being able. to. sit up during cer-tain hours of the day. Besides, there are some sick persons who; because Of th~ nature of their infirmity, cannotlie in bed,- b.ut are confined to a chair Or couch. They certainly may use .this privilege. Likewise those sick persons who are able to get up for an hour in. the morning and go :t6 the chapel for.Mass and Holy Communion; may. use the privi-lege. The .canon does n6t require .that they receive.'H61y Communion in bed in order to.use the privilege. " . " It should be noted, however, that this privilege-may not be used until a person has.actually.been ill. for amonth. The opinion of a doctor that the sick person will be in.b~d for more than a month would not justify that person in using the privilege immediately, but he:must .wait until he has bee~a ill for about thirty days. This number of days.is ,to be counted morally, not ma, thematically, It may be difficult to determine exactly the day on wh'ich a person 171 ADAM C. ELI~I8 Review/or Religi~ous became ill. He may have been feeling poorly~ for several days before be went to see the doctor and was ordered to bed. Such days should be counted to make up the month. Without~ certain hope of a spee'dg recoverg. These words exclude mere conjecture or probability. Unless it is certain, therefore, that the person who has been confined to bedby illness f;3r a month will.be well in a very few days, he may use the privilege as long as. his illness lasts. With tb~ prudent advice of theconfessor. ,This does not mean that the confessor grants the privilege of receiving Holy Communion not fasting--the law does that--but it implies .that his judgme.nt may be, required that the sick person is properly disposed. Hence a sick" religious who is mora.lly certain that be is in the state of grace and properly disposed need not ask the permission of his confessor to use the privilege granted by the.law itself. Once ortu;icea vaeek. These words are to be inter-preted strictly. The sick person may use the privilege not more than twice a week. He may use it on any two days of the week, even though on the other days he observes the Eucharistic fast in its entirety and receives Holy Commun-ion. ¯ Medicine or something bg wag of liquid food. The medicine taken may be liquid, or in the form of solids such "as pills, powders, and the like. Any food taken, however, must be in the form of a liquid, that is, it must be of such a nature that it can be drunk. Under this head would come such items as egg-hOg, thin gruel, milk, fruit juices and the like. Religious nurses will do well. to remember that the privilege granted in canon 858 is for all sick persons; not merely for religious. It may be well to mention here that religious who are chrohic invalids and who find it difficult to observe the 172 ' Mag, 1944 -. THE CARE OI~ SICK RELIGIOUS ]~ucharistic fast-either because of physical weakness, ' or because of the'need of taking medicince during the night, can obtain an indult from the Sacred Congregation of Religious to communicate even daily after having taken medicine or liquid food. It will suffice to write a simple letter stating briefly the nature of the disease, and asking for the privilege~ It will help to expedite matters to have the local Ordinary give his approval to the petition. , As for the Last Sacraments, canon 514 provides as fol-lows: "'In every/clerical institute the superiors.have the right and the dutg to administer, either per. sonall[t or bg delegate, the Holg Viaticum and Extreme Unction, in case of sick-ness, to the professed members, to the novices, and to other persons duelling day and night in the religious house reason or: service, education, hospitatitg, or health." In the case of lay institutes, that is, congregations of Brothers and Sisters, this right belongs to the pastor of the parish in which the religious house is located, or to the chaplain designated by the Ordinary to replace the parish priest (canon 514, § 3.). In convents of nuns, the ordi- -nary confessor or his substitute has this same right and duty (canon 514, § 2). Viaticum. Holy Communion is given to the sick by way of ,Viaticum whenever tl~ey are :in danger of death. It may be received daily as long as tha~ danger lasts, and the sick person is exempted from the Eucharistic fast during this time (canons 858 and 864). The opinion of a doctor, or of a competent nurse may be followed regardihg the danger of death. The sick person need not be actually dying, but it suffices that the illness be such that death may be the result of it. Extreme Unction. This sacrament may and should.be administered to the sick who are in danger of death. ~It may be administered only once during the same illness, ADAM C. ELLIS unless ,the sick person shall have recovered, and again fallen into danger of death (canon 940). Again the. prudent judgment of the physician or a capable nurse should.be fol-lowed both ~as regards the danger of death and subsequent recovery. The administration of Extreme Unction should not be put~off until the patient is actually dying, but should be " administered while the patient is in full possession of his senses. Sick persons, including religious, should be in-structed regarding the secondary effects of this sacrament, one of which is the recovery of health, if such be the will of God. Conclusion It will not be out of place here to urge religious supe-riors and those who have the care of sick religious entrusted to them to do all in their power to care for the material and spiritual needs of the sick. Let them, in thei~ charity, .use measures to prevent, as far .as possible, the beginnings Of sickness, by not overburdening their subjects, by supply-ing them with a sufficiency of good wholesome food, and by providing proper relaxation and recreation within the .bounds of religious propriety. In this connection religious superiors must learn to say "NO" to the .many demands put upon them f(~r.help or work which they cannot undertake without putting too great a strain upon a commun~ity which may be already. .overburdened. They will serve the best interests of the Church and of their own institutes by refusing such work until .they have a sufficient number of subjects properly trained both intellectually-and religiously to undertake such additional burdens. 174 ~ ¯ We, Salu!:e Thee, Mary, h ot:her God! William 13. Faherty, S.J. NO ONE has ever had the persevering energy to list all the titles of Mary. Each country, yes, almost every Catholic locality, has its own beautiful manner of invoking our lovely Lady. In the Litany of Lotetto alone we. appeal to her in over forty ways. Some titles, such as the Blessed Virgin, have universal esteem. Others possess only local popularity] Of all the loving appellativ~s by which her devoted fol-lowers call on Joachim's daughter, the .greatest is "Mother of God." So astounding is it to address a human being in this manner, that we might hesitate to. employ it, were it not revealed doctrine, its use sanctioned by. the Church. In the May 1943 number of REVIEW FOR RELIGIOUS, Father Aloysius Kemper, S.J., analyzed the doctrine of the Divine Maternity. The interesting controversy .that led to its sanction is the theme of this article. The antagonists in this case Were two leading bishops, Nestorius of Constantinople, and St. Cyril of Alexandria. Dispute and discussion of a controverted point of doctrine not infrequently lead to its settlement by conciliar defini-tion. So it was in this matter. .The Council of Ephesus (431) settled the question. But that is running ahead of the story . The Fifth-Century World . Accustomed as we are, in this modern era, to think.of the e.astern shore of the Mediterranean as non-Catholic . territory, we find it difficult to visualize the fi'fth-centur7 setting. Constantinople was the center 6f the Empire, not 175. W. B. FAHERTY Revie~u [o~ Religious Rome, so recently sacked by Alaric and his Visigoths. Not Italy, or Spain, or France, but the Province of Asia on the XVest coast, of modern Turkey was the most Christian sec-tion of the Mediterranean world. St. Patrick was just then preparing .for his missionary trip to Ireland. The great St: Augustine of Hippo was in his last years~ So much for the scene, now what about the Drarnatis Personae? Into the easiern capital as its patriarch came Nestorius, a priest of Antiokh, who soon became known for his zeal-ous hounding of heretics. Worried over'the danger of polytheism, still so strong in the pagan parts of the Empire, as well as over an error concerning Christ's humanity taught by~ a priest, Apollinaris, Nestorius leaned backward in regard to the doctrine of the Divine Maternity. Against him stood St. Cyril, the Patriarch of Alexan-dria, rugged as Gibraltar, a man renowned for the strong virtues of John the Baptist rather than for the gentle quali-ties of dohn the Evangelist. Far away, at Rome, Pope Celestine odcupied the Chair of St. Peter . Theological WarFare The first barrage of battle came when the priest, Anasta, sius, a protegi of the Phtriarch of Constantinople, preached against the use of the extremely popular title for Mary, Tbeotokos (God-bearing). Call her merely Christ-otokos (Christ-bearing), he ordered. Consternation spread arnbng the-Constantinopolitans, for this title, Tbeotokos, had been indaily use for over a hundred years. Almost everyone in the audience had been familiar with it .from ehrliest childhood. The people were.gripped by a dismay and bewilder-ment almostinconceivable to us who live in a milieu that 176 May, 1944 WE SALUTE THEE, MARY, MOTHER OF GOD tends to take doctrinal differences as easily as the changes of the ieasons. Nestorius answered ?omplaints with excom-munication and imprisonment, then mounted the pulpit and bulwarked Anastasius' position. The Patriarch. of the Eastern Capital had flung down the gauntlet. Proclus, the bishop-elect of Cyzicus, a lesser name in this theological battle, accepted. the challenge. Despite the presence of Nestorius in the audience, he rose to the defence of the popular opinion. The Patriarch coun-ter- attacked with a whole series of sermons. Not along the shores ,of the Golden Horn alone, but throughout the East, news of these teachings spread. Across the blue Mediterranean they carried, like the sails of the Phoenicians, to the ancient land of the Pharaohs. St. Cyril rose to the defence of the tiaditional opinion with several letters. First to his own people, then to the monks of Egypt, he gave the true explanation of the Incarnation. He -mapped out a detailed counter-offensive against Nestorius. Two letters to that Patriarch complained of the teaching that had thrown the faithful throughout the East into war-time excitement. Availing nothing by this, Cyril referred the matter to Rome. He sent to the Holy See his correspondence w.ith Nestorius, a collection of the con-tagion- filled sermons, and a work of his own just com-pleted. ¯ A local council, convoked at Rome by Pope Celestine in the .summer of 430, condemned Nestorius. Early in August the Pope commissioned St. Cyril to carry out the condemnation, giving the Patriarch of Constantinople only ten days to retract 'his false teaching. Celestine wrote similar letters to Nestorius himself, to the clergy and people of Constantinople, and to John, the Patriarch of Antioch. The last paragraph of the Pope's authoritative letter to Nestorius is a good.summary of the whole epistle. "You 177 W. B. FAHERTY Review t~or Religious know clearly.out opinion. Unless you preach concerning Chris.t, our God, those things which the Roman ChUrch, the Alexandrian Church,-and. the whole, Catholic Church teach~s, and the most holy. Church of the Cityof Con-stantinople held up to the present, and you separate your-self from that foul novelty as the Scripture enjoins, and condemn it in a written profession within ten days from the day on which you are aware of this. sentence, you will be expelled .from the communion of thewhole Catholic Church" (Mansi, IV, 103~4.35). ~ ~ This was a lightning attack on Nestorius. He was condemned and his rival .was chosen to. give the coupde-grace. What would he do? The cornered Constantino-politan parried the thrust with an. evasive reply and.-a promise to abide by the decision of the general council he had asked the Pope to convene. The Anatbematisms Cyril. was busy, tOO, preparing.the death blow. He drew?. UP twelve statements, called "The:.Anathematisms,'." to which,Nestorius was asked to.subscribe. Though these , ~ere couched in sucha way as tO make evasion impossible, they contained, certain difficulties of terminology. What Cyril understood to mean:-one thing, Nestorius interpreted-in a way that bordered on the false teaching of Apollinaris. So, .,instead of submitting, he issued, twelve, counter-anathematisms, John of Antiocia now stood With Nes-torius. Other bishops of the region of Antioch a.ttacked the twelve statements of Cyril, especially the third, which seemed to teach only one nature in Christ. When everyone seemed, drugged-with anathematisms; the Emperor Theodosius II con, yoked a general council to be, held at Epl~esus in Asia Minor, on Pentecost Day,~' June 7, 431. Ma~t, 1944 WE SALUTE THEE, ~ICIARY, MOTHER OF. GOD Ephesus is today a miserable village on the-west coast of Turkey, not far from the Italian naval base at Rhodes. But in Roman times, it bore the pr6ud sobriquet, "The Torch of Asia." One of the chief ports of. the Levant, it was the center of the cult of Diana in the days of St. Paul. Recall the riot recorded in the Acts, when the streets rang with the cry, "Great is Diana of the Ephesians." From a pagan stronghold it became by the third cen-tury a populous Christian city. Here St. ,John lived in later life. Here sprang up a great devotion to the Mother of God, supplanting the worship of the pagan goddess. To the main church of the city, dedicated to Mary, the bishops were making their way in the spring Of 431. The Council Convenes Since the Antiochean prelates had not arrived by June 7th, the opening of the Council was delayed. On ~he 22nd Cyril opened it, though the Papal Legate and the Patriarch of Antioch were still on the way. This seemed a high-handed act on the Alexandrian's part, for he had no com-mission to preside over the Council. Perhaps he extended hi~ powers as commissary in the indictment of Nestorius. The Acts of the Council record that two bishops, both bearing the name of Alexander, one from Apamea, the other from Hierapolis, had come from John of Antioch to tell Cyril to wait no longer. Yet these same two, along with sixty-six others, personally voted against the opening of the Council in the absence of the Syrian bishops. Nes-torius refused to recognize the jurisdiction of this incom2 plete number, and consequently would, not appear or put in any defence. Yet the first, meeting was held. A crowd of Ephesians g~ithered outside the Church of Mary as the sessions opened. Would Nestorius be con-demned? Would the popular app+llation of the Virgin be 179 W. 'B. FAHERTY '~: ' approv~O.~"~ C~rril, ,whom the Acts Of the Council describe as ".holding the.place of the most holy Celestine, Bishop of the Roman Church" (Mansi, IV, 1123);. presided when the ~ase of Nestorius was discussed. Various pertinent docu-ments were read, and a vote taken.'One hundred and ninety-eigh.t bishops subscribed to the condemnation. The setting sun, had reddened the waters of the Ionian Sea and the quiet .of evening wrapped the city be'fore the first long sessi6n was over. When the bishops filed from the Church, the word of the condemnation spread lik~ elm leaves in autumn among the expectant multitude. Where once rang the ~ry, "Great is Diana of the Ephesians," the shouts of "Theotokos, Theotokos" reechoed in honor of Mary, the Mother of God. With a thousand flaming torches, the Ephesians led the Fathers of the Council in tri-umph back to their temporary residences. A few.days later the papal legates arrived with a defini-tive letter from Celestine. The assembled prelates Were merely to promulgate the decision already made against Nestorius and make it universal. In the third session (2uly lst)the Roman legates confirmed the measures taken. With this the doctrinal work of the Council was a.lmost at an end. ¯ Several trying weeks, were to elapse before the adjournment.-During this interval Cyril preached the sermon in which he spoke the words of our title. Nestorius was deposed from his see in October of the same year, and a moderate prelate, Maximinian, succeeded him. Thus e~ded the Theotokos cgntroversy. For all time it was settled that the universal brotherhood of the-Chris-tian people could salute Mary as the Mother of God. 18o Who Is This Rodriguez? Augustine Klaas, S.J. AUGUSTA Theodosia Drane, the future Mother Francis Raphael, gifted writer and Provincial of the Dominican co.mmunity of Stone, England, tells in her memoirs of her first meeting with Rodriguez. She was about twenty-five at the time and still an Anglichfi. "One day in Mr. Maskell's library I stumbled on three volumes in dark green cloth, the title of which took mY fancy 'Religio.us Perfection.' I carried them ~0ff. It was Rodriguez. A girl of sixteen reading .the Waverley novels for the first time would be a feeble comparison. Better was .this than any conceivable novel, for here at last I found reality. It was precisely what I wanted, what I had always felt the want of: and I Used to cry out, 'Oh if I had only had this bbok at fiftee.n, what a different being I should have been!'~.Imp°ssi'ble not. to be a glutton over these books. I read them by davy; I'read them by night; I read them aloud to my sister, who .was vexed with my enthusi-asm and did not relish the Fathers of the Desert; and When she objected, I walked down to Petit Tot and read them there. I went right through them in a week, and then I be-gan again, and went right through them a second time. If I ever hear depreciating remarks about Rodriguez, as if he were an old fogy, I feel as if I could slay anyone who does not lo;~e him as I do! I think he saved my faith." (A Mere-. oir; edited by Bertrand Wilberforce, O.P., p. 51.) Most religious, perhaps, have not felt the initial impact of Rodriguez' spiritual classic quite so acu(ely as this Angli~ can young lady. At least they have not expressed .them-selves nearly so enthusiastically. Yet, it must be admitted 181 AUGUSTINE KLAA$ that the work of Father Rod/iguez is one of the all-time spiritual best-sellers, and certainly, after "the Spiritual Exercises,;. the most influential spiritual book written by a Jesuit. It has formed and molded tens of thousands df ~eligious, priests, and layfolk for three hundred years and in importance has been placed by discerning critics immedi-ately after the Imitation of Christ, alongside such notable works'as Scupoli's Spiritual Combat and'Francis de Sales'. Introduction to a Devout Life. Pius XI in 1924 addressed to the major superiors of all religious orders and congrega-tions of men an Apostolic Lette.r, in which referring to the training of novices, he says: "Most useful to read through and study will be the writings of Saint Bernard, and of the Seraphic Doctor Bonaventure, as also of Alphonsus Rodriguez . Their power and efficacy, far from failing and being weakened by lapse of time, seem today rather to have increased." (AAS, XVI, p. 142) Who, then, is this Rodriguez? : The Man Alphonsus Rodriguez, unfortunately, has always suf- ¯ feted from the petty annoyance of mistaken identity. And no wonder, since some thirty-five Jesuit writers bear the name of Rodkiguez, four of these prefixing Alphonsus. 'Most frequently he is confused with the Jesuit lay-brother, Saint Alphonsus Rodriguez, who was his contemporary and also a spiritual writer. It is worthwhile, therefore, to set things right by sketching the main events of his life, about-which there is almost nothing in English, and also to add a few interesting details about his great spiritual book. For an account of his early year~', two documents, signed by himself, are of special value. The first is a statement 1~82 Ma~ , ! 944 " " WHO I8 THIS RODRIGUEZ? written by him in the third :person when he was received.:.as. a Jesuit novice in Salamanca:- "He was examined by Father Rector, July 141 1557. Native of--Valladolid, 19 years old, son of Doctor.Rodri-guez and. I)ofia Maria Garcia; a student, has done two years of theology; has profited, greatly from his studies. Signed: Gonzfilez Alonso .Rodrlguez. J In the margin occur these words: "He has.received the tonsure." ¯-Four and a half years later, in January 1562, Alphon-sus, then a Scholastic, filled out-a questionnaire for the Jesuit Visitor from Rome,. Father Jerome Nadal, in which¯ he gives us acandid.portrait of himself (Monttrn.entaS.d.; Nadal, Tome. II, pp. 532-533) : " "My name¯is Alonso Rodriguez. -- Three months from now I shall have completed my 24th year.x , -- I am from old Castile.and V-alladolid. m My parents-are living: -- They have sufficient to support them. --. I have two sisters who are nuns, and four brothers: one.is a monk, another is a priest. , the other two have. almost nothing~ except what their parents may leave them .,. neither is married. " -- I have no debts or obligations, .excepta half-real. which I found and. though knowing to whom it belonged, I did not return it ;.now I have nothing, and even. if I had anything, it seems I could not return it.-- In the world I was devout and given to prayer and almsgiving; and so I prayed a lot, but I did not often frequent the.sacra:. ments, nor did I know anything about mental prayer.-,- I made a vow to be a religious or a monk " On account: of my vow and desire to serve God, .I entered the Company without any consolations., four and a half years ago . . ~ It is a year and a half since I took the vows. ~ Once I XHence, Alphonsus Rodriguez was born in 1538, and, not in 1526, as is stated in Father Rickaby's English edition and elsewhere.' 183 AUGUSTINE KLA~$ Review/or Religious made:the exercises of the First Week for eight or~ nine days. -- I have served in the lowest'offices of the house, made a pilgrimage, served" in hospitals., taughtcatechism. - "I desire to persevere until death in the Company and, with the grace of the Lord, to Obey in all things, no matter how difficult and hard they may be, and to keep the rules very perfectly,, as something in which my perfection con-sists. I desire very much to undergo all the mortifications and experiments of the Company, as though I had just recently entered it, and I desire my superiors ~to take great care to mortify me, because I need it very much, since I am very remiss in mortifying myself . On the other hand, Our Lord gives me promptness to obey in all things . . . Particulaily do I wish to be instructed in prayer .(about whichI am very ignorant) in order to know how to make further progress. -- Wherever the greater service of God our Lord may be, thither am I inclined to go; even though it be to the confines of the earth, I shall go there with good will; and I desire to be able and capable of undeitaking difficult and great things with the div.lne favor. -- Sala-manca, January 15, 1562. Alonso." ¯ Questioned about his studies, he adds: "I have studied thirteen years: five of grammar and three of arts in Valla-dolid, and am now studying theology for the fifth year in Salamanca. I have been thought to be very healthy through-out my studies. I have an inclination for studies, and especially, for theology. But I have little talent for them, especially for metaphysics. Memory is poor and intelli-gence likewise. I know very little about anything, but it seems I know more theology than anything else. I am a bachelor of arts." Obviously Alphonsus.was a young man of high Spir-itual objectives coupled with a humble estimate of him-self. This depreciating inventory of his talents and virtues, .184 May, 1944 WHO Is THIS RODRIGUEZ? however, was not accepted by his. superiors, for after his studies and ordination to the priesthood he was immedi-ately made master of novices in Salamanca at the precocious age of twenty-five. And the records of the time note also that he was "very skillful in solving cases of conscience:" Three years, later, in 1~566, Father Rodriguez left the novitiate at Salamanca for the joint college and seminary at M0nterrey in Galicia, where he taught moral theology in the seminary. Certain little moral treatises written during this period were highly esteemed by Father Thomas San-cbez, the distinguished Jesuit moralist, who made use of " them in his own writings. R.odriguez wasalso rector of this institution of some eight hundred students for six years (1570-1576), and, despite his many duties as rector and professor, f?equently preached "with some ability," heard confessions, and taught catechism in the town's ¯ environs. In 15 79 we find him. in his native cit.y of Valla-do! id, engaged in the Works of the ministry and solving cases of conscience. He remained there for six years. In 1585, by special Order of Acquaviva, the Father General, Rodriguez was sent from his own province Of Castile to that of Andalusia"to be rector and mas[er of novices at the famous college and novi'tiate of .Montilla. He was sent as a troubleshooter to solve some peculiar diffi-culties ~involving the training of young religious. His own provincial superior, Father Villalba, was loath to let.him- .go! "In very few men are so many qualities found together: It is truly a considerable loss for our province. He is very learned, an excellent religious, and made for training young religious in spiritual life and devotion. Of that we have no less need in Castile than in Andalusia." (Astrain, Historia IV, p. 745) On the otherhand, the success of his work at Montilla can be gaged from a letter written two years later to the 185 AUGUSTINE KLAAS Review /:or Religious General by the Andalusian Provincial, Father Gil Gonz.~- lez Dfivila: "One finds there the true formation of the Company and the real way. of training novices . Those who come from" it live according to the true religious spirit, the spirit, of obedience and abnegation, and are. distin-guished for these virtues? To my mind, the best present that Your Paternity has made tb our province . has been to call to it Father Alphonsus Rodriguez; and I hope that if the Fathers of the. third probation pass through his hands, the fruit will be still more precious . '~ (Astrain, ibid, IV, p. 745) Another n~ark of confidence was shown ¯ him when he was chosen to represent the Andalusian prov-ince at the Fifth General' Congregation of his order, held in Rome in 1593. This Congreg.ation put an end to those internal difficulties of the Spanish Jesuit provinces-for .the solution of which Father Rodriguez had labored with such consummate prudence and ability. Five years later Rodriguez left Montilla, having been appointed a general inspector of the Jesuit-establlshments in the province of Andalusia. That done, he.was in Cor-dova the following year, hearing .confessions and giving retreats, and there he remained for eight years, until 1607, when at the age of sixty-nine he once more took up his old duties as master of novices, this time in Seville, and added to them the duties of spiritual father of the community. This was to be his last appointment. During the final two years of his life he was plagued with ill-health and the infirmities of age, so.much so that he could no longer offer up the Holy Sacrifice of the Mass. Then, on-February 21, 1616, "after having received all the sacraments with full consciousness and with such serenity that he seemed rather to sleep than to die," he quietly passed away at the goodly age of sev2 enty-seven years and ten months. Father Alphonsus Rodriguez was an exceptionally 186 .7 May, ,1944 WHO IS THIS RODRIGUEZ? well-balanced character--not brilliant, but prudent, reli-. able, and stead~: Father Nieremberg, who knewhim well, describes him as "affable, thoroughly saturated with the charity of Christ, without a trace of bitterness or sadness; a faint, gentle smile on his countenance." He was much given to' prayerful retirement and perhaps for that reason was som. ewhat timid in meeting externs, He was notwhat we call today "a contact man." "I do nol~ know how to dea! or observe the amenities with e~:terr~s, as my duties demand," he wrote humbly to the General. And Father. GonzMez, the Andalusian P~ovincial, mentions in an offi, cial letter the ."timidity of the superior'.' and ',his emba'~- rassed mannerisms," but adds that this difficulty can be remedie~d by having recourse to ~ther Fathers--and he might have added that the suppl3; of such is usually plen-tifui. : Nevertheless, despite this annoying h~indicap, he was a capable superior, demanding an exact account of what was being done and giving orders so precise that "he seemed. thoroughly attentive to each detail withoutany distrac-tion." His decisions once understood and their carrying out assured, he gave himself heart and soul to the spiritual direction of his novices and subjects. Here he was the mast ter perfectly at ease. In an unobtrusive way, he was a man of constant prayer, mortification, and meticulous observance of rule. When h~ was told that his austerities might shorten his life, he made the disconcerting, but very discerning reply, "An unmortified religious man. is already dead." His own religious brethren do not seem to have been too much aware of his more than ordinary sanctity, for when the 3esuits of Madrid were officially proposing to a certain prelate of the Rota the beatification of Rodriguez' fellow-townsman and contemporary, Father Luis de la Puente, the great author-° 187 AUGUSTINE KLAAS "." Review [or Religious ity on prayer, the prelate exclaimed: "Good! but why not make the same recommendation for the saintly Father Alphonsus Rodriguez ?" His Book At what period of l~is life did Father Rodriguez write his Practice of Perfection and Christian Virtues? The bulk of it was written and delivered as exhortations during the thirteen years he was master of novices at Montilla. 'At the bidding of superiors, he arranged the material and improved it during his stay at Cordova, and finally published the first edition in 1609 and the second in 1611 at Seville. ~During the last year of his life, though suffering greatly -from his infirmities, he revised the whole work for a third edition. :. When he was informed on th~ Feast of the Puri-fication, 1616, that the printing of it was completed, he folded his hands and said. cheerfully, "Now thou dost dis- .miss thy servant, O Lord, according to thy word in peace" .(Luke 2:29). Two weeks later he was dead. The book has gone through more than fifty editions in Spanish, and has been translated in.to at least twenty lan-guages, including Arabian, Tamil, and Chinese. Among the French translations we find one made by the Jansenists in 1673, in which the.y secretly inserted their erroneous doc-trines on grace. ¯ The first English version was ¯published between 1697 and~ 1699, the translator being none other than Sir John Warner, Baronet, of Parham in S{affolk, otherwise known as Father John Clare, S.J. He is an interesting pe.rsonage. With his young wife he was converted to the true faith and both decided to become religious. She became Sister Clare of the Poor Clares of Gravelines; he.became a Jesuit. They made their solemn profession on the same day, August 15, 1667. Subsequently he became procurator, and later 188 Ma~l, 1944 WHO IS THIS RODR~GUEZ? provincial of the English Pro;cince, but spent most of his life as master of novices and spiritual father at the English novitiate at Warren, Belgium. It was there towards ~he end of his life that he made his translation through the medium of the French version of Abb~ Regnier des Marais,. and saw it through the nearby press of St. Omers. Father Joseph. Rickaby, S.J., the most recent English translator, made some use of it, for he notes in.his preface: "it has cost the present translator a world of toil and trouble. In my veneration for the quaint old seventeenth century version, still read amongst~ us, I endeavored to base my work upon that, instead of doing what I was ultimately forced to do, translating straight from the" Spanish." Practice of Perfection .and Christian Virtues is prima-. rily and .almost exclusively an ascetical, not a mystical work. To criticize it unfavorably, as some have done in recent years; for not discussing mystical prayer at length is unfair. Such was not the purpose of the book. Its author's principal aim was the training of young religious; accordingly, being a man of prudence and common sense, and a go6d pedagogue, too, Rodriguez adapted his teaching on higher prayer to the limited capacity of his disciples, who were mostly beginners in the spiritual life. He is not "anti-mystical.''~ The work deals not so much with the theory of asceti-dism as with its practice. The author.says that he.put the. word Practice in the title because "things are treated in it ih such a .way as may render their practice, very easy." Nor is the subject-matter discussed comprehensively in all its details: "I have laid before" you, as clearly and briefly as I was able, such things as are more essential and more corn- 2To cite but one eminent authority: Father Herbert Thnrston writes in The Month (Vol. 154~ p. 425) : "There can be no question that Father Rodriguez recognized and extolled the higher prayer." Cf. Rodriguez, Practice Vol. 1, pp. 254, 255, 262. 189 AUGUSTINEKLAAS " Revle~v for Religious mort to our profession." However, this practical, limited scope does not on .that account place his spirituality on a low plane. Rodriguez seeks to lead religious.to the highest sanctity by faithfulness to duty in little things, byperfect performance of ordinary adtions, by unremitting purity of intention, by habitual and ever closer conformity to the will of.God. He endeavors to form religious of sustained prayer, m6rtification, apostolic zeal, °and all the virtues; and he points to the loftiest exemplars, Christ and His saints, for "to attain to perfection, one must fix his eyes on what is highest and most excellent." And who will say that he has not succeeded? ¯ The principal sources of Rodriguez' doctrine are Holy Scripture, the Fathers of the Church, and the great spir-i. tual masters of the.past, with a particular pr, edi!ection for those stal~carts, .the religious of the desert. Among the ¯ most frequently .cited authorities are Saint Augustine (271 .times), Saint Bernard (2.5.8 times), Saint Thomas Aquinas (86 times),., and Cassian. ~is. .p.Huries . Ccoasmtilpiaons aitnido nab iosv de ethaer .oa.nrddi n.amrYet~h .0i.dni lcia.t!e:r ahriys~la mnegruita,ge ~hough somewhat .prolix. He has imagination and a ,ki, ndly humor--'.'pepper and¯salt," as one.writer says. For examp!e~ he says that a religious who jumps h, astily a.nd light!y from virtue to x~!rtue is "likd a cat w.~lking on hot coals." I.n addition, all will agree that Rodriguez has an indefinable unctionall his own. " 0fcourse, A!phonsus Rodriguez is. by. no means the perfect author. In his knowledge of things scientifiC, his-torical, and hagiographical, he is a man of his times. He considers certain apocryphal works authentic; too often he copies his sources at second hand; he draws ~considerably on the uiapublished exhortations of his Provincial, Father Gon-zfilez D~ivila, without giving him due credit. A few points 190 Ma~t, 1944 WHO IS THIS RODRIGUEZ? of his doctrine can be legitimately contested and evem impugned. Some of his examples and anecdotes are con-sidered today to be lacking in good taste: many'of, these have been excised in recent editions. But, after all, these. are only minor flaws in an author whose work is a master-piece of spiritual writing, that has successful"ly stood the test of time, and that even.with readers who are more than" ordinarily critical and exacting. It is today the most widely used spiritual textbook .of religious .the world over. A definitive critical edition would indeed be Very Welcome: Many witnesses could be Cited to proire the value and popularity of Rodriguez. Forexample, Father Faber calls the book "an inestimable treasure of the Church." Found-ers and foundresses of religious congregations have been especially lavish in their praises. Our own Mother.Chbrini drew up a list of five books as constituting a sufficient, spir-itual library for her congregation. They are: the Imitation ¯ of Christ, the St~irituat Exercises; the Religious in Solitude Of Father Pinamonti, S.&, the :Bride o[ Christ Of Saifit Alphonsus Liguori, and thePractice of-AlphonsusR0dl!- guez. Saint Alphonsus. Liguori and Saint John. E~dgs. often recommended~ the. Practice. Let Saint Vincent de Paul; the founder of the Lazarists, be our last witness.~, In an instruction to his.religious icongregation dated May: 17, t 658, accompanying the book of Rules he was sendiiig,: he exclaims: "'O Lord, who hast bestowed such blessings~ .on .many books, for example, on the"one we are now re, adihg - at table, so that well-prepared souls migh~ reap .therefrom considerable fruit, in order to free themselves from their faults and go forward in perfection, grant, O Lord,. th) blessing on this our little book . " Father Pierre Coste, the saint's official biographer, says that the book being read at table was none other than the Practice of Per-fection and Christian Virtues by Alphonsus Rodriguez. 191 Two Hymns t:o Mary Francis N. Korth, S.J. SEVERAL mon.ths a'go a reader of REVIEW FOR RELIGIOUS'wrote to the editors for information concerning a hymn beginning with the words, "Te Matrem." As the editors had no definite information to offer, they addressed the question to the other readers (cf. Vol. III, p. 70). In answer to this request a large number of letters w~re received. These letters carried a great deal of interesting information concerning two hymns to Mary, Te Matrem Dei Lau-damus and Te Mariam Laudamus. The present writer has collated the' information and digested it into the following paragraphs. The hymn Te Matrem Dei Laudamus, often referred to as the "Canticum. S. Bonaventurae," adapts the canticle Te Deurn to the praise of Mary. It is usually printed at the end of five psalms in honor of the Blessed Virgin Mary, each of which begins with a different letter of the word "Maria." St. Alphonsus Liguori, busy as he was, frequently said these five psalms. For several centuries after the death " of St. Bonaventure (1274), the great 'Franciscan theologian' 'and Doctor of the Church, the Te Matrern was attributed to him. It is found in the early editions of his Opera Omnia, either as a separate canticle or as part of the" Psalterium Majus B.V.M: It is not found, however, in the latest and most critical edition (the Qu~racchi edi-tion) Of St. Bonaventure's worksY Fr.Gallus Haselbeck, O.F.M.,in his Seraphiscbe Marienrninne remarks in substance that, while St. Bona-venture wrote poetical works, there is no poem on the Blessed Virgi.n that can really be proved to be ~is work. (See also J.H. Sbaralea, 8upplementum et Castigatio ad Scriptores Triurn Ordinurn S. Fran-cisci,' Romae, Editore Nardecchia, 1908, Pars. I, p. 1640 It seems that the Te Matrein Dei Laudamus was composed for the Great Office of the Blessed Virgin. This Office never gained uni-versal "recognition and has not become a part of the' Liturgy of the Church. However, the Te Matrem itself has'been used extensively at various times for p.ublic and private devotion. Venerable Vincent Pallotti, founder of ~the Pious Society of' Missions, propagated it through his books and.used it for May devotions. Several of our corkespondents told us about anothe'r hymn, Te Mariara Laudamus, similar to the Te Matrem. The Te Matrera 192 1944 Two HYMNS TO MARY has 44, 45, and 46 verses respectively in the three available Latin versions (all have the same thoughts with a few divergent verse-arrangements) and 43 verses in the two Engli.~h translations at hand.1 This hymn (the Te Matrem) is an almost literal transposi-tion of the thought of the Te Deum, with the exception of 14 extra vers~s (all beginning with "Tu" in the appended Latin text) inserted in the middle of the canticle. Aside from this inseition, the Te M~trern is a closer parallel'of the Te Deum than is the Te Mariam. The latter, however, with its 30 verses in the Latin (29 in the Eng-lish), comes closer to the length of the T'e Deum. Might this prac-tical identity in length have been the reason for the origin of the Te Mariam? At any rate we are told by one reader .that the Te Mariam is an abridgement of a much longer hymn (the Te Matrem) attributed to 8S. Augustine, ~Ambrose, and-Bonaventure in $chiitz, Su'mma Mariana, IL 310. Father William d. Chaminade,~Founder of the Society of Mary, included the Te Mariam in the Manual of the Servant of Mar~/, a book of prayers and hymns which he corn-- piled for the godalities of the Immaculate Conception at Bordeaux, France. This M~nual was printed in 1820 or earlier. In a copy of the Manual it is stated that Father Chaminade took the Te Mariam from one of the then current. French Antiphonaries. Anotl~er cor-respondent writes that "the Te Mariam is sung in places of pilgrim-age of the B.V.M., at least in some basilicas or places of pilgrimage in France." The Te Mariam is found in the Formular!l of the Society~ of Mary. Separate leaflets are printed at Maryhurst Normal, Kirk-wood, Missouri. At Marynook Novitiate (Society of Mary), Galesville, Wisconsin, "they also have the melody: it is really the . melody of the Te Deum laudamus adapted to the words and phrases of this Marian hymn." A variation of the Te Mariam can be found in The Reign of Jesus through Mary---On True Devotion to the Blessed Virgin according to Blessed Grignion de Montfort, Founder of the Com-pany of Mary. This book, composed in, French by Father G. Denis, S.M.M., was translated into English by'.Father A. Somers, S.M.M., and published in 1926 by Burns, Oates, and Washbourne, ,London, England. To conclude briefl~r: the Te Matrem dates back to the thirteenth 1A version of the Te Matrem under the heading, "CaCti urn Sancti Bonaventurae.". was copied thirty years ago from a Latin bo6k in honor of our Lady; the copyist tells us it has 48 verses. 193. FRANCIS N. KORTH, S,J. Review for Religiot:s century at least;, its authorship is unknown. It is not part of. the liturgy of the Church, but has been used for public and private devo-tions by various groups. A similar but shorter hymn, Te Mariara, has been in use since at least the early part of the nineteenth century. Te Matrem Te Matrem Dei laudamus: Te Mariam Virginem profitemur. Te" aeterni Patris Filiam: omnis terra veneratur. Tibi omnes Angeli et Archangeli: Tibi Throni et Principatus fideliter deserviunt. Tibi omnes Potestates et omnes Virtutes coeli coelorum: et universae Dominationes obediunt. Tibi omnes Chori: Tibi Cherubim et Seraphim exultantes assistu'nt. Tibi .omnis angelica creatura inces-sabili voce proclamant: Sancta, Sancta, Sancta Maria Dei Genitrix, Mater et Virgo. Pleni sunt coeli et terra: maiestatis gloriae fructus ventris tui. Te gloriosus Apo~tolorum chorus: ¯ sui Creatoris Matrem collaudat. T~ beatorum Martyrum coetus cahdi-datus: Christi Genitricem glori-ficat. Te gloriosus Confessorum exercitus: Trinitatis .Templum appellat. Te sanctarum Virginum" chorea amabi- 'lis:. k, irginitatis et humilitatis ex-emplum praedicat. Te tota coelestis curia: Reginam honorat. Te per universum orbem Ecclesia invocando concelebrat: Matrem divinae Maiestatis. Venerandam te veram Regis c6elestis puerperam: sanctam quoque dul-cem et piam. Tu Angelorum Domina: Tu Paradisi Ianua. Tu Scala: regni coelestis et gloriae. Tu Thalamus: Tu Arca pietatis et gratiae. We praise thee, 0 Mother of God: and hail thee, Mary, ever Virgin. The whole world venerates thee: as daughter of the eternal Father. Angels and Archangels, Thrones and Principalities: faithfully serve thee. All Powers and Virtues of heaven: all Dominations obey thee. Before thee all the angelic choirs: the Cherubim and Seraphim wait on thee with exultation. With unceasing voice all angelic crea-tures proclaim thee: Holy, Holy, Holy Mary, Mother of God. Mother and Virgin. The heavens and the earth are full: of the glorious majesty of thy Son. With One voice the" ~lorious choir of Apostles: praises thee as the Mdther . of their Creator. T.he white-robed host of' martyrs: glori-fies thee. as the Mother of Christ. The glorious army of Confessors: names thee the Temple of the Trinity. The lovely company of holy Virgins: prolaims thee as the model of virginity and humility. The entire heavenly court honors thee as Queen. Throughout the entire world ~he Church pays honor by invoking thee: as the Mother of Divine Majesty, Venerating thee as the true "mdther "of ¯ the Heavenl~ King: holy, sweet~ ~ind loving. Thou art the Queen of Angdls: and the Portal of Paradise. Thou art the Guide: to the Heavenly Kingdom and its glory. Thou art the bridal chamber and the covenant of mildness and grace. 194 May, 1944 Two HYMNS TO MARY Tu Vena misericordiae: Tu Sponsa, et Mater¯Regis aeterni. Tu Templum et Sacrarium Spiritus Sancti: totius Beatissimae Trini-tatis nobile. Triclinium. Tu Mediatrix Dei et hominum:. Ama-trix mortalium, coelestis IIlumina- ¯ trix. Thou art the Channel of Mercy:" Spouse and Mother bf the eternal King. Thou art the temple and shrine of the Holy.-Ghost: the tabernacle of the Most Blessed Trinity. Mediatrix between God and man: lovei of mortals, our heavenly enlightener. Tu Agonizatrix pugnantium. Advocata." Thou art the Inspirer of warriors: pauperum: Miseratrix et Refugium peccatorum. Tu Erogatrix munerum: Superatrix ac Terror daemonum, et superborum. Tu.mundi Domina, C6eli Regina: post Deum sola spes~:nostra. Tu Salus Te invocantium, Portus naufragantium: miserorum Sola-tium, pereuntium Refugium. Tu Mater¯omnium Beatorum, Gaudium plenum post Deum: omnium super-norum civium Solatium. Tu Promotrix iustorum, Congrega-trix errantium: Promissio Patriar-charum. Tu Veritas Prophetarum, Praeconium, et Doctrix Apostolorum: Magistra Evangelistarum. Tu Fortitudo Martyrum, Exemplar Confessorum: Honor et Festivitas Virginum. Tu ad liberandum exnlem hominem: Filium Dei suscepisti in uterum. Per Te, expugnato hoste antiquo, sunt apert.a fidelibus gegna c"oelorum. Tu cure Filio tuo iedes: ad d~xter~m Patris. Tu [psum pro nobis roga, Virgo Maria: Quem nos ad iudicandum credimus esse venturum. Te ergo poscinius nobis tuis famulis subveni: qui pretioso sa~nguine Filii tui redempti sumus. Aeterna fac, pia Virgo: cure sanctis tuis nos gloria numerari. S~Ivum fac populum tuum, Domina: ut sirens participes haereditatis Filii tui. E~ rege nos: et custodi nos in aeternum. Per singulos dies: O Pin, Te salutamus. ¯ the advocate of the poor, and the compassionate refuge of sinners~ Almoner of Heaven: conqueror and ter-ror of demons, and of the haughty.-. Queen of Earth and Queen of Heaven: after God, our only hope. Welfare of those who invoke thee: haven of the shipwrecked: solace of the ~retched. refuge of the dying. Thou Mother of all the Blessed, after God their fullest joy: comfort of. all the citizens of Heaven. Thou art the Patroness of the ins_t, thbu gathere.st the wandering: and art the promise of the Patriarch~. Thou art the truth of the Prbphets:" the glory and the teacher of the Apostles and Evangelists. ~ Thou art the strength of Mai~yrs, the exemplar of Confessors: the. honor and joy of Virgins. To frde man from exile, tho6 did~f receive the Son of God in thy~.omb. By thee was co.nquered our enemy of old: and Hea~,en was opened for the faithful. With thy Son thou sitt~st: at the: right hand of~the Father.' Pray for us to Him, O Virgin Mary: ~-: who, we believe, will cgme to. judge us. Wherefore we beg thee to aid us, " " thy. sdrvants who have been re-deemed by thy Son's Preciofis Blood. Help us, gentle Virgin, to be numbered with thy saints in eternal glory. Save thy people, Blessed Lady: that they may partake of the heritage of 'thy Son. Rule us: ~nd p.rotect us for all eternity. Daily we greet ~hee: O 1o~,ing Mother. 195 FRANCIS N. KORTH; S.J. . Et laudare Te cupimus: usq.uein aeternum mente et voce. ." Dignare, dulcis Maria: nun et ¯ semper nos sine delicto conservare. Miserere, pia, nobis: miserere nobis. ¯ Fiat misericordia tua magna nobiseum: quia in Te, Virgo Maria, confidi- IllUS. In Te dulcis Maria, speramus: nos defendas in aeternum. Te decet laus, Te decet imperiu~a: Tibi virtus, et gloria in saecula saeeulorum, Amen. Te Mariam Te dilectam Dei Patris Filiam: omnes angeli pr~edicant. Te 'admirabilem Verbi Matrem: credit inferus et contremes¢it. Te Spiritus Sancti Sponsam: piacu-lares flammae invocant. Te omnes Ecclesiae hill: totis praecordiis exultant: MatRm : immensae miserkordiae, Carissimam sanctae Annae: et unicam Filiam, Dilectissimam a Deo: Josephi Sponsam. Tu vena ~eniae: Maria. Tu slngularis: Mater es gratlae. Tu ad redimendum genus humanum: tuum commodasti uterum. Tu, Gabrieli dato consensu: gaudium peperisti universo mundo. Tu, Regina, a dextris Dei stas: Circumdata varietate, 196 Reoiew £or Religious And with mind and tongue we desire: to praise thee forever. Deign, sweet Mary: to preserve us now and forever free from sin. Have mercy on us, O loving Mother: have mercy on us. Let thy mercy "for us be bountiful: for we trust in thee, O Virgin Mary. ¯ In thee. sweet Mary, do we hope: do thou protect us forever. Praise becometh thee: empire befits thee: to thee be power .and glory forever and ever. Amen. We praise, thee, O Mary: ~a£d proclaim thee immaculate. All sinners have recourse to thee: for thou art their refuge: All Christians: and pious associa-tions with their individual mem-bers, devoutly" acclaim thy Concep-tion. Immaculate, Immaculate, Immaculate: O Virgin Mother of God. There is none who would hide himself from the genial warmth of thy char-ity: for thou art the morning rising. All the angels proclaim thee: as the loved Daughter of the Father. Even trembling hell acknowledges thee: as the admirable Mother of the Word. The Purgatorial flames invoke thee: as the Spouse of the Holy Spirit. All children of the Church: magnify thee in the exuberai~ce of their hearts: As Mother of infinite mercy, As the dearest and only daughter: of Holy Ann, As the Spouse of St. Joseph: and most beloved of God. Thou art, O Mary, the channel of mercy. Thou art the all-excelling Mother of grace. For the redemption of the human race: thou didst accede to the designs of God. And by consenting to Ga-briefs word: thou didst beget joy for the whole world. Clothed in varied beauty, thou stand. est as Queen at God's right hand, Te Mariam laudamus: te Immaculatam confitemur. Te reorum patronam: omnes peceatores deprecantur: Tibi omnes christiani: ,et asceticae congregationes: tibi singuli so-dales in Conceptione tua devote proclami~nt : Immaculata0 Immaeulata, Immaculata: O Virgo Theotocos. Nullus est qui se abscondat a calore tuo: aurora consurgens. May, 1944 Mediatrix ut sis: Dei et hominum. Te ergo quaesumus, nobis subveni: q~ii tuam nominatim illibatam Conceptionem solemniter cele-. bramus. Aeterna fac: angelorumbe~,tltate donari. Protege tuos alumnos: et tuere fasciculum haereditatis tune. Et love illos: et fecunda in oper-ibus. virtutum. Tuis solemnibus congregamur: ad benedicendum tibi." Et extollimus Nomen Marine: super omne post Jesu Nomen amabile. Dignare, per purissimam Conceptionem tuam: nos a peccato praeservare. Ostende pro famulis tuis Filio tuo: pectus et ubera tun, Ut ostendat Patri sUO Unigenitus: latus et vulnera. Nulla erit repulsa: ubi talia erunt carttatts mstgnta. Te decet laus, te decet hymnus: tibi jubilus, ih Conceptione tua Immaculata00 Maria. ab universa creatura. Amen. TWO HYMNS TO MARY In order to be the mediatrix of man-kind. We beseech thee, therefore, come to our help: who with special and solemn cult honor the immaculate purity'of thy Conception. Grant that one day: we may be made partakers of angelic bliss. Protect thy children: and preserve thy little Society,. which is thy heritage. And cherish them: and" make them al~ound in the fruits of virtue. On thy festal days we gather round thee: to sing thy praises; And we extol the name of Mary: above every other name, next to the loving name of JeSus." By thy most pure Conception:. deign to preserve us from sin. In behalf of thy children: show thy loving and maternal heart to thy Son, so that in His turn, thy only begotten Son may exhibit: His side and wounds to His Father. There will b~ no refusal: when such pledges of love .are manifest. Hymns of praise and jubilation are due to thee from every creature: owing to thy Immaculate Concep- - tion, O Mary. Amen. NOTE ON THE SOURCES OF THE TE MATREM: The hymn has been found in an old Community Book of the Redemptorists which bears the date 1860, Other sources (Latin or English) that were indicated in the letters sent to us are: The early editions of St. Bonaventure's Opera Omnia. E.g.: 1584 Venetian edition. Tom. II, pp. 316 ft. Paris edition, Tom. XIV, p. 222b. It is also the 1504 Venetian edition and the 1596 Vatican edition. C'f. above, for the recent Quaracchi edition. Mese Di Mag~io Consacrato A Maria 8antissiraa Regina Degli Apostoli Ad Uso Degli Ecclesiastici, Vincenzo Pallotti. " Regain et Testamentum 8.P.N. Francisci. : ollegit Ft. Hilarius ab Antwe'rpia; Tornaci Nerviorum, 1876. lntroductio ad Vitara 8ecapbicara, auctore P. Ft. Gaudentio, O.F.M. Herder, Freiburg, 1'882. Summa Mariana, J. H. Schlitz, Paderborn0 Junfermannschen Buchhandlung; 1908: II, pp. 310-312. Via Franciscana ad Caelestera Hierusalem, auctore P. Pa~lo a Cr. Laschan. Pustet, 1912. Liber Manualis Minoritae, editus iussu A.R.P. Donati' a Welle,. O~F.M.Cap: Typis Soc. S. dohannis Evang., Desclee, 1931, (Continued on next page) 197 [EDITORS' NOTE: We intended to" publish only letters on retreats in the present number. But after th~ Ma~:ch number went to prdss we received tw9 communica-tions on vocation that we thought should be printed. Hence the present number - contains letters on both subjects. We had to condense some of these communica-tions,, and.we still have some for later publication. More letters on retreats will 'be welcome. Kindly make them as brief as your subject-matter allows. Address then~ to: The Editors of.Review for Religio.us, St. Mary'.s College, St. Marys, Kansas.] On Re÷rears Reverend Fathers: May I submit the following thoughts that came to mind as I read your request for letters on retreats: A. Making a retreat: Experience has .convinced me that. one must put aside the ordinary duties of acti~re life. A change of scene is imperative, espe- .cially. fOi, superiors .and administrators. 2." A "closed" retreat is the only setting.suitable for the in'yard silenc~ .and r&oilection imperative for success. ¯ .3. It is not good policy to cover much readingmatter. What is read should be .th.eologicaHy sound, suited to the. individual, and pro*ocakive of. reflection. ., . 4. A wholesome pr.actice in preparation for retreat is tO xey!ew, pgst r~tre~ts and one'~-!i.fe following them, with an aim of making the present exercises really influential in shaping one's course from then 'onwards: " '.: " Bi. Giving r~kre;i~s: ". . .: . 1. A reverent approach.is the ~nly proper one:.a retreat is the work of God; a work that may mean the salvation Of a soul or "t]~ )nakifi'g c~f a saint. " ": " (Note"continued from preceding page) The Mffror of the Bless6d Virgin Mary and The Psalter of our. Lady, by St. Bonaventure. Trans. by Sister Mary Emmanuel, O.S.B. B. Herder Book Co., St. Louis, 1932. Pp. 294-297. The Catholic Apostolate, published by the Pallotine Fathers, Milwaukee, Wis-consin, Vol. XI, p. 113. (Eng. trans, by the Rev. Jos. Baier.) Deuotion in Honor o~ our Blessed Lady; The Fioe Psalms: pamphlet issued by Tile .International Catholic Truth Society, 405-407 Bergen SL, Brooklyn, N. Y. (It is published by permission of the Redemptorist Fathers.) 198 . :.: . COMMUNIGATION$. ,. 2.The retreat master would .d0. well to avo!d.ipeaking,0f. himself. ¯ , 3. Conferences should be kepton a i~igh plane: deeply and supernaturally spiritual. They should be delivered with simplicity and sinceritg. . - .:. .:. ¯ ,. 4. Retreat m~isters would d0.well to avoid.the .use.of."We." '.'We know," "We realize," "We must," "Yet, we often," and.so forth. Retreatants like to accept the conferences .as coming from God, and the retreat master's identifying himself with the retreatants tends to frustrate their efforts. 5.-Novelties or novel themes should not be used to make an impress.ion, or to convince that the retreat master is "different," or the retreat "different." Sometimes this is done to the" neglec~"of important fundamentals, for'example~hell, obedience,' silence:' " 6. Truths that are old and obvious must be reconsidered in every retreat; and time-worn advice must be repeate.d. ~ . 7.Fresh. presentation is necessary-to draw and maintain interest and attention. .- ~: .:,.~ ¯ " .' APriest : " ~'~! R~)~rend' Father~ i . : '" ' ":""" " .MY .be.st retie~s begin" after"~h~y ~iie"~ohipl~ted. ' Fout'raeiia6rab]~: retreats of mY r~ligi6u~ life: ~i~e' 6nes whi~h,s~and ou for ~me.tl-iing in~'' :rather than ":taking~o~ei~hing .outi" Th~ 'ba~ed on 6ur H61y Rule. " Thh.iekieat 'ifiasker hgd"~en't" for~a coibY,) th~N~iice M~s~ress t61d us, and"made thd Spiritual Effeici~d~ ai3"pl~i dfi:edtiy to our daily; ll; ~s.' Thi'Hbl~;' Rfile became a living:, under.h~s direction. ~ . ' . . ' ' '"" ";~'::':' Anbther father showed ia his conference on the Sacrament of- Penance how very often nuns forget to confess envy:and jealou.sy,and:, to:make their purpose of.amendm.e.nt cen~gr.about love.of neighbor. It: makes one's faults against charity, show in .true.ligh~t. whe'n:.s,h~. confesses the basic, cause, .e:g. envy.S(ill another father he!d~:f0r.th such high ideals of sanctity that "_Christ the Ideal of: th :M0nl~ Marmion is included in. my privat.e spiritual read~ng at. least. ¯once every year since. ¯ . ':. Last summer we l~ad a retreat based on the most.beautiful medi-tations I have ever heard.- The director acually showed us hove.to 199 CoMMuNICATIONS Review [or Religious meditate. I p~ay for him every"day as h bendfactor because h.e has so helped ~y meditation problem. " : i'didn't like a retreat in which we' meditated on the Passion on Easter Sunday because the Exercises put it at ,that time. I didn't like a retreat in Which every meditation began with the sanie formula. "I ha~e never liked '"hell-fire" retreats. I could nevdr be scared intobeing good. I could be converted through 16ve of G~d. I do not like to be "'read at" during retreat. If the director uses notes" I. like to have him look at his audience, now and then. Finally,. thirty-five to forty-five minutes are long enough for any conference. If a retreat master hasn't converted me in a thirty minute. talk, he never will by talking over an hour. A Sister Reverend .Fathers: ,When I make a retreat, I don't like the retreat master to in(ro-duce "novel" things to the~ extent of getting away from-afiy of the old and fundamental truths. And if the retreat master uses the Exercises of St. Ignatius, I like him to bring in the: additions, annota-tions, and so forth, because I think that these help us to understand the¯Exercises and to make a bitter retreat, Also~ I think the explana-tions of the points ought to be short enough to allow the retreatants to meditate for a while by themselves. And I like to have a few little .stories and examples in the explanations of the points, because these lessen weariness and dryness.' Fifi~lly~since you've asked for sug-gdstions-- I believe that most of us who make. retreats are greatly aided if w,e feel that the retreat, master practises what he preaches: A Brother ~everend .Fathers: ' I am living in an infirmary where permanent invalids and some elderly Sistersare housed. For several yea.rs we have had retreat mas. ters who seemed more concerned about having us comfor'table and sympathized'with 'than about stimulating our spiritual lives. But a recent retreat master 'gave us a retreat for normal religious, who should understand "that suffering is basic, to spiritual growth, and~ who, if they understand their fundamentals, should strive to look upon suffering as a privilege in their spiritual lives and to use prayer 200 May, 1944 COMMUNICATIONS and the Uniting of their pains with the Suffering Savior for their own spiritual growth and for Other souls. If any group of religious needs to be stimulated to take their Courage in both. hands and to be willing to struggle bravely "and to fight valiantly, I believe it is the invalided religious. This recent retreat master, helped us. to do just that. Though I" have had devotion to the Holy Spirit for thirty years, it hadn't occurred to me that this is a particularly sturdy, "as well as liturgical, devotion. The retreat master expl.ained it as such; and he recommended it highly' to our sick--to make of us valiant women in our trials, soldiers of Christ, rather than self-pitying children." It gave me much joy to hear this because in my own eleven years of invalidism and hospitalization I have wondered why so many reli-gious look upon their suffering as a tragedy and an" opportunity for sel~-pity. This doesn't seem to be a normal Outlook, especially if one has any knowledge of the suffering which is borne in the world, even in the loveliest of homes. To conclude: From my knowledge of r.eligious, I believe Sisters like a sound exposition of practial truths, a "rousing up" on prin-ciples, a thorough overhauling of their every-day living--always with a definite solution through prayer and the Sacraments. This may sound like a large order; but I give it relatively and in contr"ast to the retreat in which one is left with volumes of theory or pages 9f mysticism. I have no quarrel with the beautiful mystici~sm of the Church. I love it. But women seem so often to become mysti.fied instead of mystical! Perhaps men do, too; I wouldh't know, but I have always thought that they are more apt to keep two feet on the ground. A Sister On Voca'don Reverend Fathers: In response to your invitation to "talk about vocations," we are eager to take advantage of this opportunity tO say something for the vocation to the contemplative life. ¯ Rev. 3oseph.3. Strauss, C.SS.R., in his communication on The Little Flowe~ Mission Circle, states that vocations need encourage-ment. This is particularly true of vocation.s to the contemplativ~ life. When a girl feels a desire to enter the cloister, she knows she is aiming high. She does not fed any too sure of herself, a.lthough she feels strongly drawn to a life of prayer and penance. Now, if she is 201 COMMUNICATIONS Rboieto t~or Relibious told that such a life is too difficult, that it does not accord with the spirit of our age, that it is useless, that she' could do more for God in" an active Order, she begins to doubt that God wants her in the clois-ter. She does not expect her parents to "feel, enthusiastic over her separating herself from them so completely, but .when she is dis-couraged by confessors, former teachers, religious friends on whose good judgment.she has always relied for guidance, the result often is that she enters an active Order where she does not firidcontentment, and very often leaves after a shorter or longer trial. This observation is the result of our,own personal e_xperience,in interviewing those who desire to enter our Order after ileaving an active one, or members of active communities who desire to make a change. We feel that if all those who have felt a desire to embrace our life had been duly encouraged we would not experience a want of vocations. - Poor Clare lquns Reverend Fathers : The letters in yo.ur REVIEW FOR RELIGIOUS concerning rdigious vocations have interested me. I strike my breast on many scores. For example, I have not put religious pamphlets in conspicuous places where young girls seeking information may receive the vitamins to increase or satisfy this hunger. Material about nursing, social work, and teaching is easily obtained, but they see.little about religious life. I hang my head when it comes to bringing up the subject in conver-sation. I wait f6r the girls to question; they wait for the Sister to instruct. The result is that nothing happens. In.'my prayers the petition for more candidates tags at the end of other requests which seem of more immediate importance. Unwillingly and u.nknowingly I m~y have shocked today's youth. They see us at such close range and are quick to criticize any lowering of their ideal. "The world is sO much with us" that it is easy to slip into its mannerisms. Now after accepting my share of the blame, I intend to fortify myself behind a table and say to the regular confessor of°young women, "Father, what about.you?" . You know your weekly peni-tents and afte~ a year or so you know their spiritual progress and desires, their temptations, in the world and their reaction. Some of these girls might be waiting for a suggestion from you that.would bring into being their first thought of a religious vocation for them-selves. 202 Mag, 1944 COMMUNICATIONS Perhaps in today's s.eminary you are instructed not to offer such. suggestions. .If that be the case then stop reading this immediately. I only know that it is because of my confessor I happen to be where I am, and I am extremely grateful for his suggestion of over twenty years ago. His Saturday line was a very long one so he didn't h;ive much time for each indiVidual. Outside of the confessional I didn't speak to him~more than a dozen times, and then only to bid him the time of day as we passedon the str.eet--so the influence came through the confessional. He first advised me to go each week to Confession and his advice was followed. Then one day he surprised me with: "Do you enjoy going out?" "Yes,. Father." "Do you have a good time in a social crowd?" "If I know the crowd." "Do you keep steady compa.ny?" "No, Father." "Will you say a prayer every, day for a special intention?" "Yes, Father.". A few months later he'qubstioned: "Do you know anything about the life of Sisters. "A little, Father." :'Do you think you would like to be one?" "No, Father." "Well, don't let this question, worry you. Say some praye.rs every day thi*t God ¯will let you know His will and that yot~ ~ill have the:strength to follow. I will remember this inten.fion in ~y Masses." ¯ Thus my confessor took 5he initiative and helped me to make: ~he ¯ first few steps toward my "vocation. This seems to me. to be. grand work--one that the regular, confessor can surely do better thhna retreat master or a teacher: In the future I'll .try harder to foster vocations that are so greatly needed but When it comes to bringing up the subject in conversation I think I'll turn to the regular confessor and say, "Father, what about you?" A Sister 203 Book Reviews THE MAN FROM ROCCA SIC;CA. By the Reverend Reginald M. Coffey, O~P. Pp. xi -I- 140. The Bruce Publishing Company, Mil- ¯ waukee, 1944. $1.75. " '~History probably offers no parallel case of a man being so com-pletely identified with wha~ he has Written. St. Thomas very early, poss.ibly even in his own lifetime, became an institution rather than a personality" (pp. 100, 10.1). In a well-conceived attempt to por-tray the human Thomas, the" author of this popularly-written little volume makes use of the legends and scattered data on the saint's life to reconstruct a fair picture of the man behind the Summae. Apart from a number of distra.cting author-to-reader asides and. an occa-sional expression not in the best of taste, the general reader who is l/o.oking for an 'introduction to this thoroughly human .personality will find The Man from Rocca Sicca satisfying fare. Several pages in .the chapters on the "dumb Ox," on Thomas the saint, the man, the preacher live up fully to the high promise of Father Farrell's preface. They stand out considerably above the level of the rest of the book in giving "a humanly touching intro-duction to Brother Thomas." In this day of excellently written biography and of exhaustive research into medieval sources, one looks forward to a definitivd life_ of St. ThomasAthe .religious, the statesman, the teacher and preacher, the champion of truth, the human dynamo, the dominant personality of his time. The'Man from Rocca Sicca suggests the human values that. will warrant special treatment.mL. THRO, S.J. SUBDEAC;ONSHIP: C;ONFERENC;ES ON THE RITE OF' ORDINATION. By the Revere'nd AIoyslus.Biskupek, S.V.D. Pp. xl -t- 301. B. Herder' B6ok Co., St. Louis, 19~44. $2.50. These medita~ion~ are the fruit of twenty years' experience in directing the Ordinandi Retreats at Techny. Father Biskupek quickly realized how rich in lessons for the young cleric was the ordination liturgy, suitable especially to the days preceding the cere, 'mony. Having found nothing in print along these lines, he mod-estly offers his own reflections as "something new in a field that stands in need of more cultivation."~ .204 BOOK R,EVIEWS The idea is splendid~ and worked out with a gentle persuasive-ness that bespeaks the fervor and maturity of its author. An outstanding merit o~ the book is its attractive simplicity. With no display of erudition or subtlety it proposes straightfor-wardly and effectively the clerical virtues which quite obviously link themselves to the sacred text. To some this obviousnes~might appear superficial. We might look for mort of penetration, grandeur, vitality. Two remedies suggest themselves: evidence of wider familiarity with historical and ascetical backgrounds, and a more humanly appealing richness of inspirational stories and actual experiences from the priestly minis-try. "Retreat masters might feel that a psychological analysis of the cleric's obligations is a more suitable framework for 'the daily medi-tations than the random sequence of the ceremonial. But for a daily hour of conference to link the retreat with the ritual looming so bright on the horizon, the comme.ntary is rich in suggestion. ~R. NORTH, S.J. MARYKNOLL MISSION LE'I'rERS: VOLUME II, 1943. Pp. viii ~-k 54. Field Afar Press, New York, 1943. $ .50. Falling bombs! In an instant a life;s work in utter ruins! Amid the terrors of war Maryknoll heroes are saving souls by bringing Christ not only to Chinese, but also to our American service men in China. The Letters give vivid persotial accounts of work ainong the Bhuddists, shopping tours in Kwelin, the strange life at Tibet, mis- "sion schools in war-torn villages. Thi~ second part of this booklet answers the question, "Why send missionaries to.South and Central America?" The descriptions of the sleepy life of the "barracas," the visit of Vice President Wal-lace to the mission in Villa Victoria, the tender devotion of the natives to Mary, the uniq

Issue 20.1 of the Review for Religious, 1961. ; Volume 20 1961 EDITORIAL O~FICE St. Mary's College St. Marys, Kansas BUSINESS OFFICE 428 E. Preston St. Baltimore 2, Maryland EDITOR R. F. Smith, S.J. ASSOCIATE EDITORS Augustine G. Ellard, S.J. Henry Willmering, S.J. ASSISTANT EDITORS John E. Becker, S.J. Emile G. McAnany, S.J. DEPARTMENTAL EDITORS Questions and Answers Joseph F. Gallen, S.J. Woodstock College Woodstock, Maryland Book Reviews Earl A. Weis, S.J. West Baden College West Baden Springs, Indiana Published in January, March, May, July, September, Novem-ber on the fifteenth of the month. REVIEW FOR RELI-GIOUS is indexed in the CATHOLIC PERIODICAL IN-DEX. JOHN XXIII Devotion to the Precious Blood [The following is an English translation of the Latin text of the apostolic epistle Inde a prirais, which Pope John xxIiI issued on June 30, 1960, concerning the fosterihg 6f devotion to ~the Precious Blood of Christ. The original text oF the docu-ment is to be found in Acta Apostolicae Seitis, 52 (1960), 545-50.] From the first months of Our pontifical labors, it oc-curred to Us again and again--and our. solicitous~ and plain-spoken words have often been an indicatioh of Our future intentions--that when daily practices-of religious piety were to be discussed, We would invite the faithful to an ardent honoring of that reality which in a remark-able way manifests the mercy of God for the souls of men, for holy Church, and for the entire ~orld~. We would in- ' vite them, in other words, to a special veneration of the Precious Blood of Christ Jesus, our Redeemer and our Savior. ~' We Ourselves became accustomed to this devotion in the home in which We were raised. Even today it is with happiness that We recall that every day during the month of July Our parents used to recite at home the litanies of the Precious Blood. Following the apostolic exhortation, "Take heed"to yourselves and to the entire flock whereof the Holy Spirit has made you bishops for the ruling of the Church of God which he acquired by his own blood" (Acts 20:28), We have decided, venerable Brethren, that the principal and pressing duties of Our pastoral office demand that We first of all take care of sound doctrine and secondly that We provide for the right exercise and conduct of religious piety, both" in its public and its° private manifestations. For this reason it hag.seemed to Us opportune to exhort Our sons to consider the indissoluble bond which should link the two widely diffused devotions to the Holy Name of Jesus and to the Sacred Heart of Christ with the're-. ligious homage to be offered to the Precious Blood of the Incarnate Word which was poured forth "for man~ for a remission of sins" (see Mt 26:28). ÷ ÷ ÷ D~votion to Precious Blood VOLUME 20, 1961 4, 4, ]olm XXIH REVIEW FOR RELIGIOUS 4 Just as it is of the utmost importance that the liturgical action of the Church should be in full accord with the profession of the faith;since "the law of belief determines the law of prayer";1 and just as no forms of piety should be introduced which do not flow from the purest fonts of the truths of faith; so it is also right that the various types of devotions should agree among themselves. It is actually necessary that those forms of piety which are re-garded as the most important and which are more apt for the attainment of holiness should in no way disagree with or oppose each other. It is likewise necessary that the forms of piety which from the viewpoint of value and of use are of limited and minor importance should yield ground to those forms which contribute more to the ob-taining of the salvation that was accomplished by Him who is "the mediator between God and men, the man Christ Jesus, who gave himself as a redemption for all" (1 Tim 2:5-6). If the faithful derive the driving forces of their personalities and the discipline of their lives from a correct faith and a sane piety, then they can be assured that they are thinking with the Church and that through their union of prayer and their charity they are clinging to that Christ Jesus who is the Founder and High Priest of the lofty religion which derives its name, dignity, and power from Him. Even if only a hasty glance be directed to the admirable new emphases that the Church has attained in the field and area of liturgical piety--and such emphases are in full accord with that salutary progress of the faith wards a fuller understanding of divine truth-~it becomes consolingly clear that in the last few centuries this Aposto-lic See has often and openly approved and recommended the three religious devotions We have already mentioned. Although these devotions had been introduced into the practice of Christian living by a number of the faithful during the Middle Ages and although they were after-wards propagated in various dioceses and in various re-ligious orders and congregations, yet it was necessary that the authority of the Chair of Peter should intervene in order that these practices might be declared to be in ac-cord with Catholic faith and that they might be extended to the universal Church. It will be sufficient to recall here that from the. sixteenth century Our predecessors had bestowed spiritual benefits on the devotion to the Holy Name of Jesus which in the previous century St. Bernadine of Siena had untiringly propagated ~hroughout Italy. In honor of this Holy Name an Office and a Mass were first approved, then a litany.~ x See the encyclical Mediator Dei, Acta Apostolicae Sedis, 39 (1947), 54. t See .4cta Sanctae Sedis, 18 (1886), 509. fewer were the benefits with which the P~oman Pon- :iffs promdted the devotion to the Sacrffd 'Heart of Jesus, devotion that was so greatly helped to its achievement its full and complete form and its universal propaga-aon by those matters whlcti~were~,made clear'to St. Mar-garet Mary Alacoque by Christ when He appeared to her showing her His Heart. With admirable unanimity the Roman Pontiffs have honored this religious practice not only by pointing out its power and its nature but also by declaring its legitimacy and by promoting its use through-out the entire world~a All this has been done in many public documents of the Church, the three most impor-tant of which are three encyclicals devoted' t6 this topic.4 As was only right, the consent and the approval of this Apostolic See were not lacking for the devotion to the Precious Blood of Christ, the remarkable promoter of which in the last century was St. Gaspar del Bufalo, priest of the Roman clergy. In this connection it will be remem-bered that at the command of Benedict XIV a Mass and an Office were composed in honor of the adorable Blood of the Divine Redeemer; Moveover, Plus IX, in order to fulfil a vow made to God at Gaeta, ordered this liturgical ¯ feast to be extended to the universal Church.5'Finally the Supreme Pontiff of happy memory, Pius XI, raised this feast to a double of the first class in order to per-petuate the memory of the jubilee which took place on the occasion of the nineteen hundredth anniversary of the' redemption of the human race. He did this because he was convinced that the increased solemnity of the feast would foster a deeper devotion to the~: Blood of the Re-deemer and that thereby more abundant effects of the same divine Blood would result for mankind. We were but~ following the example of Our predeces-sors when, in order that devotion to the Precious Blood of Christ, the immaculate Lamb, might grow an, d flourish, We approved its litanies as properly set forth by' the sacred .congregation8 and recommended to the entire Christian family the private and public recitation of the same by attaching to them special indulgences.7 Our de- 8 See the Of?ice o! the Feast of the Sacred Heart, Second Nocturn, Fifth Lesson. *The encyclical Annum sacrum in dcta Leonis, 19 (1899), 71 ft.; the encyclical Miserentissimus Redemptor in Acta Apostolicae Sedis, 20 (1928), 165 ft.; and the encyclical Haurietis aquas in Acta Aposto-licae Sedis, 48 (1956), 309 ft. ~See the decree Redempti sumus of August 10, 1849, in the Ar-chives of the Sacred Congregation of Rites, decrees for the years 1848--49, folio 209. e See Acta Apostolicae Sedis, 52 (1960), 412-13. ¢ Decree of the Sacred Apostolic Penitentiary of March 3, 1960, in Acta Apostolicae Sedis, 52 (1960), 420. 4. 4. 4- Devotion to the Precious Blood VOLUME 20, 1961 4. 4. John XXIII REVIEW FOR RELIGIOUS 6 cision in th~is matter, pertaining as it did to the solicitude for all the churches (see 1 (]or 11:28) which is proper to the .Supreme. Pontiff, was prompted by the hope that in these days of great and pressing spiritual needs the faith-ful might continue to increase their respect for those three forms of Christian piety which We previously praised and that they come to see them as possessing a perpetually salutary power of effectively promoting the spiritual life. Since the feast and month are now approaching which are dedicated to the Blood of Christ, the price of our re-demption and the pledge of a salvation and of a life that will never fail, the faithful should meditate on this Blood with renewed fervor and should partake of it by more frequent reception of the sacrament of the Eucharist. Il-luminated by the light which comes from the profitable admonitions of Sacred Scripture and from the precepts of the holy fathers and doctors of the Church, they should recall how abundant and limitless is the power of this truly Precious Blood, "one drop of which is able to wash the entire world from every sin," as holy Church sings t.hrough the lips of the Angelic Doctors and as was wisely confirmed by Our predecessor, Clement VI.0 The power then of the Blood of Christ, God and man, is infinite; infinite too is the love which moved our Re-deemer to pour it forth for us. This shedding of His Blood began .eight days after His birth when He was cir-cumcised. Later it was shed more copiously when being in agony in Gethsemani, He prayed the longer (see Lk 22:43), when He was scourged and crowned with thorns, when He climbed the hill of Calvary and was there affixed to the cross, and when at the end His side was opened by a great wound which was to be the sign of the divine Blood that flows out into the sacraments of the Church. All these events show that it is not only fitting but even highly necessary that all the hithful, reborn as they have been in the streams of this Blood, should adore it in a spirit of religious homage and should honor it with their love. It is most salutary and entirely fitting that the worship of adoration which is due to the chalice of the Blood of the new ~fid eternal testamefit, especially when it is ele-vated in the Eucharistic sacrifice for the worshipful gaze of the faithful, should be followed by the reception of that Blood. This is possible, because in the sacrament of the Eucharist the Blood of Christ is received since it~is joined by an indissoluble bond to His Body. Joined in mind with the priest, the faithful who attend" Mass can In the hymn ddoro te devote. See the bull Unigenitus Dei Filius of January 25, 1343, as cited in Denzinger-Rahner, n. 550. most properly repeat to themselves the words which the priest says at the time of his sacred Communion: "I will take the chalice of salvation and I will call upon the name of the Lord . The Blood of our Lord Jesus Christ guard my soul unto life e~ei:nal, Ameh." There can be no doubt that in this way the faithful, whenever they wor-thily approach the sacred synaxis, will receive a more abundant, share of those fruits of the redemption, of the resurrection, and of eternal life which the Blood offered by Christ "throu.gh the Holy Spirit" (Heb~9:14)~acquired fbr all the family of mankind:Nourished by the Body and Blood of Jesus Christ and sharing in that divine power of His which has raised up in the Church numberless ranks of martyrs, the faithful will find it easier to bear ~the labors and troubles of everyday life; and should it be necessary for the sake of Christian virtue~and the kingdom of God, they will even sacrifice their lives, for they will be burning with that ardent love which caused St. John Chrysostom to exclaim in his writings: "Let us come back from the table as lions, breathing fire, terrible to the devil, realizing who our Head i~ and how great a love He has shown for us . This Blood ~hen it is worthily re-ceived, drives out the devils and _calls to our side the angels and even the Lord of the angels.~. This Blood when it was poured forth Washed the entire world . It is the price of the world; it is that b~ which Christ bought His Church . These thoughts will moderate our passions. How long will we cling to present things? How long will we refuse to be aroused? How~lo.ng will we take no care of our salvation? Let us reflec( what honors God has be-stowed on us;.a.n.d then letus give thanks and give back glory not only by our faith but also by our deeds.''x° It is to be hoped that those ~ho are honored by the name of Christian will frequently consider the fatherly exhortation of the first Supreme Pontiff when he wrote: "Spend the time of your sojourn here in reverence, in the realization that you were redeemed not by gold or silver., but by the precious blood of Christ, as of a lamb without blemish and without spot" (I Pet 1:17-19). May they also.listen closely to the Apostle of the Gentiles when he says: "You have been purchased at a great price. Glo-rify God then and carry Him in your body" (1 Cor 6:20). If all the faithful take these texts to heart, then their way of life by which they should be an example to others will become more noble and more fitting. Thus it will come about that the Church, strengthened by such virtue, will carry out its earthly task to the profit of the human race. Men, peoples, and nations will be joined by a close bond of brotherly love, if they will yield themselves to the move- See Homily 46 on the Gospel o] John in Migne, Patrologia Graeca, 59, 260-61. + + + Devotion to the Precious Blood VOLUME 20, 1961 ments of the grace of that God who wishes all men to be ¯ saved (see 1 Tim 2:4), who has willed the redemption of them all in the Blood of His only begotten Son, and who hag called all of them to become members of the one Mystical Body whose Head is Christ. Civil society itself will thereby enjoy a serene peace; and human nature, which was created to the image and likeness of its Maker (see Gen 1:26), will become yet more worthy of God. It was to a consideration of this lofty dignity to which mankind has been divinely called that St. Paul exhorted those converted Jews who were too much attached to the institutions of the Old Testament even though the latter was but a dim figure and image of the New Testament: "You have come to Mount Sion, to the city of the living God, the heavenly Jerusalem, to the companionship of many thousands of the angels, tb the comunity of the first-born who are now citizens of heaven, to God, the judge of all things, to the spirits of the just who have been made perfect, to Jesus the mediator of the new covenant, and to a sprinkling of blood that is far more eloquent than that of Abel" (Heb 12:22-24). We are certain, venerable Brethren, that Our fatherly exhortation, when communicated in the way you judge best to you.r people and your clergy, will be put into salu-tary and effective execution in a spirit of willing coopera-tion. Accordingly as a sign of heavenly gifts and as a pledge of Our special benevolence, We impart in full charity Our apostolic blessing to each and every one of you as well as to your flocks, especially to those who carry out Our desires with devoted alacrity. Given at Rome in St. Peter's, the thirtieth day of June, on the vigil of the Feast~ of the Precious Blood of our Lord Jesus Christ, in the year 1960, the second of Our pontificate. John XXIII REVIEW FOR RELIGIOUS CHARLES A. SC.HLECK, C.S.C. The Sister in the Church When something good, nobie, and sublime is called into question or becomes obscure, it usually calls into existence an immense amount of thought,~reflection, and literature. Indeed, if we are to meet the demands of the situation fully and adequately, the whole matter of the entire reality must once more be subjected to a prolonged and meditative scrutiny. There is usually not so much a question of justifying its existence as there is of getting back to its roots, of elucidating and bringing into the light and clarity of the common vision the fundalnental and essential meaning of the institution in question. And this is especially true when this institution has been estab-lished by God or by His Church. What we feel in such a case is the need to see straight, or rather to see into the core and the heart of the reality itself. In the past such was true of several of the mysteries of divine revelation, the Incaination, fok example, the Trinity, grace, the divine motherhood. This calling of an institution into question together with" the consequent obscurity that almost destroys our appreciation of it has been common in our own day in the case of the Church herself, Mariology, the role of the laity in the Church, and Christian virginity or the religious sister in the Church. Consequently we witness today an outpouring of much labor, thought, and writing which, with more or less suc-cess, attempts in one way or another to penetrate into the divine reasons for the existence of such mysteries and their essential and basic meaning. And while each of these re-alities would certainly be a most interesting topic for our consideration, the one that is being singled out in the present .article is the institution of Christian virginity, or more precisely and exactly, the role of the religious sister in the Church. At the very outset we ought to note that one aspect of this vocation has rarely been called, into question or fallen into obscurity at least as far as the apostolic re- Thee Reverend Charles A. Schleck, C.S.C. teaches theology at Holy Cross College (seminary), 4001 Hare-wood Road N.E., Wash-ington 17, D.C. VOLUME 20~ 1961 9 ~. ~. sa,~, c.~.c. REVIE~ FOR RELIGIOUS lO ligious sister is concerned. And that is the utility, the contribution which such a vocation makes to one or other of the needs of our visible society. There are very few who would call into question the utility of the teaching, or of the care for the sick and the abandoned, or of the other spiritual and corporal works of mercy which form part and parcel of the various apostolates and missions entrusted to apostolic communities of religious women in the Church. In fact, the thought and the writing that has come forth in defense of the sister's vocation has tended to make this its principal and chief weapon. But when we come to another aspect of this vocation, one that touches the very soul of it and centers around the fundamental meaning of this vocation, then we find very few even among Catholics who understand what is perhaps the primary and basic mission of the sister in the Church. The proof of this, it seems, lies ih the fact that the question Ut quid perditio haec still remains in the minds of so many inside and outside the Church"To what avail is this loss of womanhood, this institution of virginity?" From the fact that this question mark still rematns and is even looming larger in certain areas of our country in spite of all the writing and speaking that has been done on the subject, we can conclude, without any kind iSf violence or exaggeration being done to the actual situation, that people by and large do not consider the collaboration in action with other institutions of so-ciety as a sufficient explanation of the vocation of the re-ligious sister. And that is a sobering thought; for these people are, perhaps, more right in their conviction or as-sumption than any of us ~ould be willing to admit. No, it is not the i'prose" of the sister's vocation that needs° clarification in the eyes of the world and in the minds of men, and perhaps even in tier own mind. It is rather the "poetry," so to speak, or the poetic symbolism of the life and mission of the sister in the Church that must be mole constantly and widely diffused both inside and ~outside the Church. For without that difftision we can not hqpe 'to make men see and love the vocation, the mission, or the role wl~ich God intends her to play in the Mystical Body Of the Church. We musi then ask ourselves the question: What is this "poetry" or this basic notion which lies at the very root of the sister's mission in the Chtirch? Only when we an-swer that question satisfactorily will we be able to di-minish and soften and, in the case of many, eliminate the objections which they raise against it. Only then can we hope to show those outside the Church and to very many inside, that the mission and the presence of the sister, far from being a block or an obstacle to the continuation of life, is itself a source of vitality and one of the most ex- cellent ins~truments by which the highest and most sub-lime form of life, if not perhaps begun, is nevertheless nourished, increased, protected, and safe-guarded, and most often formed and fashioned. The religious sister is ~v~fi tb the Church not:so much as a model or an image according to which other women must pattern their lives; neither is she given to the Church as a kind of living representation of the grace of the Christian life as it would .have been given Ito all. except by reason of some fault or' guilt on their part. No, she is given to the Church as a kind of sacrament,' a v,s~ble s~gn, a symbol of one, even of several mws,lble reahtles. To understand this assertion thoroughly, w,e need to re-call briefly the mysteries of the Trinity and of creation. In the first mystery, that of the Trinity, ~we know that God the Father communicates His own nature to God the Son, and these two persons~ commumcate this same nature to the Holy Spirit. Yet while all thre~ of these per-sons possess the one same divine nature, skill from our very limited vision this nature appears to take on differ-ent~ aspects when we consider one or other oflthese persons according to His distinctive properties or characteristics. We obtain a much clearer picture of the richness of each of the persons by linking up certain qualities or perfec-tions with which we are familiar, with one o~: other of the . divine persons. Thus itis by reason of the various kinds of processions which we find in this myster~ that we at- .~ tribute understanding to the Word of God Who proceeds by way of an operation of the divine intell~,ect; similarly we attribute love and affection to the Holy Spirit because He proceeds by way of an operation of theI divine will. In the second mystery, that of creation, God seems to have wished that His various perfections I~e manifested and shared in by many different creatures, each acc.ording to a very definite limitation, such that some would repre-sent Him more perfectly and more fully, than others. For only in this way could the fullness of His b~ing be made somewhat clear. When we focus our gaze on material creation, we see that only one creature came into being, made, as we are told, according to the lmage~ and likeness of God. Only one received a perfection or perfections which would enable it to know and to love ~;od, to share and participate in the most intimate opI e.rations of the Godhead. That creature was man. Or let ks say, it was human nature, possessed by two different~individuals who I reflect the riches of this nature in such d~ffe~ent ways that the fullness of the mystery of the human composite might stand'out the more clearly and might m,rror more per-fectly the riches of the Godhead. For we must not forget that man and woman also belong to those th.ings of which it was said by the Apostle: "From the foundations of the 4. ÷ ÷ The Sister in the Church VOLUME 20, 1961 II C. A. $chl~cl~, REVIEW FOR RELIGIOUS world, men have caught sight of His invisibl~ nature, his eternal power and his divinity as they are known through the things he has made" (Rom 1:20). In something of the way in which the divine nature was shared in by two person~ other than the Father, proceed-ing from Him and yet personally manifesting and empha-sizing different aspects (at least according to our imperfect vision), so too in the mystery of the human composite we see one nature shared in by two individuals who mani-fest in their whole make-up the distinct perfections of the rational creature. And just as the Word of God is the one to whom we attribute the intellectual operations of God while the Holy Spirit is the one to whom we apply the affective operations of God, so too (I do not mean to say that the parallel is entirely exact) man is the one in whom we see manifested more visibly the operations of the mind and the duties of the intellective side of our being, while woman is the one in whom we see manifested more visibly the operations of the will and the duties of the affective side of our being. Since all created beings are sent into the world as signs or "sacraments" in the broad sense of this word, and since man is an image of the Trinity, we might say that man and woman are visible signs and symbols of the intellec, tire and affective operations and perfections of God. Man is a sign or a "sacrament" more especially of God as truth, and woman is a sign or "sacrament" more especially of God as love. In a sense, then, we might say that man reflects more the Second Person of the Blessed Trinity, the Word, while woman is more the reflection of the Third Person of the Trinity, the Holy Spirit. Now while it is true that the original plan of God was interfered with and that it was set right again only when the two persons proceeding from the Father were sent in mission to men, still it is precisely here--in relation to the fall and the two missions necessitated by it--that the "poetry" or the "sacramental" role and meaning of the religious sister begins to appear in all its dignity and sublimity. For when we consider the mystery of these two divine missions, we see that the Son of God was sent in mission to instruct men and to teach them the way of salvation. His function was to preach by word of mouth those mysteries and that knowledge of God which had been hidden from the foundation of the world. The Holy Spirit, on the other hand, was sent in visible mission only very briefly and for a different purpose. For He was sent both as a sign and as a kind of mother-principle. He was sent as a sign of sanctification, a sign of what the interior renovation which takes place within the soul in the state of grace actually is. In fact, the very creatures under which He appeared manifested this role: the dove and the fire. The one, the dove, manifested the innocence of sanctity, its caution, its fruitfulness, and its silence; while the other, the fire, manifested love and the knowledge proper to love, the wisdom of the heart. Moreover, the Holy. Spirit was sent as a kind of.mothe~:prlnclple, a pi~i~i~i~ '~f re-birth, to mold the human race into a new creature. This was the work He was to continue in a silent and hidden manner by acting as the soul, the vitalizing force and power of the Church, giving birth and life to the family of God. While it is true, then, that in the mystery of the Trinity the Holy Spirit is in a sense passive, since He is the term of a divine procession but not a principle of any further divine procession, still He does not remain passive. Rather He becomes active, most active, together with the Father and the Son in the work of sanctification or of what we might call the Trinification of the members of the family of ~God. This role of the Holy Spirit has certain affinities with the role of woman. Although, of the two individuals pos-sessing human nature, she embodies the characteristics of receptivity, acceptance, and submission, this does not mean that she is inactive or merely passive. The case is far otherwise. She receives or accepts, but only to give flesh and-blood, so to speak, to what she receives, to clothe it with the more sublime qualities of human nature. By reason of her entire being--her body, her soul, her powers of understanding, her capacity for affection, her aptitudes, and her inexhaustible devotion--she is made to mother the human race, to know it in all of its depths and.heights, its crudities as well as in its sublime potentialities. Thus, she has been endowed by God with a maternal instinct to form someone for family life, whether it be for the human family or for the family of God. In fact, this func-tion is one that she is not free to side-step; she is not free to isolate herself or to make her life self-cente~ed. For she exists for humanity; she is at its very foundations, not so much to direct and govern it, but rather to give it birth and to direct its initial steps in the pursuit of the human race's common goal. Woman exists, moreover, as an inspiration for all to seek the things that are above; likewise she is a sign of what this higher life actually is. She was given to man as a~companion, a helpmate to enable him to attain the sub-lime end for which he had been destined. And when she realizes the potentiality that lies within herself, she acts as a focal point or as an exemplar for the human race. Hence in the present economy of our existence, the divine idea of a complete human nature as something that trans-cends all difference of sex is better translated by woman than by man,, not only because her beauty excels that of ÷ ÷ ÷ The S~ ~ the ~hurch VOLUME 20, 1961 ~. A. $cltleck, ~.~. . REVIEW FOR RELIGIOUS 14 man, but also and especially because she presents an idea that is remarkable for the contraries which it unites-- somewhat as the activity of the Holy Spirit is presented to us in the Sequence for Pel~tecost, something like the ac-tivity of grace itself. For feminine nature presents us with an idea that is simple, yet very profound. She appears as one in whom we find a mingling of grace and gravity, of a smiling yet deep seriousness, of enjoyment and sacrifice, of song and silence, of purity and fecundity. It is in Mary' that we find the most perfect realization of this womanly' perfection. How the rest of womankind has realized this ideal and performed her role can be very readily seen by scanning the pages of history,, both sacred and profane; She has often led man away from God--she has often performed the role of the first Eve; and yet she has often led man back to his God---she has performed the role of the second Eve. Her influence ~has accompanied man. to near perfection, and it has also plunged him into an abyss of hate and despair. In fact, we can say that the destiny of man in his relationship with God depends to a great extent upon the silent directive force and power of wo-man, befit good or evil. Whether it be for good or evil de-pends very much upon her veil of mystery, her unassum-ing surrender to goodness and her willingness to share her time and her qualities with man in a spiritual or in a physical sense. Without her cooperative participation, the totality of human existence would become distorted and sterile. For her role in human existence will always be that of a bride, of a woman moving within the realm of man, not rejecting her veil which is a sign of her ac-ceptance, of her l~at mihi, not struggling to attain that which is properly man's, but surrendering her whole be-ing in an effort to make her contribution to the end result which is the unity of the human race with God. Like the Holy Spirit with whom she has a certain af-finity, woman is not only passive or receptive. She is com-municative, in fact, essentially communicative; and .like the person of love whom she represents, she tends to be-come dit~usive, 'to create or to prepare [or the members of the human family the best that this family contains in the depths of its own being--life, freshness, the poetry of love, fidelity, service, and care. It is only when woman actually lives or incarnates in her own life these characteristic marks of the Holy Spirit that she arrives at the fulfillment of her mission in crea-tion. And it is only in and through her arrival there that she attains that vision proper to wisdom, one that reaches from end to end seeing all things and judging all things according t° their proper place in the divine plan. It is only in the measure that she fulfills her role that she will be enabled to see the needs of souls, the needs of the Mys- tical Christ, and the destinies of the humffnfamily. For in proportion as her affective nature becomes more and more purified, she Will become more and more like to the person of the' Holy SpiriLwho, is personal love in the mystery of the Trlmty; and she-will be g,ven~that gift which is part and parcel of her vocation--wigdom and the divine vision which this implies. For as h~r'affections become purified, she learns~o .center herself and her life in God who will constantly infuse intd her a deeper love which is perfected by one 'of~His most precigm Sifts w~sdom. Thus we can say that'only in proportion as there grows in the woman the untarnished innocen~e~0f Mary the girl, will there also' grow in her the. deep compas-sionate gentleness and wisdom and.vision of Mary the mother, enabling her like Mary to cover the world with a silent and still co-redemption. Consequently, we can say that ~oman's vocation and mission is to imitate and continue partially at least and in a visible way the mission of the Holy Ghost--to mother the human race inits relatidnship with God by showing men that God isoa God of lov~ and that it is man's duty to find God not go much by r~ducing Him to our level of thought and limitatiofis, 'but rather/by going out of ourselves and in the" darkness Of a deep faith ~and trust, loving beyond what we see. M6reover, she was meant to be a perpetual sign to man of what the soul in the state of grace is--the bride of the L6rd. If this is the fundamental role of woman by her very nature, we should exPect that any furthervocation which she might be called upon"by God td exercise in the divine plan would not depart from this. Rather we would expect it to call her to a more perfect fulfillment of this funda-mental and basic role or vocation; for grace, as we hav~ so often heard, builds upon nature. It should come-as no surprise, then, that w~ should conceive of the religious vocation which lies at the very basis of the sister's way of life as a dall or an invitation from God much more than as an arbitrary decision on the 15art of a woman to enter the religious life. It is;' we might say, a special glance 'or grace which God Himself directs towards certain souls whereby He lifts thein from the realm of His common love and elevates them t6 that of His special love. We can say that if a woman goes out of the world in attempting to realize a religious vocatibn, she does not do so arbi-trarily; she does so onl~ in :response to an invitation by which God addresses her by'her first name, going beyond the common love which He shows otherg'and embracing her with His ~pecial love. A sister gods out of the world (and ~this is implied in the religious life) only became she has been given an-other task by almighty God/For she is given- to the Church The~ Sister in the Church VOLUME 20; 1961 REVIEW FOR RELIGIOUS 16 and to mankind, not so much as a type or figure as we mentioned above, but rather as a sign in much the same way as the Holy Spirit was given to the world in His visible manifestation as a sign. And because she is given to the Church as a sign, her whole life must be, as it were, a kind of graphic picture or parable. For in her there was meant ~o become lifelike and instantly visible what in all others is usually kept secret and hidden. In her what is innermost in the Church of God is turned outward; and the City of God, which lies so concealed in others, becomes the town which is set upon the mountain--visi-ble for all to see. I am speaking, of course, of the life of man with God. It is this role which the sister constantly plays in the Church; we see it in the habi~ she wears, in the houses she lives in, the bearing which marks her per-son, and in the very disposition of her life. Her mission and vocation in the Church was meant to publish this truth: that this woman belongs entirely to God, that she lives only for Him and only with Him. This is, it seems, what the vocation of the religious sister was meant by God to signify; and the external marks which set it off from all other vocations (something like the plate of pure gold worn by the high priest of the Old Tes~tament) indi-cate immediately that the one belonging to this yay of life is set apart for the Lord. God knew that by reason of the fall the observance of the first and greatest commandment--to love God with one's whole heart and soul--would be most difficult to keep. For the mind of man, wounded by original sin, would tend to look downward; his heart would tend to become immersed in the things of time even though he be ordered to an eternal destiny. The sublime idea of union with God would be recalled and brought to birth in him only through what he saw or only through what he would in some way sense. God knew that if know.ledge would be had only through the instrumentality of the senses, through contact with visible things such as the spoken or the written word, then love would be recalled to man and begotten in him only t~hrough what he would in some way sense, only through some visible instrument; and in this case the love that would be recalled and be-gotten in him would be a share and participation in God's own love itself. It was for this reason that God instituted Christian virginity, and the Church ~gave this institution a very definite form in the religious life; *for the sister was to be a sign or a "sacrament," that is, a visible sign of an in-visible reality. It was one of the best possible ways of realizing and of answering the cry of the psalmist, "We no longer see the signs," which you have placed before us, Lord. While a sister is a sign of many things---of the fact that God exists, of the fact that He can touch a soul in a most intimate way, of the fact that He can ask a soul, or rather demand of 'it as it were~ 'to live for Hi~n ~lone-- still the sister is above all according to the divine~plan a sign of a yet greater mystery, 'For her mlssxon was set up by God to signify that He is love, that He is one who loves and can be loved. She was meant to indicate perpetually, not so much in her own individual person as in the insti-tution which she incarnates, that man is called to experi-ence God's personal love, that a human soul is called to be the bride of the Lord. This explanation is not just ~ sentimental, metaphor; it is something, which fias been constantly re-echoed in the literature of the Church--in the figure of the Church herself as the ,immaculate spouse of Christ, in the person of the bride of the Canticle of Canticles, in the figure of the chosen people as the Jerusalem or Sion of the Old Testament, in the.figure of Mary, and in the figure of the New Jerusalem who is said by St. John in the Apocalypse to be sent down from heaven by God all clothed like a bride who has adorned herself in readiness to meet her husband (Apoc 21:2). It is in fact rather clearly indicated there that the new Jerusalem is a figure of the Church and of the individual members of this Church, each of whom is called to be the bride of the bridegroom who is the Lamb (Apoc 21:9). There is, we might say, a common desire in the Church to see this heavenly Jerusalem or to catch some glimpse here on earth of the soul that is ready to enter into glory or who already participates in vision. In the sister that desire was to be fulfilled. For while it is true that the re-ligious profession taken together with the reception of both man and woman is essentially the same, a represen-tation of an eschatological state, nevertheless it is only in the case of tlie sister, because she is a woman, that one of the principal effects--the closest possible union with God---is brought out most strikingly and unmistakably. The man's consecration to God is considered to be a kind of second baptism, a ceremony in which his death to the world and his resurrection unto God is signified. But in the case of the woman, the ceremonies taken in their en-tirety form a kind of marriage rit~, a marriage in which she unites herself to the God-man as His bride. Conse-quently only the sister is able to signify in her very being and. person the marriage of the Christian with God, be-cause only she cfin be by nature a bride. The veil and, in some cases, the ring that she receives at the time of her profession were meant to be a perpetual reminder both to herself and the world that there is another world of r.eality that lies far beyond the surface vision which takes up the thoughts and the attention of the majority of men. 4- + The Sister in the Church VOLUME 20, 1961 17 ÷ ÷ ~,. A. $chleck, REVIEW FOR RELIGIOUS 18 The excellence of this marriage over that of the sacra-ment lies in the immediacy of the union with Christ the God-man as well as in the permanence of the bond that is established at that time. For we kno~ that in the re-ligious profession a woman unites herself' immediately to Christ, whereas in Christian marriage, She unites herself only. mediately to Him, through the intermediary of a human creature who represents Christ for her. The bond of the religious profession, moreover, is not dissolved at death; rather it is 'one that realizes its full meaning and significance not here on earth but only'in eternity since it is the reward of virgins alone tO follow, the Lamb whithersoever He goes in the everlasting hills. It is in this way that a sister is a visible and constant symbol to the world of the sublime privilege and destiny which rests upon all human souls--to be a bride in search of the bridegroom. Sublime though this role of the sister is, there is yet another one which is not merely attached to this destiny of being a bride of Christ, but is its natural outcome. We know that in and through human marriage the bride as-sumes the interests 'and the concerns of the ~bridegroom. Consequently, in the marriage signified by the'religious reception and profession of the sister, she assumes the in-terests and concerns of eternal love, of God who is infinite love. Thus her love is not only not annihilated by her profession, but it is given new life and becomes much more dynamic and extensive than that which is had be-tween two persons united to each other through Christian marriage. It is meant to assume the status arid proportions' of the love of the God-man Himself. If the bride reflects the interests and the concerns of the bridegroom, she does so in a very definite way in accordance with her own na-ture. Since this nature is feminine, she rel~resents God as love and she reflects the concern of God for souls in a ma-ternal way. in fact, we can say that the maternal office or role for which she is created is not only not annihilated in her profession but is brought to its highest and most perfect fulfillment because she exercises it over a greater number of souls and with respec~t to the highest life that can be given to a creature, a share in the life of God Him-self. This is as it should be. For a natural desire, one that is implanted in a creature by God Himself, must be capa-ble of being ftilfilled and must be fulfilled in some way or other if that creature is to realize its highest possible perfection. In calling the sister ~o her vocation, the highest voca-tion to which a woman could aspire in the Church, God will not--I think that "we can say can not---destroy this aspiration which lies deep in the very make-up of every woman. Rather He will bring it--He must bring it--pro- vided there is no'obstacle on her part--to its fullest and most perfect realization. To be pure and untouched~oand wholly consecrated to God and yet to have the heart and soul of.a mother is the unique wonder of Mary; and,it is also at the very heart and m);s'te~ 0f the sister's ,~6cation. It is a grace which is given to her initially in the grace of vocation itself, in much the same way as the fruit of the tree is given already in the very seed of the tree. And that grace will die or grow in the sister in the same measure or proportion as the grace of vocation dies or grows in her heart. It is of this also that a sister is a continuing sign or symbol to the world---that only a virgin motherhood is' compatible with~ a~_divine motherhood, that is, one that has as the whole purpose of its existence to lift up the souls of its children to :God, Just as Mary became filled with,grace and,superabundant 'in it, so to9 the sister is called to something similar--to be filled ~with grace but in such a way that she not only receives it but commtini-cates ,and diffuses it' to others as .a mother communicates and diffuses life to her children. Consequently, the.phrase which the Church in her liturgy.applies to Mary can also be applied in a certain sense to her: "And ~having the honor of virginity, you have also the joyof'motherhood," I think that it is true to say ,that only this understand-ing and presentation of the sister's, role in .the Church will make it more meaningful for her and restore it to its rightful place of: excellence~among the ways of life that lie"open to the faithful. For unless there is ~a deep faith and conviction in her marriage with Christ and in her spiritual motherhood, ~ the deeper motivating forces of, her vocation c~)uld easily remain somewhat obscured"and the consequent fruit of her apostolate diminished. And unless the missiofi' of the sister is presented to all the faithful during the years of their academic training and instruction,.espeCially in high schools and colleges, not by means of a ~¢il~d of "fly,by~nigh~" program but by one that openly juxtaposes it to marriage and presents it in all of its fullness, with its beauty, excellence, and joys, to-gether with its peculiar trials and difficulties, the question Ut quid perditio haec? spoken of above.will remain in the minds of a great many of the faithful and continue to ;. serve' as a parent,al objection to the very vocation itself: For all the attractiveness and beauty which this picture of the sister's mission in the Church might present, there° is one warning that might be voiced before c6ncluding, a-warning which becomes ever more necessary as the prog-ress of our technical civilization moves on with the.speed of an object drawn by the pull of gravity.And that is that 'the sister as well as the institution which she incar-nates must not fail to hold up the mystery of the cross-- in schools, in vocation literature, and above all in ,the The Sister in the C~hurch VOEUME 2~ 1961 19 4. + C. A. Schleck, REVIEW FOR RELIGIOUS 20 actual living of the religious life itself. The presence of this sign of contradiction, its mystery, its sorrow and its joy, must always be the very basis of her way of life. For the essence of the religious life is "to go out from the world." Consequently, the religious sister is to bear in mind that here on earth she is called upon to fulfill the obligations of a bride and .a mother. The privileges and the rewards that shall be hers--that of "following the Lamb whithersoever He goes" and that of ~eeing "her sons coming from afar off and her daughters rising up at her side" (see Apoc 14:4; Is 60:3 ff.)--are reserved for eternity: These will be hers only if she has understood and accepted at the very outset of her religious life and has observed ever more faithfully during it the injunction of St. Ambrose: "The root and the flower of virginity is a crucified life.". It is this life, together with all that it implies in the case of the woman--silence and stillness and hiddenness especially--that is necessary not only for this vision to remain throughout her life but also for it to grow and to reach to new extensions and heights so that all the various lights and shadows of its beauty might appear in all their fullness, richness, and splendor. Such a vision of the "Word breathing forth love" as St. Thomas says (Summa tkeologiae, .1, 43, 5, ad 2), can be purchased only where there is lived and practiced prayer and disci-pline. These requirements have today made the vocation of the religious sister especially difficult. For the growing demands of her apostolate in the world along with the almost imperceptible infiltrations of elements foreign to her. vocation which such an apostolate often implies, could easily diminish and even destroy the possibility of retaining and developing this vision. If she remains faith-ful, however, to a constant and personal practice of these requirements, she will enable herself to fulfill her two-fold role, that of being a virgin in search of Christ and that of being a mother in whose conceptions no sin is passed on to the offspring, but only grace, only a share in the life of God Himself. Like freshly fallen snow on a mountain she will lift her gaze.only to God; and yet under the heat of the sun (which stands for the activity of'the Holy Spirit) she will melt and give life-giving water to those who dwell in the fields and valleys below. And he who drinks of this water shall never thirst, but it will become to him "a fountain of living water springing up unto life everlasting" (Jn 4:14). In conclusion we might sum up very briefly what we have attempted to give in these few pages. A religious sister leaves the world to become a sign or symbol, repre-senting God to men and men before God. For God loves humanity in her person, and in her person humanity gives its loving answer back to God. This, I think, is the mission given to the sister both by God and by the Church. When she returns to the world in the exercise of her apostolate, regardless of what this might be, she does so primarily as a sxgn, a symbol of the pasclial mysterxes, of tiuman na-ture's death to sin and resurrection unto God. In her case, this resurrection will be not so much unto light and knowledge as unto love. We know, that no apostolate, no vocation has any real meaning except in some relation to communication of life through light or through love. In the case of the religious sister it is in ke~eping with her very nature that the communication be more often predominantly through love; and even when it is through light, through the instruction of youth, it will be a spread-ing of vision in and through the warmth of love. Therein lies the "poetry" or the sacramental meaning and the divine design for the sister's mission, a mission whose fullness and richness and meaning must be made known to the world today; for it presents the solution to the needs of our day a constantly deeper interiorisation of doctrine and life, a flowering of the contemplative spirit, and an intense outpouring of charity and love. It is true that the world of today needs a rational theology; yet before it can become capable of this theology, it needs the vision which lies behind it, the vision wfiich made the very Summa of Aquinas seem like so much straw--the vision of eternal light that loves and is love. This role, this mission, this need for the presence of the sister in the Church has been very well indicated by a passage from one of the works of St. John of the Cross: 0 Lamps of fire, in whose resplendent light the deepest caverns where the senses meet,- erst steeped in dark-ness dire, Blaze with new glories bright, and to the lov'd one give both light and heat. Living Flame of Love, Stanza 3 This is the work of the Spirit and it is also the mission of the sister in the Church. And so in the end we come back to the beginning. The sister's apostolate or primary mission is very much like that of the Holy S15irit with whom she has a very definite affinity--to diffuse within the souls of men the gift of created love which is the com-mon bond uniting us with God and with each other in the friendship of divine charity or in the community of love which is the Church. If the sister fulfills tfi~t mission, on the day of her entrance into eternity she will merit to hear the words which the Prophet addressed to the new Jerusalem many centuries ago: "Arise, O Jerusalem, and stand on high, and behold the joy that comes to thee from thy God" (Bar 4:36; 5:5). 4- 4- The Sister in,- the Church VOLUME 20,, 1961 JEAN GALOT, S.J. Thanksgiving After Holy Communion, + ÷ + The Reverend Jean Galot, S.J. is Professor of Dogmatic Theology at Coll~ge Saint-Albert, Eegenhoven - Louvain, Belgium. REVIEW FOR RELIGIOUS 22 In recent years it seems that some observers have no-ticed a decline in personal thanksgiving after Holy Com-munion. 1 The liturgical too;cement would seem to have led some of the faithful, including priests, to neglect any prayer which is not official, liturgical prayer, or prayer with a community flavor. On the other hand; the publi-cation b~y Father Karl Rahner of two articles on the theo-logical justification for thanksgivings gives us an oppor-tunity to reconsider this aspect of Holy Communion. We would like to do this not only from the standpoint Of prac-tice, but also doctrinally. Firstly, we shall ask what connection there is between thanksgiving and the Mass. In particular, is it correct to say that thanksgiving has only minor importance because Mass is it.self essentially a thanksgiving? Then we shall look at the reason usually given for making a thanksgiv-ing; namely, the continuation of the real presence of Christ in the communicant. But is this, in fact, the chief justification for the practice? Finally, there are some conclusions about the length of the thanksgiving and the manner of making it. Having a better understanding of Holy Communion and of its effects in us will lead us to see the attitude it requires of the communicant. By t~he end of this study it is hoped that the great im-portance of the matter in all religious formation will be ,apparent. This is the year of the Eucharistic Congress which has as its theme "Pro mundi vita" [For the life of the world], and it is also the fiftieth anniversary of St. Plus X's decree on the Communion of small children. It would be rewarding were the thoughts here outlined to contribute in any way to a fresh development Of Eucharis-, uc p~ety. . x This article originall~ appeared in Revue des Communautds Re. ligieuses, 32 (1960), 73-86. The translation is by Rev. D. Brigstocke, s.J. *"Danksagung nach der hl. Messe," Geist und Leben, 32 (1959), 180-89, 442-48. Thanksgiving Completes Our Participation in the Mass It is very t~ue that the whole Mass is a thanksgiving. The expression Eucharist~.makeS this clear. The word was applied by the primitive Church to the sacr~iment which Jesus instituted at the Last Supper; and the reason may be found in St. Luke and St, Paul: when He consecrated the bread, Christ "gave thanks" .(Lk 22:19; 1 Cot 11:24). It is the attitude which distinguished Christ at this capi-tal moment that has given its name~ to the sacrament. In memory of. Christ His '~disciples have likewise "given thanks" to God by repeating the gesture of consecration,3 ~How is this characteristic attitude to be interpreted? To give thanks is to thank God and to adopt the disposi-tions ofsomeone who has received everything from Him, and is glad to offer Him everything in return. At the moment of the Last Supper, Christ wished, to proclaim that He held everything from the: Father, hnd at,the same time He wanted to make a complete offering of Himself to the Father in a way .which would for ever perpetuate His oblation on Calvary. By this, thanksgiving, which is intended to be an act of total homage to the Father, the bread is blessed;~ it is consecrated because, being ,offered to God, henceforth it belongs to Him; it becomes the in-strument of divine blessings. The thanksgiving is an obla-tion, and the blessing of the bread is the sign of this obla-tion, its material symbol This is as much as to say that one must n6t have too restricted an idea of thanksgiving, confining it tO an outburst of gratitude alone. It signifies a return to God of what He has given to man. It is .a "Thank you" which is expressed by a profound offering of the self. If the Mass is to be called a thanksgiving, then it is within this very broad meaning of the word. Those who take part in the Mass have to acknowledge with. Christ that they h~ve received everything from the Father and that with Him they present to the Father all that has been bestowed upon them. They do this by uniting their offer-ing,' which should l~e as complete as possible, with that of the Savior, Does this mean to say that fervent.participation in,the Mass, with this attitude of thanksgiving, makes a thanks-giving after Holy Communion secondary or only slightly useful? We might notice that Father Rahner, while put-aFor the employment of the term Eucharist in the prim~itive Church an~d especially in St. Justin see P. Batiffol,'L'Eucharistie, la prdsence rdelle et la transsubstantiation, "l~tudes d'histoire et de th~o-logie positive," 2nd series; J.-A. ~Jungmann, Missarum Sollemnia, I, 45 ft. ~In St. Matthew (26:26) and St. Mark (14:,22) the equivalent of "having given thanks" is "havin~,g blessed." 4, Thankagiving Holy vo,.u~E ~o. ÷ ÷ ÷ ~ean Galot, REVIEW FOR RELIGIOUS ting in the first place the thanksgiving constituted by the Mass itself, maintains that thanksgiving after Holy Com-munion means much and is truly recommendable. And if one thinks of the personal participation by the priest or the faithful in the Mass, with all that this sharing de-mands, it cannot be said that thanksgiving has only sec-ondary importance. For its role is to complete partici-pation in the Mass, and to ensure the full fruit of this participation. In fact, participation in the sacrifice of the Mass reaches its culmination in Communion. This is the sacrificial meal. Certainly the sacrifice has its value on its own. Once the Consecration has taken place the essence of the sacri-fice has been accomplished, with its worth ex opere operato applied to the intentions for which the Mass is celebrated. But in the sacramental order the personal participation by the priest or faithful in the sacrifice of Christ remains essentially insufficient so long as it has not ended in Communion. This remains true, however fer-vent the will to unite oneself with the Offering and the Consecration.5 The object of Holy Communion is the full association in the Savior's sacrifice of those who are present at the sacramental renewal of this sacrifice. It unites them to Christ's offering in virtue of an efficacity ex opere operato different from that of the Consecration, and which completes the latter by acting in each com-municant individually. This sacramental efficacity may be explained in other terms by saying that here it is no longer the member of the faithful who tries simply to unite himself to the sacrifice of Jesus, albeit his efforts are sustained by grace; it is Jesus Himself coming to unite the Christian to His sacrifice. He comes to incorporate the individual with His sacrifice, and He does so by a divine power enabling the fa!thful to offer that which human weakness would have precluded. This sacramental incor-poration in the sacrifice may be translated in terms of thanksgiving: by Holy Communion Christ comes to in-corporate the faithful into His own supreme thanksgiving --a thanksgiving repeated at each Mass and which in-cludes the offering of His death. Christ associates the Christian with Himself, placing him in this situation of giving thanks. The sacramental efficacity of this incorporation, while it proceeds essentially from the divine strength of Christ, depends also upon the dispositions of the faithful. As with the rest of the sacraments, the effect ex opere operato of Holy Communion does not dispense the faithful from cooperating with grace. Christ gives Himself with His 5 Cf, the Council of Trent (DB 944) encouraging the faithful to sacramental communion at each Mass they attend. omnipotence, but the soul still has to open itself to Him and welcome Him. This attitude of welcome, this opening of the self and subjective fervor will have an influence upoh the fruits of Communibn. Here it is that we discern':the'i~nportance 6f'indi~,idual thanksgiving after Holy Communion. The Christian really has to "receive, Christ in such a way as to allow Christ to incorporate Him fully into His own sacri,fice. In order to be able to receive Christ in this way, one has to pay attention to Him, try to show Him the sentiments of welcome that He deserves, .and make ohe's own the thanksgiving that Christ brings with Him. This can only be achieved in those moments~ of recollection When a cer-tain intimate dialogue occurs. The time of thanksgiving after Holy Communion is the moment when all that has happened at the altar enters deeply into the soul of the Christian in order to transform it. At this moment the communicant yields himself to that immense giving of thanks which was the theme of the Savior's sacrifice. He commits himself personally to this thanksgiving by allowing Christ to penetrate to his. fur-thest depths, and by devoting all his powers as a man, his ability to reflect and to will, to the work of extending the Savior's reach within him. Thus, thanksgiving after Holy Communion is not a simple movement of personal piety which just happens to be added to a liturgical action in itself fully sufficient. It~is not a complement, with value only secondary. It is the reception and welcome of the liturgical and sacramental action, a welcome without which this liturgical action could not produce in the com-municant that which one has a right to expect. True--the thanksgiving is individual. It has to be, because it signi-fies a personal welcome given to the coming of Christ, and it has all the more worth in proportion as the depths of the personality are engaged. But this individual com-plement is claimed by Holy Communion and therefore by the liturgical action of the community which is the Mass. Besides, while remaining an act of the individual, the thanksgiving allows the member of the faithful to rise to a higher le~,el of community charity. It does this pre-cisely because in Holy Communion the Christian wel-comes to himself the love of Christ. . There is, therefore, no reason for neglecting thanks-giving after Holy Communion, or for holding that it is an act of private piety which we may omit at will. On the contrary, it is the ordinary completion of 'the Mass. Its importan.ce is not less for not being found among the prayers that the priest recites officially. By its very essence the thanksgiving has to be something intimate,~ a reaching-out and utterance of the soul; and as such it gua,rantees the full effect of the Mass in each of the faithful. + Thanksgiving A.~e~ Holy Commumon VOLUME 20, 1961 ~e~ ~, sJ. REVIEW FOR RELIGIOUS Thanksgiving and the Real Presence of Christ For some time after Communion the sacramental pres-ence o£ the bod~ o£ Christ remains in us.~ It is difficUlt to decide the exact duration o£ this presence, but it does not cease be£ore the dissolution o~ the species. Accord.oing to some medical opinion, a small host in a healthy stom-ach does not corrupt before haft an hour.7 On the other hand, it is even more 'important to notice that this bodily presence o~ Christ in the communicant is given essentially £or a spiritual action, and more speCially £or a spiritual presence o~ Christ in u~. For Christ comes to nourish us spiritually. Father Rahner has good reason £or insisting upon the spiritual pregen.ce o~ Christ that Holy Communion produces. Thinking o~ the Eucharist, St. Paul Spoke about "spirit-ual food" and "spiritual drink" (1 Cor 10:3-4). He un-derstood the efficacity o£ the Eucharist as being o£ the spiritual order because, to speak more precisely, this effi-cacity was due to the Holy Spirit: "in 6ne Spirit we have all been made to drink" (1 Cor 12:13). According to these views, it is not the Bgdy or the Blood of Christ, as such, in their simple material reality, which operates in the communicant, but the Holy Ghost whom they bear. St. Paul was ectioing Christ's teaching. In the l~romise o~ the sacrament a's St. John recounts it, the Master had under-lined the spiritual nature o~ the etticacity of the Eucharist: "Only the spirit gives li£e; the flesh :is of no avail" (Jn 6:63). By itseff the flesh would be powerless to exert any sanctifying activity; it is only through the Spir!t that it can act in this way. In order to better understand the connection which exists between the Eucharistic body and the Holy Ghost, we should recall that the Body present in the Eucharist is the glorifie.~d Body o[_.the Savior. It is His risen Body. It is true that th.is Body is giv~en to us in a ~sacrifice. But the sacrifice, While it renews the offering of Calvary, renews too the completion of this offering and' its acceptance by the Father: :that is to~ say, the glorification o~ Jesus. That is why the Mass omme'mbrates not only the Passion~ but . e Father Rahner has put £orward a new theory~ according to which 'the real presence would cease [xom the moment of communicating, because from that instant the species of bread can no longer be con-sidered as food, being .no longer eatable. According to him there would begat this moment the equivale.nt of corruption of sp.ecies'. In' principle, however, tradition considers that physical corruption of ~ ¯ the species must occur before the real presence ~ceases. One might!! also add that the species of bread do. continue to be a nourishment' I even ~fte'r actual manducation, and so they remain the sign 6f the I real presence. Therefore the presence of the Body of Christ certainly I persists after the ~ctual°moment of communicating. ~ C~. Cardinal Gasparri, Tract. canonicus de Sanctissima Eucha- I ristia, (1897), n. 1194~ also the Resurrection and Ascension. Without the Resur-rection and the Ascension the sacrifice would be neither perfect nor consummated. Therefore, at the moment-of consecration it is the risen Body of Christ that becbmes present on the altar, and\in,.Holy Commufii61i~,iit is this risen Body which the faithful receive. Now the charac-teristic feature of the glorified humahity of Christ is that of being filled with the Holy Spirit,.and of b.eing able to transmit and communicate thissame Spirit.,At the Resur-rection the Body of Christ was tr~a~stormed and spirit-ualized by the Spirit. So it is that St. Paul considers the risen Christ as He who possesses the Hgly Spirit, and who bestows Him for our sanctification,s "The last Adam was made into a quickening spirit" 0 Cor" 15:45). This Pauline teaching is based on the testimony of the Gospel itself, which shows us in the risen Chyist Him who says.to His apostles, "Receive ye the Holy Ghost" (Jn 20:22), and above fill Him who sends, the Ho.ly Spirit to all the disciples on the day of Pentecost (Lk .24;49; cf. Act The reception of the glorious flesh of Christ in the body of the communicant produces as a consequence a general pervasion by the Holy Spirit. Before all let us notice that the Holy Ghost does not veil the presence-of Chr!st, as though He were an intermediary acting as a screen. On the contrary, He causes the ~piritual diffusion of this p~es-ence; it is He who causes the action and love of the Savior to penetrate the soul. It is through Him that the presence of Christ gr6ws deeper and more intimate. It is this spiritual action of the bodily presence of the Savior in the communicant that demands the latter's cooperation if that action is to be exercised fully. It fol-lows that this spiritual action requires the most fervent thanksgiving possible. We are now in a position to define more exactly the role of thanksgiving. For our part, i.t is the welcome to the bodily presence of Jesus as a presence which acts in a spiritual manner and thus penetrates the soul. It is, be-sides, traditional to think of thanksgiving along these lines: the Christian who has just communicated addresses himself to Christ present in his heart, Christ who. has reached and penetrated into his very soul. The communi-cant desires to make some answer to this spiritual pres-ence. This concentration of attention upon the spiritual presence of Christ should not lead to the conclusion that the bodily presence is without importance. The spiritual presence is bound up with the bodily presence:. ,we have recalled that it is the glorious Body of Christ that is the s Cf. F. X. Durrwell, La Rdsurrection de ]dsus, myst~re de salut, (Paris: 1949), pp.,196-23. 4- 4- 4- Thanksgiving Alter ltoly Communion VOI~UME 20, :1961 ÷ ÷ ÷ lean Galot, SJ. REVIEW FOR RELIGIOUS 28 bearer of the Spirit. In th6 rest of the Sacraments there is an action by the Holy Spirit, together with an infusion of grace; the Eucharist is the only sacrament wherein we receive not only grace, but the author of grace. In it we receive the spiritual presence of Jesus after a fashion that ig quite exceptional, arising from the fact that this pres-ence is the immediate result of the presence of His Body within us. It is this bodily presence which guarantees the spiritual presence at its highest pitch, together with spiritual nourishment, Thanksgiving after Holy Com-munion has as its object the spiritual assimilation of the presence of Christ. The Duration of Thanksgiving According to what principle should we determine the lengt.h of thanksgiving? Father Viller writes, "It is nor-mal for it to last as long as the Eucharistic presence of our Lord remains in us.''9 But it is quite legitimate to enquire with Father Rahner whether this criterion is fully justified. To begin with, certain inconveniences arise when we seek to measure the duration of the thanksgiving by the duration 'of Christ's bodily presence in the com-municant. If, as Cardinal Gasparri states on medical evi-dence, a small host remains in the stomach for not less than half an hour, and a large one for an hour, then this p~i~sistence of the species will in any case require a very long thanksgiving. Besides, were this criterion to be adopted, it would be for doctors and biologists to decide upon the length of the thanksgiving. In addition to this, such a criterion does not appear to be founded on the true nature of the thanksgiving. The proper object of the latter is not the reception of the Body of Christ in the stomach, but the reception of the total Christ by the soul. We are not dealing with an assimilation by the body of the Body of Christ, but with a reception and assimilation "of His spiritual presence. We have tried to stress that the bodily presence of Christ is designed to give us His spiri-trial presence more comp.letely and immediately. Since the role of the thanksgiving is to open the heart or the soul to this spiritual presence of the Savior, its duration should be measured by the amount of time nor-mally needed if such'a welcome is to occur. It should be long enough to allow the person of Christ to exercise His action in the soul of the communicant and to fill it with His life in the measure that He Himself wishes. What 'must take place is a penetration of our intelligence and will and sentiments by this presence, and there must also be a personal effort to achieve this intimate relationship with Christ. No absolute norm can be given for achieving Communion (pratique), in Dictionnaire de Spiritualitd, II, 1282. this, simply because one has to take into account the sub-jective dispositions of each individual. But in general spiritual writers think that about a quarter of an hour is good measure for most. This isJong enough to ach,,ieve the degree of recollection whi~li ig n~ssary if profound con, tact is to be made. with the person of the Savior, and if the depths of the soul are really to be opened to Him. Certainly it would be arbitrary to declare that the last prayers of the Mass are a sufficient thanksgiving after Holy Communion, and that once the litUrgical action has been completed there is no need to prolong the prayer which should act as an echo to the.sacrament just received. On the contrary, itmay be said in general that the mere fact of following the prayers 6f the priest up to the ending of Mass is not sufficient to afford Christ th~ intimate and personal welcome which His Eucharistic. presence asks of us. It is to be regretted that there are those.who syste, m~tically favor the departure of the faithful as~.soon as Mass h~s ended. If there are many lives in wl~ich frequent reception of Holy Communion fails to produce the fruit that might be expected, may this not be because the welcome offered tq the Eucharistic Christ is not fervent enough, and because the thanksgiving which should lie the surge of a° personal. love is too brief and superficial? It has already been no-ticed that sacramental efficacity ex opere operato requires man's cooperation if it is to have its full effect. Father Rahner writes that this efficacity eX opere ope-rato cannot be increased by the thanksgiving, and that it simply depends upon the disposition of the soul at the moment of Communion. He adds that if this disposition exists it will in fact be manifested by a meditative and recollected thanksgiving,xo But if it is true that strictly speaking the thanksgiving does not augment the efficacity ex opere operato, it does none the less allow th.is effic~city to be. exercised in the fullest measure desirable. It is not only at the precise moment of communicating that 'the bodily presence of Christ produces its spiritual action. This is continued later. It will be fully efficacious to the degree that the soul yields itself to it in thanksgiving, attempting to respond by faith and love. The length of the thanksgiving does influence the efficacity of the sacra-ment, seeing that normally a certain time is called for if a welcome is to be considered fervent. It is therefore un-derstandable that the Church should recommend a thanksgiving which goes on after the Mass has ended. In this connection it is worth citing from Mediator Dei. As this encyclical is expressly concerned with the liturgy, it ~o Rahner op. cir., pp. 186-87. ÷ + + Thanksgiving A~ter Holy o~munio~ VOLUME 20, 1961 29 ÷ ÷ REVIEW FOR RELIGIOUS 30 is particularly noteworthy that it should stress the per-sonfil thanksgiv.ing d~manded by the liturgy. When the Mass, which is subject to special rules of the liturgy, is over, ~the person who has received Holy Communion is not thereby freed from his duty of thanksgiving; rather; it is most becoming that, when the' Mass is finished, the person who has received the Eucharist should recollect himseif, and in intimate union with the divine Master hold loving and fruitful converse with Him. Hence they have departed from the straight way of truth: who, adhering to the letter rather than the sense,~assert and teach that, when Mass has ended, no such thanksgiving should be added, not only because the Mass is itself a thanks-giving, 'but also because this pertains to a private and personal act of piety and not to thegood of the community. But, on the contrary, the very .nature of the sacrament de-mands that its reception should produce rich fruits of Christian sanctity. Admittedly~the congregation has been officially dis-missed, but each individual, Since he is united with Christ, should not interrupt the hymn of praise in his own soul, "al-ways returning thanks for all in the name of our Lord Jesus Christ to God the Father" (Eph 5: 20). The sacred liturgy of the Mass also exhorts us to do this when it bids us pray in these . words, "Grant, we beseech thee, that we may always continue to offer thanks" (Postcommunion, Sunday Within the Octave of Ascension) " .and may never cease from praising thee" (Postcommunion, First Sunday after Pentecost), Wherefore, if there i~"no time when we-must not offer God thanks, and if we must never cease from praising Him, who would dare to reprehend or find fault with the Church, because she advises her priests (canon 810) and faithful to converse with the divine Redeemer for at least a~ short while after Holy Communion, and inserts in her liturgical books, fitting, prayers, enriched with indulgences, by which the sacred mlmsters may make suitable preparati6n before Mass and Holy Communion or may return thanks afterwards? So far is the sacred liturgy from re-stricting the interior devotion of individual Christians, that it actfiaily fosters and promotes it so that they may be rendered like to Jesus Christ and through Him be brought to the heavenly Father; wherefore this same discipline of the liturgy demands that whoever has partaken of thd sacrifice of the altar should return fitting thanks to God. For it is the good pleasure of the di;gin~ Redeemer to hearken to us when we pray, to converse witfi us intimately and to offer us a refuge in His loVing Heart. Moreover, such personal colloquies are very necessary that we may all enjoy more fully, the supernatural treasures that are contained in the Eucharist and, according to our means, share them with others, so that Christ our Lord may exert the greatest possible influence ofi the' souls of all. Why then, Venerable Brethren, should we not approve of those who, when they receive Ho!y Communion,~ remain on in clbsest familiarity with' their divine Redeemer even after the congregation has been"officially dismissed, and that not only for~the consolation of conversing with Him, but also to render Him,due thanks and praise and especially to ask help to defend their souls against anything that may lessen the efficacy of the sacrament and to do everything in their power to cooperate with the action of Christ who is so intimately present. We exhort. them to do so in a special manner by carrying out their resolu-tions, by exercising the Christian virtues, as also by applying to their own necessities the riches they have received with royal liberality. The author of that golden book The Imitation of Christ certainly speaks in accordance with the letter and the spirit of the liturgy, when he gives the following advice to the person who approaches the altar, "Remain on in secret and take delight in your God; for He is yours whom the whole world cannot take away from you" (4 [12).Xffr," ~" ,~ The Manner o[ Making the Thanksgiving The very first principle is that of personal liberty. The same way cannot Be laid down for everyone, and there is no universal formula. Wffat is important above all is that in this meeting with Christ the soul should express itself personally. One cannot, then, lay it down as a hard and fast rule that the best way to make a thanksgiying is to follow the priest in the prayers he says towards the end of Mass. Besides, taken from the point of view of giving thanks, it must be admitted that in the Roi'han Rite these prayers are very brief and only slightly' d.eveloped. Cer-tainl); at Masses where the congregation sings or pub-licly recites the pray+rs, this activity will be shared by tl~0se who have communicated. They 16ave till later the completion of their thanksgiving in a thore personal man-ner. But where neither hymns nor'prayers are expected from the congregation, each communicant is free to fol-low his own taste. On the c;ther hand it is quite possible that an individual will need educating in the use Of thig liberty. An obvious example is that of children, and the same may be "true of a number of the'f~tithful. In orderto help their thanks-giving a prayer may be recited or an intention placed before them. Care should always be taken to introduce va,riety in order to avoid monotony and routine. But if there is great freedom in the loving converse that a thanks-giving should be, there are still certairi principles which should guide .the exercise of this liberty. We suggest, at any rate, two such principles. _Firstly, thanksgiving is the kind o.f prayer .which is par excellence directed towards the person of our Lord inti-mately present. Indeed, as we have noticed, the Eucharist is d!stinguished from the other sacraments by this gift of the personal presence of Christ. It follows that after Com-munion we should be concerned to develop all that brings our attention to bear upon the very person of the Savior. Before all else.~ this person claims our ad~oration. In renew-ing his faitfi'in the presence of God now bestowed upoh him so intimately, the communicant adores the Lord with his whole soul; and proclaims before the Infinite Being that he is a creature and utterly depend~nt. But as this in-finite being is now his guest, the com~nunicant tries to converse with Him familiarly. He c~mverses with Christ who is the identi(al'Christ of the Gospel, the Christ who The Cath~oiid Mind, 46 (June, 1948), 363--64. ÷ +- + Thanksgiving Alter Holy Communion VOLUME :~0, 1961 ÷ ÷ ÷ lean Galot, $.]. REVIEW FOR RELIGIOUS 32 enjoyed being in the company of men. The thanksgiving is the privileged moment in this personal dialogue. On the other hand it is no less important to recall that the thanksgiving is indeed the prolongation of the Mass and its completion in the individual soul. In consequence .there should be an effort to develop the dispositions which unite the soul with those of Christ in His sacrifice. Be-fore we go on to mention these dispositions, a word should be said about the Mother of God. MaTy can bring great help to the soul in its effort to unite itself to Christ's sacri-fice, just as she aids in the effort towards union with 'His person. The Blessed Virgin remains the model of per-sonal welcome to the Savior's presence, as well as of an intimate sharing in the redemptive sacrifice. She has a mission to draw souls along this way. It will be particu-larly helpful to have recourse to her in order to ensure a genuinely fervent thanksgiving. Among the dispositions which associate us with Christ's sacrifice is gratitude, for it has given its name to the Eu-charist. We have to own that we owe all to God our Father, and we should thank Him accordingly. It is to Him that we owe in the first place the immense benefit of Com-munion itself, and the gift of the Savior's body. Then comes offering. Once we have owned that all is the Father's sift there is the wish to.°ffer Him all in re-turn. The total offering that Christ makes in the Mass entails a total offering by the communicant. Thus'Com-munion prepares the soul for the sacrifices of the day ahead those sacrifices 3vhich are the effective seal of what has been offered at Mass. If it is possible to foresee certain sacrifices, it may be desirable to offer them in advance during the thanksgiving; thus the Christian will be helped to accept them in the right spirit when they come, a spirit of intimate union with Christ and the love which was carried to love's extreme limit. Thanksgiving gives the soul the opportuniiyto adopt an ideal attitude of gener-osity Which it will ~try to maintain when the difficult mo-ments do in fact arise. We should also-mention confidence and joy. Christ present in the soul is the glorious Christ, and his sacrifice was consummated in the triumph of the Resurrection. The thanksgiving should strengthen confidence in the victory the Savior h~is won, both in Himself and in others, and in such a way that the communicant is able to face more firmly obstacles to his personaFreligious life and apostolate. There should also be a renewal of spiritual joy. Coming from Communion the Christian should have a heart filled with enthusiasm and be manifestly happy, for he has just welcomed the triumphant Christ. Neither should prayer of petition be forgotten. The sacrifice of the Mass is celebrated in order to spread divine graces more abundantly upon men. The communicant ought to unite himself with the salvific will of God which, in Christ, inspires sacrifice. With the Savior he should de-sire the expansion and progress of His Kingdom; he will become more and more one. w~th the intima~t,e~desires of Christ in proportion as he makes his own the great inten-tions of the Church and asks for their fulfillment. At the same time the communicant entrusts his own private in-tentions to Christ, intentions that represent his own share of responsibility in the advancement of the Kingdom. He will take advantage of the Savior's presence in order to express his desires and hopes and to obtain their satisfac-tion. Finally, among those dispositions which we may expect the thanksgiving to develop is fraternal charity, that love of one's neighbor of which Christ's sacrifice is the perfect and extreme form. Ever since St. Paul the Church has loqked upon Holy Communion as the most powerful sac-ramental bond linking Christians, the artificer par excel-lence of the unity of the Mystical Body. Thanksgiving should contribute to the flowering of charity, both of that direct charity which concerns the people with whom daily life brings, us into contact, as well as 6f that more ample charity which goes out to the furthermost confines of the whole Mystical Body, and which is marked by a special goodwill towards our separated brethren. Such, then, are the essential dispositions which thanks-giving should develop. One could add others, or further stress certain aspects of those which we have mentioned. With Father Rahner we say .that all that is really pious may find its place in the thanksgiving, all that touches the heart of the communicant, his cares and his intentions. For the point is that thanksgiving may be seen as a kind of r~sum~ of Christian piety, of which it is the richest and most complete moment. In thanksgiving participa-tion in the sacrifice of the Mass~ reaches its peak, just as does union with the Savior's person. All the diverse, inti-mate attitudes of a man before God may therefore here be manifested in the deepest and most concrete fashion, with a most sincere personal impulse. Thanksgiving A]t~r Holy ommunion VOLUME 20, .1961 I~MILE BERGH, S.J. The Communicant's Our Father ÷ ÷ + The Reverend ~mile Bergh, S.J. is editor of Revue des Commu-naut~ s Religieuses and Professor of Canon Law at Coll~ge Saint-Albert, Eegenhoven - Louvain, Belgium. REVIEW FOR RELIGIOUS 34 The Lord's Prayer expresses perfectly the-dispositions which should be found in the Christian who participates integrally in the H01y Sacrifice by sacramental Com-munion. It is certainly proper to think that at the mo-ment when our Lord actualizes in us in a special way His work~of salvation, He teaches us by His Spirit the prayer of redeemed sons. Le~ us then respond to this grace. Father! We are to call You by this name because Your Son, present in us, communicates to us His" divine life. May His Spirit make us taste Your paternal love. Our Father! We all form but one body, we who h~ive partaken of the same bread. In Christ we encounter all of Your sons. We will be always more brotherly toward them. We pray to You especially for our brothers, sep- "arated Christians, that they may participate ih our Eu, charist in the only Church of Christ. Who art in heaven! We believe firml~ that we have re-ceived the bread come down from heaven. Grant, our Father, that we may live close to You in spirit in the so-ciety of~the angels and saintS. Hallowed be thy name! The Eucharistic offering gives You perfect glory. YoUr holiness, Your power, Your love, all Youi attributes proclaim themselves in this mystery. W~ Unite our adoration to the Holy, holy, holy of the angels. We render You all honor and glory through Your beloved Son. Thy Kingdom come! Grant that from the rising of the sun to the going down thereof all people will offer this purest sacrifice to You, so that the entire universe may submit to the sweet yoke of the Lord Jesus. May His reign of truth and of life, of holiness and grace, of justice, of love, and peace extend itself by means of the Eucharist to all nations. Thy will be done on earth as it is in heaven! To receive communion is to participate in the obedience of Your Son. In everything He has done that which was pleasing to You. We give ourselves over to His will as He has given himself over to Yours for us. Make us, by the Spirit of Jesus, faithful and loving, patient and resigned. So 'the world will believe that You are Love, and the fiat of ~he earth.will echo the Amen i~f heaven. ~ . ~ Give us thi~ day 9ur daily bread! After the gift ~which You have just given us, the bread of eternal-life, can we doubt for a moment your Providence and not wait to re-ceive from it all the help for which our misery has need? Give us each day the bread of heaven. Give it to us in our last hour. Give it to all suffering humanity, for it is the guarantee of eternal happiness. Forgive us our. trespasses! By the ~mystery of the Re-demption, ~,hic.h has just renewed itself.,~f~ "us, by the power of the Body~and the Blood of Jesus, our Savior, purify us of our faults; give us deep contrition for them, pen~etrated with love and~fihal confidence. .~ As we forgive those who trespass against us! On the altar as at Calvary You pardon Your enemies. You have desired that we should reconcile ourselves Witti one another be-fore presenting our offering. Teach~ us to imitate You~ mercy w.hmh ng~ther judges ngr condemns, but pardons without tiring. By the charity which we draw from the Heart of Your Son may we be everywhere and always artisans of peace and union. Lead us not into tempthtion! We-ha~e been made mem-bers of Your Divine Son. Do not l~t us profane His most holy Body. We ate threatened on eve~ sid6,.,f0'r w'e are feeble and inconstant, imprudent and (owardl~. Welean solely on His strength and His 'love. YoUr S6.n could not be very powerful, were He unable to support U.S from one day to the next. But deliver us from evil! For one who has understood what Communion i~, tl~ere is but one evil" on earth: to lose or allow to grow cold by s~in the friendship of God. Deliver us from sin and fronl everythin~g-which leads to sin. Deliver poor. sinners fr6m their slavery.~ Amen! It is Your love which, after halving invented the marvels of the Incarnation" and the Redemption,. has crowned their magnificence with the ~ystery of the Eu-charist. We believe in-and w~ will always believe even more in Your charity. The Communicant's Our Father VOLUME 20, 1961~ MICHAEL NOVAK Saint East and West ÷ ÷ ÷ Mr. Michael Novak, a well known writer on various subjects, is cur-rently studying for a graduate degree in ~unhiivleorssoitpyh.y at Harvard REVIEW FOR RELIGIOUS In these days of the re-unifying of East and West, the great John Chrysostom stands as a long-ago figure to whom both sides already turn with reverence and love. The Bishop John (3't47-~07) won the hearts of his people so wholly by his gifts of spirit and of tongue that they could not refrain from calling him as by a proper name: John of the Mouth of Gold. The saint and bishop is a crucial figure for the understanding of the meaning of the East. For he was Bishop of Constantinople in the time in which it was beginning to exert its power as the new center of the East. At the time of Nicaea in Byzantium was still inconsiderable. To the cultured world, it meant little save as the recent choice of Con-stantine for his eastern headquaiters. To the Church, it was again inconsiderable, compared to the great sees of An tioch and Alexandria which, with Rome, formed the triangle of influence in the first three centuries of Chris-tianity. But by ~81, at the second ecumenical council, Constantinople had squared the triangle by becoming the third great patriarchate of the East, and had in fact shouldered out her Eastern rivals to take second rank to Rome alone. Rome and Constantinople: two instead of four. The Emperors, of course, both of East~ and West, would be sympathetic to such centralization.' Magistrates and bishops, these were the focal points of leadership among the people (not as in our own day, when com-munications leaders, unions,, vocal professional classes, and so on, offer other focal points of leadership). To have the bishops aligned with the magistrates was then the simple key to unity and civil peace. To have one 'bishop in authority in each half of the Empire was to limit to two the locks in which to turn the key. In ~98, when St. John was raised to the patriarchal throne of Constan-tinople, the system was beginning to manifest what would be its classic workings. John Chrysostom had been ordained a priest and had been preaching at Antioch for a dozen years when he was kidnapped and borne away to Constantinople. He was kidnapped, so that neither he nor the people could . successfully protest--there was vigor and imagination to actualize cabinet decisions in those old days. How did John react to the outrage? There was no escaping the sit-uation. For the glory of God he set his hand to" the task with courage, then with joy: ., ~.' ~" Cardinal Newman's famous essay gives us perhaps the best image of this man Chrysostom, for whom the Car-dinal felt one of the most intimate ties among all the men of history. Why was John a great orator? Because he spoke in the measures of Cicero? to the public weal like Demosthenes? mystically like the ardent Origen? as a witness of the faith like Athanasius? s~,eepingly and cre-atively like the grei~t~Augtistine? humanly and commonly upon the Bible like the Antiocheans among whom he was trained? No, says Newman, he won the greatest ac-colade of any human orator because of his closeness to his people's heart. He spoke for them, adapted all his talent and his heart to their needs and characters. ~They crowded one another to hear him. He defended them. He loved them. Against those who plotted against him, the high in Church and Empire, the people were his strength: not at all because he was a demagogue, but be-cause he was a shepherd who knew his Own, whose own knew him. His greatest characteristic, the secret inner x~ord of his life, Cardinal Newman conceives, was his "intimate ~ym-pathy and compassionateness for the whole world,~ not only in its strength but in its weaknesses." His singular mark is "the interest he takes in all things, not so far as God has made them all alike, but as he has made them different from each other., the discriminating affection-ateness with which he accepts everyone for what is per-sonal in him and ianlike others., his versatile recogni-tion of men, one by one, for the sake of that portion of good, be it more or less, of a lower,order or a higher~ which has severally been lodged in them., the kindly spirit and-the genial temper with which he looks round at all things which this wonderful world contains." Out of such love, Chrysostom could approach his peo-ple with balm and sweetness evefi when ~he chastised. He hated and feared only sin; he was willing to die over and over for his people; he told them that. His own life was active and abstemious to infective measure. He did chas-tise; he made enemies. Impulsive and courageous both, he was not cautious with that talent of his: he spoke. The people loved him mightily for his courage and his single-ness. "His friends loved him with a love stronger than death, and more burning than hell; and it was well to be so hated, if he was so belovedT' When Theophilus, the Patriarch of Alexandria, enviously contrived with the of-fended Empress Eudoxia to exile John in 403, the first ÷ ÷ ÷ Saint ot East and West VOLUME 20, 1961 4. + 4. Michael Novak REVIEW FOR RELIGIOUS 38 exile, John could not be cautious even while his fate hung in the balance. He preached with great fervor to his people: "Christ is with me; what then have I to fear? . Already you are even more earnest than before. And when tomorrow you go out singing the litanies I shall be with you, for where you are, there also am I, and where I am there are you. Though separated in space we shall ever be one in spirit, for we form one body and it cannot be separated from its head . I am ready to give my life ten thousand times over for you . You have watched many days and nothing has moved you from your pur-pose. You have not been weakened by threats or by long-drawn- out waiting--you have done what I have always been w~anting you to do: set earthly things at naught, turned your backs on this world, risen above the slavery of the body. That is my crown, my consolation, my anoint-ing, my token of immortalityl" 1 Thus was John's union with his peop!e. His affection-ate heart poured out toward each of them, and they re-sponded. By a ruse, at the time of his second exile, he called for his riding mule at one side of the cathedral, then slipped out the other, lest the gathering crowds riot against the Imperial troops who led him off: John always thought of the people. In exile, too, on the far eastern shores of the Empire "in the loneliest spot on earth," John thought of them. He wrote them hundreds of letters, asking of their health, consoling, chiding, directing, beg-ging money for new missionary needs which he had come upon in his travels. John's first trait was compassion. His second was sanguinity: never have I had it so good, he writes shortly after he had nearly died, this frail man in his sixties, in toilsome travel; the cool air, the leisure, the care heaped on me have refreshed me. "My health was never better." His third characteristic was courage and impetuositymtogether with his goodness, these brought him to his exile and his martyrdom. To understand the malice and passion that could have moved Christians to send so good a shepherd to exile and to death, we must reflect on many aspects of the Chris-tianity and of~ the world in John's time. The peoples around the blue Mediterranean were now Christians only three hundred years or, much more accurately, only for two or three generations. The perfection of holiness, the expression in manners and institutions of the love and justice of the Lord, had hardly had time to be explored even mentally, f.ar less sink deeply by habit into the tissue and fibre of society. Elementary passions were fierce. Ways and means were direct. Monks--those whom Christianity might be suppo.sed most thoroughly to have transformed 1 Donald Attwater, St. John Chrysostom: The Voice of Gold (Mil-waukee: Bruce Publishing Company, 1939), p. 126. II were known in several places to have torn enemies limb from limb with bare hands; their riots at Alexandria were a terror. The soldiers guarding Chrysostom at Caesarea risked murder and enslavement at the hands of Isaurian barbarians rather than face the mob of monks "Who de-manded that Chrysostom leave the' city. As f6~ tl~*hier-archy, Chrysostom-said he feared nothing as he feared the Bishops. Treachery that led to flogging, tearing with hooks, burning with torches as happened to one of Chrysostom's deacons, a gentle youngster runs through the history of this time as bright scarlet and yellow thread. We must understand the wildness of the. times, and the fierceness of even tl~e next many. centuries, if we are to understand the play of human passion ;ind barbarity upon which Christianity is called to ~zork. Violeni" im-pulses, cruel machiriations, fierce self-int~rest, still rhn rampant in ourselves; but we must make an effort to re-call the times when society itself more directly expressed thes~ evil movements, less effectively neutralized and hid them. Civil magistrates and ecclesiastics may not in the main be hny holier now than heretofore, but political forms, canon law, the persistent suasion of civilized con-ventions prevent their being as violent in their evils as once upon a time save where the primitive passions arise again under the ifnpulse of marching boots and songs and shouts. ~3nce this backdrop of primitive violence is set, still another note in Chrysostom's situation must be recalled. It is this. The glory of European_ civilization was in the fourth century pivoted not yet on Europe proper but still on Alexandria and Antioch and old Byzantium. The East bore the glory of human history. Greek was the great language of the Empire. Christ had come in the East. Greek philosophy was reborn in Origen, Plotinus, Por-phyry. The great councils of the Church were Eastern councils. The Near East flourished with libraries, splen-did cities, the roads and methods taught and fostered by the earlier Romans. The deserts of Egypt and the fast-nesses of Cappadocia and Caesarea heard in th~ still crystal nights the prayers of Eastern monks. Augustine was only now bringing glory to the Latin tongue; Benedict was not yet shifting the pivot of spiritual energy from Egypt to Subiaco. Western Europe was only now b~ing conceived: the East would bring her forth. In the violence of local jealousies and entanglements with the state, Chrysostom, the light of the East, could appeal to Innocent of Rome. The Pope and he could find solace in one another's reverence and love. East and West were not yet fighting against themselves, as mother against her daughter, as land blessed by the presence Of Christ against land chosen as the humble seat of Christian leader-÷ ÷ ÷ Saint o] East and West VOLUME 20, 1q61 ÷ ÷ ÷ Michael Novai~ REVIEW FOR RELIGIOUS 40 ship. Chrysostom appealed to Innocent; Innocent replied with love. But Innocent's powerlessness foreshadowed the doom that'was to come, as the torture and dispersal of his emissaries foreshadowed other injuries of each side upon the other in the centuries to come. These were still prom-ising times, at the end of the fourth century. Chrysostom's fame went around the world; Africa and Italy shared the suspense and pain of his exile, and waited upon his let.° ters. These were among the last generations of unity of sentiment between East and West. Like the mysterious column of flame that leapt up in the night from Chrys-ostom's pulpit and burnt his cathedral to the ground, as he took ship never to see Byzantium again, so the glory of the East was to feel the flame and fire of centuries of strife, long separation, and continued misunderstanding. Why was Chrysostom sent into exile? When he came to Constantinople as Patriarch, he had begun, as Donald Attwater says, to sweep the stairs from the top. He re-buked, encouraged, disciplined, set the example for his clergy. He spoke courageously against the rich, on behalf of the poor for justice' sake, on behalf of Christ for humility's and charity's sake. He rebuked vanities and thoughtless injustices. He spoke plainly to the Empress and her court. At a crucial moment he dared to speak impulsively of the vanity of wealthy women of the court, perhaps even deliberately to ring out adoxia (disreputa-ble) to suggest Eudoxia (the Empress). Theophilus of Alexandria had had little difficulty setting enemies in motion concertedly against him. Exiled once, brought back in glory shortly--in a harbor crowded as a city square, to shouts, to joy--he was soon exiled again, de-finitively. The reasons hardly mattered. Enemies he had. Richly slippered toes he had trampled on. The ardent affection of the people could not prevent the outcome. Why was Chrysostom sent into exile? It was not only for the reasons of state, the trumped-up charges, then the consequent intrigues, the pressures, the Imperial com-mands to make the charges stick. These were trivial, dispensable. If it had .not been these, it would have been others. Good men must be broken. This is the law of Christianity. Chrysostom understood it, explicitly. Chrysostom's great natural gift was his unequalled heart-enflaming tongue; by all the laws of Christianity, his tongue would have to be silenced. Chrysostom had to be sent into exile, to the 'farthest parts of the Empire, so that God's grace might work where he had worked be-fore, Silent now in tongue, his letters live for ages--letters exile forced on him. Chrysostom grasped the fact that the kingdom Christ came to bring has laws for its inner life which set history topsy-turvy. A historian seeing the incredible malice, jealously, and ferocity of religious leaders in these times might marvel, with contempt, that Christianity could achieve so little fruit, even~,among her own.W, i~.t~',hier-archy, favor, churches, energies,~Christianity seems to do so lattle, for all 1.ts lovely wor~ls, to give the race-new hfe. But Christianity is not hierarchy or social acceptability. It is not monasteries or many vocations or crowds in church. All these did not prevent, they caused, the tor-ture of Chrysostom to death. Christianity is sacrificial love. Christian life is sacrificed life. Hence persecutions must come. If they do not come from those outside Chris-tendom, they must come from the corruption or limita-tions in the organization itself. Indeed, saint will perse-cute saint°as St. Jerome and St. Epiphanius joined Chrysostom's enemies; as good Cardinal Manning and khe saintly Newman could hardly bear each other's com-pany without severe constraint. Sacrificial love is the in-ner life of the Church. All the turmoil at Constantinople --jealousy, scheming, lying, banishment, and torture for those who would not w6rship with the false successors-- all this was necessary to make the inner life of Constan-tinople's faithful fructify. Christianity simply cannot live without suffering. External standards and measurements have got, at times, to be set at odds. Only so can con-sciences be proved truly mature, strong, brave, bold, in the darkness of faith and selflessness. "There is no need to remind you, the teacher and shepherd of a great flock," wrote Pope Innocent to Chrysostom, "that everywhere and always good men are put to the test of meeting with injustice and evil . Rest securely then in your good conscience, honored brother, for that is the strength of all good men in the hour of~affliction." "Do not be scan-dalized," John wrote to Olympias, recalling the ~candal of the Incarnation and of all the Scriptures; "remember that things even more distressing happened in the days of the Apostles." Though disunity and injustice racked his see, though true Christians were driven from the churches while the cowardly or the vicious pretended to worship there, though he himself was driven ever further into exile, forced to travel and again to travel (an attempt by his enemies to murder him by physical exhaustion), still Chrysostom could die with his favorite phrase upon his golden lips: "Glory be to God. Amen." Chrysostom un-derstood Christian love. "Be true to yourself and no one can harm you," he wrote in a last short treatise which he sent Olympias. Conscience is the dwelling place of Chris-tianity, and sacrificial love is the life of conscience not duty, or conformity, or complacency, or obligation, or law. Purified will, enamored of persons, and a Person. Hierarchy, canon law, even the Holy Mass itself, the sacra-÷ ÷ ÷ Saint oI East and West VOLUME 20, 1961 41 ments these are but means. They are some of them in-dispensable means, to be sure, given by Christ. But the accent may as accurately be On means as on indispensable. The law is love. The Way is love. The fruit is love. And love means sooner or later darkness, trial, and suffering. If East and West are separate since the tiine of John, it is because all kinds of considerations have got the better of sacrificial love. Historically polemic has been preju-diced and fruitless, each side preferring personal empha-ses to self-sacrificial views of truth. Why do Roman Cath-olics in practice if not in theory, exaggerate the legalisms of the external Church out of all proportion to their Christ-given role? Because these aspects have been under severe attack for many centuries and, knowing their value, these people have not got accustomed to seeing their limitation they are means, not the goal. Why do Easterners resist the effort of unity? Because they do not wish to forfeit centuries of tradition by a too humiliating capi~tulation to Western points of view. There are count-less 6ther reasons: none of them are insuperable, save through lack of charity. The inner dynamism of Chris-tianity is toward unity. Disunity makes for inner anguish; quarrelling causes our intensest pain; selfishness and ac-cusation make witnesses "cry out to the Lord for mercy and for aid. Just so, the scandal of disunity is our trial and darkness. The inner life of the Church is Sacrificial love. That is why the first need of East and West, when we speak of unity, is to focus our eyes with mutual regard on men as lovable as St. John Chrysostom, pride of the East and of the universal Church. Our longing hhs got to be the same as his: to be consumed, like John of the Mouth of Gold, in thq paradoxical, interior ways of the Lord's love. Michael Nov~ REVIEW FOR RELIGIOUS 42 R. F. SMITH, S. J. Documents The documents wh.ich appeared in, Acta Apostolicae Se, d~s I(AAS) during August and September, 1960, will be summarized in this article. Throughout the article all page references will be to the 1960 AAS (v. 52). New Breviary and Mass Rubrics By the apostolic letter motu propriO, Rubricarum in-structum, of July 25, 1960 (pp. 593-95), Pope John XXIII announced a new code of rubrics for the Roman Breviary arid Missal and decreed the revocation of all statutes, indults, and customs contrary to the new code. On the following day, July 26, 1960 (p. 596), the Sacred Congre-gation of Rites duly promulgated the new code of rubrics and directed that their observance be begun on January 1, 1961. The new code~ is a long document of one hundred and forty-four pages (pp. 597-740) and is divided into three parts which deal consecutively with general rubrics, rubrics of the Roman Breviary, hnd rubrics of the Roman Missal. "° General Rubrics Part One of the new code, entitled "General Rubrics," ¯ consists of nineteen chapters. The first of these chapters notes that the document is intended only for the Roman Rite. Chapter Two defines the mean.ing of liturgical days and rules that all such~days are now to be divided into first-, second-, third-, and fourth-class liturgical days. Chapter Three divides all Sundays into first- and sec-ond- class groups. First-class Sundays are the Sundays of Adveht, Lent, and Passiontide, Easter, Low Sunday, and Pentecost; all other Sundays are.second,class ones. First-class Sundays take precedence over all feasts with the ex, ception of the Feast of the Immaculate Conception. A second-class Sunday outranks a second-class feast and, when it occurs on November 2, displaces All Souls' Day. However, first- and second-class feasts of our Lord, ~when 4. 4. Survey oy Roman Documents VOLUME'20, 1961 R. F. Smith, $. ]. REVIEW FOR RELIGIOUS they occur on a second-class Sunday, take over the place as well as all the rights and privileges of the Sunday; in such cases accordingly no commemoration is made of the Sunday. Ferials, Vigils, Feasts Chapter Four defines ferials as days of the week other than Sundays and divides them into four classes. First-class ferials are Ash Wednesday and the ferial days of Holy Week; all these ferials take precedence over all feast days and admit no commemoration except a privi-leged one. Second-class ferials are the Advent ferials from December 17 to December 23 and the Ember Days of Advent, Lent, and September. These ferials outrank sec-ond- class feasts and must be commemorated when out-ranked. Third-class ferials are all the other ferials of Advent, Lent, and Passiontide. Third-class Lenten and Passiontide ferials outrank third-class feasts, but third-class Advent ferials yield to such feasts. All third-class ferials, however, must be commemorated when out-ranked. All other ferials of the year are fourth-class ones and receive no commemoration when outranked. Vigils are divided in Chapter Five into three classes. The two first-class vigils, those of Christmas and Pente-cost, take precedence over all feast days; and the Vigil of Christmas, when necessary, takes the place of the Fourth Sunday of Advent. Second-class vigils, those of the Ascen-sion, of the Assumption, of the Nativity of St. John the Baptist, and of Sts. Peter and Paul, outrank third- and fourth-class liturgical days; the only third-class vigil, that of St. Lawrence, is preferred tO fourth-class liturgical days. Both second- and third-class vigils, when impeded, are commemorated according to the rubrics governing such matters; these vigils, however, are omitted if they fall on a Sunday or a first-class feast or if their feast day is transferred or reduced to a commemoration. Chapter Six groups feast days into first-, second-, and third-clvss feasts. Only first-class°feasts have First Vespers; however, second-class feasts of our Lord have First Vespers whenever they replace a second-class Sunday. The rest of this chapter is concerned chiefly with those feasts which the law now requires to be inserted into particular cal-endars drawn up for the use of dioceses or of religious orders and congregations. Chapter Seven r~tains only three octaves, those of Christmas, Easter, and Pentecost. The octaves of Easter and Pentecost are first-class ones; that is, all the days of these octaves are first-class. The Christmas octave is a second-class one; the days within the octave are second-class, but its Octave Day is a first-class day. Chapter Eight lists the various seasons of the ecclesi- astical year, while Chapter Nine provides for the Saturday Office of our Lady. Chapter Ten considers the Major and Minor Litanies; it notes that, those bound to the Office no longer need to say th'e' ~itany of the Saints on the Rogation Days; it Mso giv~'sq6~al ordinaries ~he ~I56wer to transfer the Rogation Days from their usual place to three other successive days at a more appropriate time. Precedence of Liturgical Days Chapter Eleven gives a breakdown of the days of the ecclesiastical year into the four classes of liturgical days and gives the rank of precedence within each of the four classes. First-class liturgical days. include all first-class Sundays, feasts, ferials, and vigils as well as the days within the octaves of Easter and Pentecosti the Octave Day of Christmas, and All Souls' Day. Seqond,class litur-gidal days are all second-class Sundays, feasts, ferials, and vigils together with the days within the octave of Christ-mas. Third-class ferials and feasts and the one third-class vigil constitute third-class liturgical days, while fourth-class liturgical days include the Saturday Office of our Lady and fourth-class ferials. Chapter Twelve defines what is meant by the occur-rence ~of liturgical days, and the following chapter gives the rules to be followed when two or more liturgical days happen to fall on the same date. In such cases only first-class feasts may be transferred; all other feasts are either commemorated or completely omitted. Chapter Fourteen gives the procedure to be followed in the case of a per-petual occurrence of liturgical days. Chapter Fifteen reg-ulates the situation that arises when the Vespers of one liturgical day conflict with the First Vespers of the suc-ceeding day. If the days are of unequal rank, the Vespers of the higher day are to be said; but if the two days are eqtlal in rank, Second Vespers are to be said with a com-memoration of the other set of Vespers. Commemorations Chapter Sixteen divides all commemorations into priv-ileged and ordinary commemorations. Privileged com-memorations are made at Lauds and Vespers and in all Masses; ordinary commemorations on the other hand are made only at Lauds and in conventual and low Masses. Privileged commemorations are the commemorations to be made of a Sunday; of first-class liturgical days; of~ the days within the octave of Christmas; of the September Ember Days; of Advent, Lent, and Passi?ntide ferials; and of the Major Litanies (but at Mass or~ly). All other commemorations are ordinary. In Masses of first-class liturgical days and in sung non-conventual Masses, no commemoration~is to be made ex- 4. 4. 4- Survey Roman VOLUME 20, 1961 45 cept a privileged one. Second-class Sundays permit a commemoration of a second-class feast only; even this, however, is to be omitted if there is a privileged com-memoration. Other second-class liturgical days permit one commemoration, whether privileged or ordinary. Third-and fourth-class liturgical days permit only two commem-orations, Chapter Seventeen gives the conclusions to be used for the orations and commemorations of the Breviary and the Missal. Chapter Eighteen is concerned with the litur-gical colors; it gives episcopal conferences in mission" ter-ritories the power to change the liturgical colors when they are inappropriate for that particular region. Chapter Nineteen completes Part One of the document by its rubrics for Mass" and Office vestments; according to this chapter the folded chasuble and the broad stole are no longer to be used. 4- 4. ÷ R. F. Smith, S. ]. Breviary Rubrics Part Two of the new code of rubrics is entitled "Gen-eral Rubrics of the Roman Breviary." Chapter One of this part divides the recital of the Office into choral,~com-mort, and individual recital. Choral recital is that of a community obliged to choir by ecclesiastical law; common recital is that of a community (two or three persons are sufficient) not bound to choir. Chapter Two notes that the canonical hours are dis-tributed in a way intended to sanctify the natural day; nevertheless to satisfy the obligation of reciting the Of-rice it is sufficient if all the canonical hours are said in the twenty-four hour period allotted them. Matins (but not Lauds1) may be anticipated after two o'clock in the after-noon of the preceding day. In choral and common recital Lauds should be recited in the early morning and Ves-pers, even during Lent and Passiontide, in the afternoon. The same p.ractice is recommended for private recital. Compline is fittingly made the last prayer of the day, even though Matins of the following day have been antici-pated. When Compline is made the last prayer of the day m choral and common recital, the Pater noster is omitted, its place being taken by an examination of conscience ~of reasonable length; the Confiteor and the rest of Compline are then.recited. All of this is also recommended .for indi-vidual recital. Chapter Three then discusses the calendar to be followed by those bound to the Office. Chapter Four begins by listing three types of Matins. .The first type, consisting of three Nocturns, that is, nine Psalms and nine Lessons, is used on first- and second-class REVIEW FOR RELIGIOUS lit is probable that in private recitation Lauds may still be 46 anticipated. feasts, on the lfist three days of Hply Week, on the Octave Day of Christmas, and on All Souls' Day. The second type consists of a single Nocturn of nine Psalms and three Lessons; it is Used on all Sundays except Easter and Pente-cost, on all ferials except the'q~t three days of Holy Week, on vigils, on third-class feasts; on'the days within the octave of Christmas, and at-the Saturday Office of our Lady. The [hird type of Mating, used only on Easter and Pentecost and throughout their octaves 'if composed of a single Nocturn of three P~Alms find three Lessons. The chapter continues by" considering th~ five kinds of Offices which are now ~6 b~ used in the recital of the Breviary. "I:l{e Sunday Officd i~xcluding th6 Office°for Easter, Pentecost, and the Sunday within the oc'tave of Christmas) is largely the same as formerlywith the excep-tion of Matins. At Matins are recited the nine Sunday Psalms, then the absolution Exaudi; the Blessings to be used are Ille nos, Divinum ~iuxilium, and Per 'evangelica dicta. The First Lesson is the same as the former First. Leg-son of the day's Scripture; the gecond~ Lesson is formed'by u~iting the former Second and Third Lessons of the Scripture; and the Third Lessoh ig the First Lesson of the Homily, that is, the former Seventh Lesson. The festive Office is used for all first-class feasts and is said in the same wgy as an~ Office of a double of the first clasg was formerly said. The semi-festive Office, used for second-class feagts, is said in the same°way that Offices of doubles of the sdcofid clasg'have been~recited since 1~55. The ordinary Office, that uged on third-class feasts and for the Satm'day Office of oui'Lady, is recited like the former simple Office except for s6me changes in the Les-sons. The First Lesson is the former First Lesson of the day's Scripture, the Second Lesson is formed by uniting the former Second and Third Lessons of the Scripture, and the Third Les~on is of'the feast. This Third Lesson is obtained by using the "contracted life of the saint_ in the former Office; or, failing that, by.~om.bining the Fourth~ Fifth, and Sixth I~ssons of the former'prope.r Office of the feast; br finally, if .t.~ae feast has no Proper, by using the former Fourth Lesson of the Common. The ferial Office, used on all fer'ials and vigils except the last three days o.f Holy"Week and the Vigil of Christmas, is like the former ferial Office with Lessons either of the H~omi!y or of t~e day's Scripture. The Dil~eren.t Parts o['~the .OOice ,, ,.+,. Chapter Five, which legislates for the various parts of the Office, makes several changes which "can be-noted here. All Hymns of the Office have only the conclusion given in the Breviary, all changes~ of the conclusion by reason of feast or season being now excluded. The com-plete Antiphon is always to be said in its entirety both ÷ Survey o~ ~ Roman Documents ;=VOLUME 20, 1961 ÷ ÷ R. F. Smith, S. ]. REVIEW FOR RELIGIOUS d8 before and after the Psalms and Canticles of all the canonical hours. The Responsoria of Offices with three Nocturns are to be taken from the Proper or the Common as previously. In the.Sunday Office, however, the first Responsorium will be the one given after the former First Lesson; the second will'be that given after the former Third Scripture Lesson; and the third, when needed, will be the Responsorium formerly recited after the Third Lesson of the Homily. In ordinary Offices with Lessons taken from the day's Scripture, the first Responsorium will be that used after the former First Lesson, while the second will be that formerly used after the Third Scrip-ture Lesson. Ordinary Offices with proper Scripture Les-sons will use proper or o~dinary Responsoria in the° same order as given in the previous kind of ordinary Office. At Prime the Capitulum will always be Regi saecu-lorum and the Lectio Brevis is always to be the seasonal one. In private recital of the Office and when the Office is recited by those who are not deacons, the prayer or oration of the Office is to be preceded-by Domine, exaudi orationem meam with its response in place of Dominus vobiscum and its response. Preces feriales are to be said at Lauds and Vespers of the ferial Office on Wednesdays and Fridays of Advent, Lent, Passiontide, and the Sep-tember Ember Week. They are also to be said at Lauds on Ember Saturdays except on the Saturday within the octave of Pentecost. Chapter Six gives the directions for making the sign of the cross and for bodily posture during the choral and common recital of the Office. It is recommended that the regulations for the sign of the cross be followed also in individual recital.° Mass Rubrics Part Three of the new c~de of rubrics is called "General Rubrics of the Roman Missal." Chapter One gives some ¯ basic notions of the various kinds of Masses and notes that the phrase "private Mass'" should be avoided, since the Mass by its nature is always and everywhere an act of public worship. Chapter Two then considers the calendar to be followed in the celebration of Mass. Chapter Three siates that the conventual Mass, except on fourth-class ferials, must comform to the Office of the day and should be ff solemn Mass, or at least a high Mass. This chapter prohibits the chanting.of the Divine Office during the conventual Mass. Chapter Four is' con-cerned with Sunday and ferial.Masses, while Chapter Five discusses the Mass for feast days. This latter chapter al-lows a priest celebrating a non-conventual Mass to choose a proper Mass for a given feast from the section "for cer-tain places" rather than use a Mass formula from the Common. And in the case of non-conventual Masses, any of the Mass formulas in the correct category of the Com-mon may be used when there is no proper Mass for the feast. Votive Masses "' '" ~' Chapter Six, which deals with votive Masses, begins by general remarks on the subject. It permits all Masses of universal feasts of the Blessed Virgin to be used as votive Masses, excluding, however, Masses of the mysteries of hbr life with the exception of the Immaculate Concep-tion. Sequences are to be omitted in votive Masses and vestment colors should fit in with the votive Mass chosen. In the case of low, non-conventual votive Masses of the fourth class, however, the color of the Office of the day may be used; violet and black, however, are always to be used when demanded by the votive Mass chosen. The chapter then divides votive Masses into four classes. First-class votive Masses, which are those permitted on all litu

Issue 64.2 of the Review for Religious, 2005. ; Faith Perspectives Taking Account Religious Life Holy People QUARTERLY 64.2 2005 Review for Religious fosters dialogue with, God, dialogue witt~ ourselves, and dialogue with one . another about the l~olin~ess~w~e try tolive' ~ ~ according to charisms of Catholic religious life,,; As Pope Paul VI said, our Way of being church is today the way of dialogue. Review for Religious (ISSN 0034-639X) is published quarterly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ° St. Joseph's Provincial House 333 South Seton Avenue ° Emmitsburg, Maryland 21727 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2005 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. view for religious Editor Associate Editor Canonical Counsel Scripture Scope Editorial Staff Webmaster Advisory Board David L. Fleming SJ Philip C. Fischer SJ Elizabeth McDonough OP Eugene Hensell OSB M~ry Ann Foppe 7Fracy Gramm Jiady Sharp ' Clare Boehmer ASC Steve Erspamer SM .Kathleen'Hughes RSCJ Ernest E. Larkin OCarm Lot~is and Angela Menard Bisl~op Terry.Steib SVD Miriam -D. Ukeritis CSJ :'. QUARTERLY 64.2 2O05 contents 116 prisms Prisms faith perspectives Reaching the Alienated Heart: An Interpretation of the Descent into Hell Dennis J. Billy CSSR examines our creedal profession that Jesus "descended into hell" and finds an understanding for our contemporary human experience. 129 Feet First into Resurrection Bonaventure Stefun OFMCap delves into the significance of the Christian action of the washing of the feet in its sacra-mental way of relating us to the risen Christ. Reflection and Discussion 11,4] 135 152 taking account Framing the Ethical Rights of Priests James F. Keenan SJ writes as a moral theologian to propose four ethical rights that would seem to need recognition for the healthy communio of the church. Faith and Solidarity in Action Anne Munley IHM presents a summary overview of the May 2004 plenary session of the International Union of Superiors General (UISG) dealing with the ministry of reconciliation. Review for Religious 159 Women Religious in Treatment for Addictions Millie Cargas describes art therapy and its effectiveness in therapy programs. 168 Asceticism and Chaste Celibate Love 177 184 194 Vilma Seelaus OCD unites chaste celibate love with an asceticism that enlarges the heart to receive a greater outpouring of God's love, which then flows more freely through us into the lives of others. Prayer hoOy people Snapshots of Three Lesser-Known "Saints" Robert F. Maloney CM sketches in brief detail the lives and deaths of three Catholics who continue to call us to witness to our faith. Learning to Live Serenely: The Wisdom of FFancis de Sales Juliana Devoy RGS reintroduces us to the sage advice of Francis de Sales in the ordinary daily living of our Christian lives. Reflection and Questions Good and Bad Zeal, Good and Bad Spirits Joseph I. Cisetti notes that, while distinct, the teaching of St. Benedict on good and bad zeal and the instructions of St. Ignatius on good and bad spirits bear similarities useful for both personal discernment and pastoral ministry. Reflection Questions ~ 201 206 ]epartrn r s Scripture Scope: Reading the Acts of the Apostles Canonical Counsel: No More, No Less, and No Other . 212 Book Reviews 64.2 200Y prisms Te title of the apostolic letter "Stay with Us, Lord," published on the occasion of the October 2004-October 2005 Year of the Eucharist, repeats the request that the two disciples gave to the stranger as they made their way to Emmaus on that first Easter Sunday. Each year we seem to enter anew into the full challenge of our asking the Lord "to stay with us" as we move into the Easter and Pentecost seasons .and the Ordinary time of our Christian living that follows. Every Eucharist we celebrate brings home to us our relating to the Risen Lord in his sacra-mental presence. As we know from our scripture readings in the Easter season, Jesus seemed to move in and out of the disciples' lives. His alter-hating presence and absence prompted Peter and some of the other apostles to go back to their trade of fishing, which provided the occasion for a picnic breakfast at the seashore. Perhaps over and over again we may have heard the apostles and disciples begging "Stay with us, Lord." The Risen Lord does "stay" with his eucharistic stance of offering himself totally in love to God his Father and of giving himself R~ie'w for Religio~s totally in love over into our human hands. The once-event of crucifixion is removed from the boundaries of time by the very person of Jesus now risen and "stay-ing" with us day after day. Each celebration of the Eucharist calls forth our recognition of this nearness of Jesus, inviting us to be with him in this love-offering. Eucharistic adoration outside of Mass continues to chal-lenge us to recognize Jesus' presence not so much as merely "staying" with us but rather as continuously offer-ing himself in love totally to the Father and to us and always inviting us to fully integrate ourselves into his sacrificial (that is, "making holy") action. "Stay with us, Lord"--heartfelt as the plea is--needs more humbly to be prayed as "Let us be where you are, Lord." Our greatest desire is always to be where God is; we do not smugly ask God to take the trouble to come to where we prefer to be. By God's grace and calling, some women and men, often hermits or consecrated religious, have dedicated their lives to Eucharistic worship. They have given their lives to "stay" with the Lord. But for the most part we ordinary Catholics find that life is spent in many activities, working for a living, being helpful and hospitable, planning, coping with setbacks, involved with family or community, with limited time for church celebrations and Eucharistic devotions. Are we slow to expect Christ to "stay with us"? .If we are, why not prayerfully seek to "stay with Jesus" as he continues to be active everywhere in this busy world of ours? Then we realize the 'truth of the Eucharistic action: Jesus is the One inviting us to be With him in his love offering to God and to others. Our. prayer is: "Let me stay where you are." David L. Fleming SJ 117 64.2 2005 faith perspectives DENNIS J. BILLY Reaching the Alienated Heart: An Interpretation of the Descent into Hell The doctrine of Christ's descent into hell after his suffering and death on Good Friday conveys some important truths about the meaning and scope of the paschal mystery. To understand this doctrine, we must distinguish its theological for-mulation from the underlying truth it seeks to express. Also we must put aside any prejudices that would prevent us from probing this doc-trine for its full worth and must open our hearts to its deep spiritual wisdom. My purpose in this essay is to explore what the Apostles' Creed means when it says that Jesus "descended into hell" and to see this teaching's impact on our lives today. Christ's Redemptive Self-Emptying As we begin, note that the descent into hell makes sense only if we examine it in the con-text of the creed's other affirmations about Dennis J. Billy CSSR, a frequent contributor to our pages, writes from Accademia Alfonsiana; C.P. 2458; 00100 Roma, Italy. Review for Religious Christ, especially those related to his plan of redemp-tion. The Apostles' Creed, we are told, "is rightly con-sidered a faithful summary of the Apostles' faith" and constitutes "the oldest Roman catechism." 1 Since all of the church's teachings about Christ are closely related, just where this particular doctrine appears in the creed can tell us much about its overall function in the faith of the early church. When looking at the surrounding words, we see that Jesus' descent is placed between affirmations about his suffering and death ("he suffered under Pontius Pilate, was crucified, died, and was buried") and the proclama-tion of his resurrection ("on the third day he rose again"). If the early Christians considered entering the realm of the dead a natural outcome of Jesus' passion and death, then rising from the dead preceded his ascent into heaven. This immediate context tells us that Jesus' descent into hell occupies an important place in the over-all narrative of Jesus' redemptive journey. If it did not, it would never have been placed at the very heart of the creed's Christological affirmations. The preceding and subsequent Christological affir-mations in the Apostles' Creed make this even more apparent. Earlier we affirm that Jesus is the only Son of the Father, that he was conceived by the power of the Holy Spirit and born of the Virgin Mary. Later we affirm that Jesus ascended into heaven, sits at the right hand of the Father, and will come again in glory to judge the living and the dead. The creed's entire Christological narrative, then, looks something like this: incarnation, birth, suffering, death, descent into hell, resurrection, ascent to the Father's right hand, return in glory, final judgment. Along with the resurrection, Jesus' descent into hell lies at the center of the narrative of human redemption. It is the last action of Jesus' redemptive self- 119 64.2 200~ Billy ¯ Reacbing the Alienated Heart emptying and the point from which his transformation and glorious ascent begins. rOse,ore the dead, ' ascended into heave " allows for somb latit de: about how these forrnulation " " should be ftnderstOod. ,:, Formulation and Truth At this point some pivotal questions arise. What is the correspondence between the statements in the Apostles' Creed and the truths they express? Is this brief narrative of Jesus' redemptive mission meant to be taken lit-erally? Does it reveal certain truths about Christ's redemptive action that can be removed from their present theological formulations in the hope of uncovering deeper, even more penetrating insights into the mystery of the Christ event? Is it possible to uncover the underlying truths of the creed without doing damage to the tradition by which those truths have been passed down? There are no simple answers, to these important and enigmatic questions. Some statements in the creed are affirmations of historical fact and require a close con-nection between the formulations themselves and the truths they .state. To say that Jesus suffered, died, and was buried, for example, leaves little room for discus-sion. Either these affirmations happened or they did not. The historical events to which they refer must be either accepted or denied. Other statements in the creed, however, are affirma-tions of faith that cannot be historically verified and thus Review for Religious offer more leeway in distinguishing between their for-mulations and the truths they disclose. To say that Jesus rose from the dead or ascended into heaven allows for some latitude about how these formulations should be understood. What do we mean when we say someone has risen from the dead? What is our understanding of ascension? What is our understanding of heaven? Unlike the notions of suffering, death, and burial, these con-cepts have no historical precedents with which to com-pare them. Given these possibilities, theologians need to discern with care the nature of the particular creedal statement before them and then determine to the best of their abil-ity the relationship between the formulation itself and the truth it uncovers. While a certain logical gap will probably always exist between the formulation and the truth to which it points, the gap will likely vary from one doctrinal formulation to the next. Understanding Jesus' Descent Like the doctrines of Jesus' resurrection and ascen-sion into heaven, the creedal affirmation of Jesus' "descent into hell" allows for a certain amount of dis-tance between its theological formulation and the truth it expresses. After all, there must be more to this doctrine than the image it conjures.in our minds of a literal, spa-tial descent by Christ into the dark and gloomy under-world of the now outdated Hebrew worldview. What about the astonishing message of God's undying love for the world? Most would agree that hell is not so much a place as a state of being, one completely alienated from God. In our reinterpretation of hell, the focus should be on the spiritual and mental, not the physical. When speaking about Jesus' "descent into hell" today, perhaps we should interpret it as revealing something about 121 64.2 2005" Billy ¯ Reaching the Alienated Heart humanity's alienation from God and about Jesus' role in bringing that alienation to an end. Alienation makes us feel isolated from ourselves, one another, and God. It hinders us on our journey through life and prevents us from becoming the persons we are called to be. Ronald Rolheiser puts it this way: "We are social beings, meant to live in love and intimacy with others. Our nature demands this. When, for whatever reasons, we cannot achieve this and communicate love as we should, then something is missing inside of us--and we feel it! We feel estranged and alienated.''2 To be in hell is to be in a state of complete and utter alienation from God. In such a state, we have lost touch with our-selves and so have become incapable of reaching out in love to anyone. If we are honest, all of us will admit experiencing sometime in our lives this sense of being estranged from and "out of sync" with ourselves, the world around us, and the God who created us. We feel at war with our-selves, divided and incapable of healing the division. Although we are conscious of it in various ways and degrees, this sense of alienation is not a matter of per-sonal choice (although choice can contribute to it), but a part of our existential condition as human beings. What makes matters worse is that we somehow sense that it was not meant to be this way, that something has gone terribly wrong with our human condition and that some-how humanity as a whole bears at least some (if not all) responsibility for it. Making All Things New Christianity is all about how God chose to make things right again by sharing our human condition and overcoming this alienation lurking deep in our hearts. Down through the ages, the church has developed the Review for Religious doctrines of original sin and redemption to explain this universal alienation and reveal the way God has chosen to rectify it. Jesus' descent into hell is intimately tied to these fun-damental Christian doctrines, each of which, like two sides of a coin, cannot exist without the other. Here, too, a distinction must ., - - -- be made between the formulations of these doctrines and the truths they disclose. Like Jesus' descent into hell, these doc-trines allow room for interpretation. The doctrine of original sin affirms that all of humanity has somehow become alienated from God in its collec-tive soul. The doctrine of redemption, in turn, affirms that, for any healing to take place, Jesus entered that realm of alienation and preached the Good News of God's love for each and every human being. When seen in this light, Jesus' descent into hell is the final stage of his redemptive self-emptying. H~ has entered our world, given himself to us completely, to the point of dying for us, and even to the point of telling those who live in complete alienation from the divine that God still loves them. Through the cross Jesus reveals his message of divine compassion, breaks down the resistance of our primal alienation, and offers newness of life to all who would have it. Byzantine iconography illustrates this point very well. When depicting the descent into hell, the artist normally has Jesus standing on the toppled gates of hell with a scroll in one hand and pulling Adam out of a bottom- The word preached by Jesus to those in hell boldly proclaims a new creation made possible by hi! rising from the dead. 64.2 2005 Billy * Reaching the Alienated Heart less pit with the other. Below Adam, angels can be seen locking Satan and his minions in chains that will hold them captive for all eternity. According to the principles of iconography, a scroll typically represents the preach-ing of the word. Since "Adam" in Hebrew means "man," in the universal sense of the term that today many would refer to as "humanity," Jesus' lifting of Adam, the first man, indicates the healing of humanity's primal wounds and its elevation to even great heights through Christ's redeeming grace) The word preached by Jesus to those in hell boldly proclaims a new creation made possible by his rising from the dead. Through his resurrection Jesus, the first fruits of the new humanity, takes fallen humanity by the hand, lifts it out of its primal alienation, and lets it par-ticipate in a union with the divine more intimate than everbefore thought possible. Jesus' descent into hell cannot be properly understood apart from his rising from the dead. It relates to the resurrection as the doctrine of original sin relates to the redemption. They are like two sides of a coin: they cannot exist without each other. Observations The above presentation offers a rethinking of the church's traditional teaching of Jesus' descent into hell. What follows are a number of remarks designed to fill out this interpretation in practical and relevant ways. 1. To begin with, this presentation challenges us to examine our minds and hearts in order to affirm what we truly believe about our faith. The doctrines of Christianity developed over time out of the experience of God's people and must always try to speak to their ongo-ing experience. If they fail to do so, they risk becoming brittle assertions from the past that fail to inspire and give life. The challenge for today's believers is to engage Review for Religious these doctrines in such a way that they continue to speak to their experience while remaining faithful to the insights of our Christian forebears. This presentation of Jesus' descent into hell uses different interpretive lenses to affirm the underlying truths of the traditional teach-ing so that they can be understood among the shifting contours of today's spiritual landscape. 2. A fundamental presupposition of this presentation is that it is possible to draw a distinction between a par-ticular formulation of the Christian faith and the truths it seeks to express. Since the complex relationship between language and meaning are not easy to unravel (if at all), we have urged here that, when seeking a refor-mulation of a doctrine that would be more palatable to contemporary tastes, we proceed strictly on a case-by-case basis. The approach used here for reinterpreting Jesus' descent into hell, for example, would not neces-sarily work in discussions of other creedal statements, especially those with more historically verifiable claims. 3. The distinction between a theological formula and the truth it discloses can be upheld on the basis of the analogy of human language. As with language, the Aposdes' Creed is a complex system of symbols that seeks to convey an intricate web of meaning. While all trans-lations of that meaning from one language to others are themselves interpretations (some better than others), we maintain that translations are not only possible but some-times absolutely required. This claim is all the more true for the church's proclamation of the Gospel, which at one and the same time must remain faithful to the apos-tolic tradition and relevant to the spiritual needs of each generation. 4. The choice of the phrase "alienation from the divine" as the existential equivalent to the Christian doctrine of hell has much in its favor. The term "alienation" is used 64.2 2005 Billy * Reaching the Alienated Heart by many spiritual writers today and, when taken to an extreme, conveys a sense of the intense pain and isolation experienced in a life marked by a total absence of God. The knowledge, moreover, that there are different degrees of alienation (from simple noninclusion to total estrange-ment) brings new insights in the Catholic doctrine of purgatory. If hell is the state of being in which individuals have become so alienated from God that they can no longer open their hearts to God's compassionate love, then pur-gatory represents that state of being where alienated hearts still can be moved to conversion. Seen in this light, the final judgment is not an external ruling exercised by Christ at the end of time, but the simple recognition that per-sons' choices in life have a cumulative effect on their hearts. 5. Finally, Jesus' death on the cross, his descent into hell, and his resurrection from the dead do not bring an end to humanity's existential condition of alienation from the divine, but begin its healing. Jesus' descent into hell was not a single, one-time event, but a continuous engag-ing with humanity's alienation from the divine. Because Jesus' redemptive action occurs both in and out of time, he continues to empty himself for us to this very day by descending into the throes of our alienation from God in order to make of it a new creation. V~at has changed for us as a result of his redemptive action is that, in the midst of this alienation, we can hear a still small voice from deep within our hearts calling us by name and affirming God's compassionate and abounding love for us. That voice is the Spirit, the bond of love between the Father and the Son, who wishes not only to speak but also to dwell within our hearts. Jesus' redemptive action makes it possible for us to live a life in the Spirit. This descent into hell is a stark reminder of what our lives would be like without him. While these observations do not exhaust the insights Review for Religious that this interpretation of Jesus' descent into hell has to offer, they demonstrate that doctrine can be both con-tinuous with the past and relevant to the spiritual sensi-tivities of today's believers. We have seen that this descent can be understood as Jesus' proclamation of the truth of his resurrection even to those who have com-pletely alienated themselves from the divine love. Although God's love for humanity is deep and plen-tiful, Jesus was well aware that not everyone would be ready to accept his message of forgiveness and intimate friendship with the divine. He experienced rejection dur-ing his public ministry and fully expected the same (if not worse) when he journeyed to hell by way of his grue-some and bloody death by crucifixion. This knowledge, however, did not prevent him from proclaiming his trans-forming message of God's love in the realm of the dead. On the contrary, it emboldened him. The point of this essay is that this shadowy realm lies not in some dark, murky Sheol beneath the pillars of the earth, but deep in the human heart. Even today Jesus goes there to proclaim his message and bring an end to humanity's primal alienation from God. Although the message he preaches is a source of vexation to many (hence the well-known phrase "harrowing of hell"), many whose hearts have not been completely hardened will listen to it and be moved to repentance. In the final analysis, Jesus' descent into hell affirms that the Good News is destined to be proclaimed not just to the ends of the earth, but to the heights and depths of reality itself, especially the heights and depths of the human heart. "God is everywhere," as we learned from our penny catechism--even in hell. He is present not only by virtue of keeping things in existence, but also by virtue of his word, the healing message of hope he carries to our fallen and alienated humanity. 127 64.2 2005 Billy ¯ Reaching the Alienated Heart Notes *Catechism of the Catholic Church (Rome: Libreria Editrice Vaticana, 1994), p. 53, §§194 and 196. 2 Ronald Rolheiser, The Restless Heart: Finding Our Spiritual Home in Times of Loneliness (New York: Doubleday, 2004), p. 43. 3 For more on iconography and Jesus' descent into hell, see M. Helen Weier, Festal Icons of the Lord (Collegeville: Liturgical Press, 1977), pp. 41-44. 128 Mother and Son She sits in the half lit room, eyes half closed in prayer. Outside, it is still dark, and all in the house but her are asleep. She looks up as the room fills with light, a new day breaking, the light like none she or anyone else has ever seen. Although it is not whiter than snow, the light of the angel at the tomb, to see it would frighten most. But she, with a light of her own, greater than that of angels, knows she has nothing to fear from this light of purest love. Kevin Bezner Re~ie~ for Religious BONAVENTURE STEFUN Feet First into Resurrection ~ nly with the beginnings of scholasticism in the 1 lth or 12th century was there a careful and sys-tematic distinguishing of sacraments from sacramentals. In 1274 the Council of Lyons (DS 860) listed the church's seven sacraments. In earlier centuries, preach-ers would include various actions in Christian life as grace-giving sacraments/sacramentals, without con-trasting them. One action of Christ commonly followed was his washing of his disciples' feet at the Last Supper. In an age when most travel was by foot, one would think that people would take feet for granted--take them in stride and ignore them. Once people's feet developed calluses, it would seem that they could go on forever with a minimum of care. Paul blithely considered feet to be less majestic parts of the body, even though essen-tial for carrying the faith beyond the mountains. As insignificant as feet would have seemed, people could not forget what the Master had done. One can imagine Peter welcoming visitors to his place of abode with a basin and a towel. Feet took on such an importance that 129 Bonaventure Stefun OFMCap writes this reflective article from St. Augustine Friary; 221-36th Street; Pittsburgh, Pennsylvania 15201. 64.2 2005 Stefun ¯ Feet First into Resurrection washing guests' feet was seen as a kind of sacrament in the church for hundreds of years. Imagine how the concept of a body's importance may have developed in the early church. First came the gru-eling crucifixion and then the gradual realization of res-urrection, both actions involving the Lord's body. What Jesus did in washing the apostles' feet became a way of understanding his res-urrection, for it was a complete and natural demonstration of his incarnation, his embod-ied life on earth. His concern for a lowly part of the human anatomy reminds us that his own mortality came from his human makeup. Disciples could simply follow footsteps into the theology of a Lord who could die and then be raised from the dead. The story began on Easter Sunday. Once the Sabbath restrictions were ended, disconsolate women set out for the tomb where their Master had been quickly buried. These were the women from Galilee who used to accom-pany Jesus and his Twelve. They liked to prepare the lit-tle that he ate and to minister to his various needs, tiny as those needs usually were. This time, with desolate hearts, they wanted to per-form their final service with all their deepest love. They wanted to provide for Jesus' body the anointing that had to be cut short when the Sabbath followed so closely on his dying. Their hearts were filled with love and with an overflowing sorrow, the ambivalent feelings the living experience in taking care of the dead. All those feelings were suddenly turned to alarm as Review for Religious they drew close to the tomb. It was gapingly open, and they could see that it was empty. Immediately they feared desecration or vandalism or strong intimidation on the part of the soldiers or the city's leaders. In their bewil-derment the women turned back to their homes, stum-bling along in stunned silence.lust a short way along their return road, the)~ were jolted to a stop. There was .Jesus, just standing there, not a desecrated corpse but alert and fully alive. He lifted his hand in silent bless-ing and greeting. He had come on purpose, knowing the familiar road they would use. Without hesitation the women knelt in a cluster and embraced his feet. Their prostration was typical enough for their day, more than just a simple bow when paying respect to a beloved teacher. Disciples would kneel to acknowledge how superior the person was who taught them and made sense of life's daily struggles. This time, embracing their Master's feet implied something even greater than deep respect. Jesus himself had embraced his disciples' feet with his hands, washing their feet and drying them with the padded caress of a towel. The women marveled when they heard the Apostles tell the story. Once that ritual of washing feet was completed on the solemn occasion of his last meal with them, Jesus told his disciples to do what he had done, and they told others. This would be a sign that they were.Jesus' disci-ples. The whirlwind events of the next days prevented any development of the new rite of service, but all would have been thinking of his command to wash one another's feet, serve one another, love one another just as Jesus loved each of them. Even the children would have to be part of this new and loving ritual of washing feet. Jesus said plainly that all such service, even to the very least, was really done for him. 131 t~4.2 200~ Stefun * Feet First into Resurrection The Gospel of John On 12:3-7) subtly connects this foot-washing by Jesus with the tearful washing and costly anointing of Jesus' feet by a woman of tarnished reputa-tion in the house of Simon the Pharisee (Lk 7:37-38, Mk 14:3-8, Mt 26:7-12). Judas called the flood of oil a dread-ful extravagance. We all are inclined to thoughts like that, John seems to imply, and perfumed oil belongs on the head, not the feet! It certainly seemed wasteful until Jesus said it was part of the preparation for his burial. Now, on the road returning home, the women real-ized that the pre-burial anointing by one or two women was more important to Jesus than what they were attempting to do by going to his tomb early in the morn-ing. He seemed to accept that anointing of his feet at a Pharisee's interrupted dinner as a special sign, a sign which indicated an intense love and an immense faith. John suggests in his Gospel that the woman, named Mary, was showing the kind of reverence a body deserves that brings God's presence into salvation history. Jesus kept saying that he knew he was about to be executed. He would die and bring about forgiveness of sin, and he would do it through his body. He would put his body into total submission to God, and in dying he would trust the Father to take care of him, including his body, and even his feet. The woman herself seemed to be saying the same thing with her aromatic anointing. The body she anointed would not carry the stench of corruption but rather the fragrance of God's presence. In accepting this service for his burial, Jesus was indicating that he had no fear of physical corruption after death. Psalm 16 had long before assured him of his Father's intervention to keep his body from decay. He needed just to trust his Father, to live by faith as completely as he asked his dis-ciples to do. Review for Religious As the women of Easter Sunday embraced their Lord's feet along a familiar road, they understood the fuller meaning of washing and anointing feet. They con-eluded that every washing was also an anointing, a prepa-ration for his burial. All the daily care for little children and other needy persons was part of his burial, as were all the care and respect shown for the bodies of persons who had died. The very care became the perfume of love and the promise that the Father would be present even when bod-ies succumbed in death. What this woman did in anointing his feet, Jesus said, would be recalled wher-ever he would be remembered and his gospel proclaimed. When he made this remark, it seemed like simple grati-tude on his part, but he was really saying that every dis-ciple of his could help prepare his body for burial. Their daily acts of service to their brothers and sisters would be an anointing with perfumed oil, a symbol of God's presence and a pledge of resurrection, his own first, and then that of all his disciples. It was natural for people in the early church to con-clude that the washing of feet was a kind of sacrament, a sign of the Lord's presence and a channel of grace. Gradually, in the course of centuries, feet became pam-pered by socks and sturdy shoes and comfortable trans-portation and no longer looked forward, upon arriving, to the soothing removal of mud and dust. Not just tramping feet but all parts of a Christian's body took on the role of signifying the body of Christ. Can we, like Jesus, in dying, trust the Father ~to take care of us, including our body, and even our feet ? 133 64.2 2005 Stefun ¯ Feet First into Resurrection Instead of a washing only, at baptismal rites the body would be anointed, as it would also at confirmation and the sacrament of orders. Often a healing anointing would be given to the sick, and the sacrament of healing addressed the greater healing of sin's wounds and the grand hope of sharing in our Lord's risen life. In these latter-day circumstances, the washing of feet has taken on the appearance of an act of penance and humility, a virtuous act, but no longer a sort of sacra-ment like the seven described by the Councils of Lyons, Florence, and Trent. Not just the washing of feet, but all thoughtful care of others used to be understood as a path toward understanding and being involved in Christ's dying and rising. If feet no longer need gentle washing as a matter of kind hospitality, some other service in Jesus' name for a poor child or a travel-worn person on life's journey would keep Jesus' disciples aware day by day of him dying and rising among us, or us dying and rising in him. Questions for Reflection and Discussion Questions for personal reflection and group discussion: 1. How do we understand our Catholic distinction between sacraments and sacramentals? Perhaps we may need to review "Sacramental, in the Catechism of the Catholic Church, Part Two, Chapter Four. 2. We experience the washing of the feet during the Holy Thursday Eucharistic celebration. Have we experienced other sacramental moments during the Eucharist or other Catholic prayer service? Why was this action sacramental for us? Review for Religious JAMES F. KEENAN Framing the Ethical Rights of Priests Lately priests have been writing and signing a variety of statements. For-instance, on 9 December 2002 fifty-eight Boston priests signed a letter calling for the resignation of Cardinal Bernard Law. In a letter of 1 October 2003, priests of Rockville Centre called for a meeting with Bishop William Murphy over "widespread dissatisfaction" with his leadership. The priests of Chicago wrote an open letter to the hierarchy about the tone and content of church leaders' remarks about gay and lesbian persons, a letter subsequently adopted by priests of Rochester (New York) and Boston. Then there Was the let-ter of last August signed by more than 160 priests in Milwaukee calling for a married clergy. Amazing actions inasmuch as many cannot remember during the 1980s or 1990s any other James F. Keenan SJ has written for us twice before, in 1992 and 1996. His address is Theology Department; Boston College; Chestnut Hill, Massachusetts 02467. taking account 135 64.2 2005 Keenan ¯ Framing the Ethical Rights of Priests such letters written by priests. Thus, it seems relevant for a Catholic moral theologian to ask: Do priests have a right to do this? A~dmittedly, in each instance the letters are admoni-tory at most, yet they are concerned with influencing the bishop and/or the bishops' conference. As the priests in Rockville Centre noted in their letter, as "your brother priests., we believe that [we] may have a special role." Do they? Before answering that question, I need to ask three prior questions. First, how much have moral theologians assisted priests? Second, how interested would priests be in the assistance of moral theologians? Third, how appropriate is rights language for speaking about the priesthood? After answering these questions I will pro-pose four specific ethical rights for priests. Question 1: How much have moral theologians assisted priests? The answer to the first question is simple: Not much. Strange as it may seem, priests and bishops rarely receive any professional training from moral theologians. Those who study at seminaries, divinity schools, or schools of theology do not have the type of ethical training that those at other professional schools receive. Students at business, medical, or law schools take ethics courses that address the ethical issues relevant to their particular pro-fession. They are taught the responsibilities and rights specific to their profession: matters of representation, confidentiality, whistle-blowing, client expectations, priv-ileges, promotions, evaluations, conflicts of interest, pro-fessional boundaries, and so forth. This type of ethical training is not found at most seminaries, divinity schools, or schools of theology, even though many students take two, three, or four courses of Review for Religious Christian ethics. Divinity students and seminarians gen-erally do not study the ethical demands, responsibilities, rights, obligations, and privileges specific to their voca-tion. Rather, they study the ethical norms and relevant circumstances regarding the laity's sexual relations and the attendant reproductive issues, the social ethics of governments and businesses, and the medical ethics of physicians and nurses. That is, those in ministry are taught how to govern and make ethically accountable the members of their congregations. But, generally speaking, they are not taught by what ethical reasoning, insights, or norms they should govern themselves ethi-cally. A priest, therefore, knows much, much more about birth control and in-vitro fertilization than he knows about the demands of confidentiality, the principle of subsidiarity, or the right treatment of employees. This same alienation is found in canon-law courses. When seminarians study canon law, they learn more about whether a married couple can get an annulment than the rights and responsibilities incumbent on their own state in life. Ask a priest what he should do if his vicar says to him, "An accusation has been filed against you; I deem it credible; you have two-hours to leave the rectory." Few would know what rights belong to him. But tell him that you want to marry a person who while belonging to another Christian denomination married a person in a non-Christian wedding but subsequently entered that denomination and then they both sought the blessing of a minister (of yet another denomination) and he will be able to explain to you whether and why your intended needs to file for an annulment. Priests learn a lot about how to direct others, but not about what pertains to themselves. That being said, there have been a few recent signs of change. As early as 1996 the moral theologian Richard 64.2 2005 Keenan ¯ Framing the Ethical Rights of Priests Gula wrote his Ethics in Pastoral Ministry (Paulist Press). Gula has spoken around the country about the need to develop such training. The Protestant ethicist Karen Lebacqz has likewise written and spoken extensively on the topic. More recendy, facing the crisis here in Boston, Edward Vacek, Stephen Pope, and Lisa Sowle Cahill have written and spoken in a variety of places about the need for professional ethics in the church. With the Mennonite theologian Joseph Kotva, I edited Practice What You Preach: Virtues, Ethics, and Power in the Lives of Pastoral Ministers and Their Congregations, which con-tained twenty-six essays by Christian ethicists from a dozen denominations reflecting on the need to develop more ethically accountable lives of service and leader-ship. Interestingly, though all the contributors were well-known, most of them had never written on ethical issues internal to church life. In order to help readers get an idea of the scope of issues facing people in ministry, the writers in our col-lection offered ethical guidance for individual church leaders and their communities and dealt with issues such as disillusionment and deference in clerical life, semi-nary admissions policies, candidacy programs, pastoral assignments, staff salaries, liturgical celebrations, and the practices of collegiality and subsidiarity. These initial exercises by moral theologians illustrate, then, just how much work we need to do to assist the clergy in their professional service to the church. But that leads to the second question. Question 2: How interested would the clergy be in moral theologians' assistance? That answer is simple: It all depends on the priest, for there is no consensus among priests about the need of professional ethics. The reason for this is, in part, the Review for Religious differences among them regarding their own under-standing of themselves and of episcopal decision making. The first difference is how they privilege one dimen-sion of their ministerial identity over another. Admittedly, all understand themselves as having the status of ordina-tion and yet being called to service. But they look at that double identity with specific preferences. In a wonderful new book, Evolving Visions of the Priesthood (Liturgical Press, 2003), Dean Hoge and Jacqueline Wenger asked the clergy whether there is a new status or permanent character conferred by ordina- Because status privileges the clergy as liping in a"distinct world, establishing a professional ethics for them Can be especially challenging. tion. When they first asked that question in 1970, only 52 percent of those aged 26-35 said yes, while 88 percent of those aged 56-65 said yes. But now, more than thirty years later, 68 percent of those once young priests now between 56-65 answered yes, while an enormous 95 per-cent of those 26-35 said yes. That is, thirty years ago the younger the priests were, the less inclined they were to be concerned~with the status question; today the younger they are, the more they are so inclined. Because status privileges the clergy as living in a distinct world, establishing a professional ethics for them can be espe-cially challenging. The second difference correlates with the first. Those priests more inclined to understand themselves as ordained and set apart are more comfortable with earlier forms of episcopal decision making, while those more inclined to identifying themselves with their ministerial service are looking for more professional standards. The 139 64.2 2005 Keenan ¯ Framing the Ethical Rights of Priests former tend to look at ecclesial bureaucracy with esteem and are satisfied with their fraternal and paternal expres-sions. Similarly they are comfortable with the way the Roman curia proceeds. Those who prefer service look to the world of the professional where the norms of con-duct are posted and expectations regarding promotions, decision making, and power sharing are public and clear. Thus the way a priest identifies himself also tends to develop into where he looks for standards of authority. We might be surprised by the way these differing tendencies look at canon law. Those who see themselves as having a set status are comfortable with exercises of local episcopal authority and prefer the bishop's admin-istrative or executive judgment to the actual application of the law. The men who want clarity and norms are more likely to want reform of clerical culture, and toward that end they often turn to their professional identity as expressed in canon law. These tendencies play out similarly in the contem-porary problematic of removing priests. Priests who understand themselves as ordained and set apart prefer episcopal exercise of administrative power to resolve matters. Priests who understand themselves primarily as servants favor canonical procedures. These dividing lines are applicable not only to the clergy but to the laity's relationship with the clergy. It ought not to be surprising, then, that the champions of the right of accused priests to receive due process and juridical appeal are more often those who tend to orga-nizations like Voice of the Faithful. One layperson, Catherine Henningsen, frequently addresses VOTF chap-ters and calls the removal of priests without due process "the most underreported aspect of the pedophilic crisis" and labels it "the second wave of abuse on the part of many bishops." She follows step by step the normative Review for Religious procedures that bishops should follow, that the clergy should expect, and that the laity ought to oversee. Her work highlights the natural affinity between VOTF and freestanding priests' organizations like the Boston Priests Forum and New York's Voice of the Ordained, which look to guarantee the rights of accused priests. But other priests--those who are more comfortable with ecclesial administrative judgments--are strong critics of Henningson, seeing her work as opportunistic. A final set of tendencies among priests is how they distinguish the private from the public. Priests inclined to understand themselves primarily as separated from oth-ers usually are less inclined to find relevance in the dis-tinction between the private and the public. Priests inclined to service, professional standards, and canon law give the distinction great weight. These feel that they should have private living quarters and be able to dress as they want on their vacation days. Some also see celibacy as an unnecessary intrusion into their private lives. I propose these rights, then, not to extend the divide, but to offer a context in which priests tending in either direction can discuss them, Moreover, I propose them, not as a manifesto or as a confrontational stance for those priests and laypersons who prefer the more service-ori-ented professional model. Rather, I offer a modest pro-posal to both sides of the aisle, and to those as well who try to bridge those aisles. Hopefully, it may let us find common ground upon which we can find agreement rather than disagreement. Question 3: Is rights language appropriate? The answer here is also simple: Yes. I use the word "rights" not as a canonist does, that is, as a very specific right that the Code of Canon Law recognizes; but rather as what moral theologians and Christian social ethicists 141 64.2 2005 Keenan ¯ Framing the Ethical Rights of Priests mean when we talk of the right to food, or work, or healthcare, that is, as an ethical right. Certainly, I propose these with the hope that they may be' eventually articu-lated into canonical precepts, but I do not claim that they necessarily have canonical force now. Moreover, I do not see rights as some sort of volun-taristic assertions of power over and against others; rather, I see rights language as springing from acom- " Way, b foreright . .language appeared in modern liberal democracies, righis Were fi. dt , trinsic .the,. good munity of faith looking to see how its mem-bers can best protect the good of the whole church and its specific members. Following Brian Tierney (The Idea of Natural Rigbts: Studies on Natural Rights, Natural Law, and Church Law, 11 Y0- 162$), I believe that rights were originally recognized by l lth- and 12th-century theologians and canonists who tried to articulate those that belonged to popes, bishops, the clergy, and other church members, not as inimical to the life of the church, but as constitu-tive of the church. In other words, way before rights lan-guage appeared in modern liberal democracies, rights were first expressed as intrinsic to the good of the church. Finally, as Aristotle taught us, ethics is for the com-munity, and asserting the ethical rights of priests is cer-tainly not at the cost of the community, but rather for its benefit. Thus, to the extent that these rights are not respected, to that extent not only priests but the com-munity of the church, its own very communio, suffer. Book II of the Code of Canon Law outlines the obli- Review for Religious gations and rights of all the Christian faithful (cc. 204- 223). The first set of rights and obligations belongs to the laity (cc. 224-231), and eventually the Code turns to the rights and obligations of the clergy (cc. 273-289). Here we find three canonical rights: of association, to a vaca-tion, and to fitting and decent remuneration. Instead of these three canonical rights, I propose four "ethical" ones: the right of priests to share respectfully in the episcopal ministry of the local ordinary, the right of association, the right to exercise their ministry, and the right to fair treatment. I propose these rights as modes of helping the church to further understand the way priests today should ethically live and serve in the church. The Right to Share Respectfully in the Bishop's Ministry The first right echoes one that was discussed in the revision of the Code of Canon Law, "the right of coop-erating with the bishop in the exercise of his ministry." It is the right being implicitly invoked and exercised by priests in their recent letters to bishops and bishops' conferences. John Lynch, a canon lawyer who has written on the rights of priests, frequently asserts that the "cleric shares in the episcopal ministry." Interestingly, he roots his claim precisely in the first canon in the section on rights and obligations, canon 273: "Clerics are bound by a spe-cial obligation to show reverence and obedience to the supreme pontiff and their own ordinary." Lynch's claim is derived from three Vatican Council II documents. The Decree on the Ministry and Life of Priests (Presbyterorum ordinis, §7) says: "Priestly obedi-ence, inspired through and through by the spirit of coop-eration, is based on that sharing of the episcopal ministry which is conferred on priests by the sacrament of order 64.2 2005 Keenan ¯ Framing the Ethical Rights of Priests and the canonical mission." Similarly, The Bishops' Pastoral Office (Christus Dominus, §28) says: "All priests, whether diocesan or religious, share and exercise with the bishop the one priesthood of Christ." Finally, Lumen gentium §28 declares: "The bishop is to regard his priests, who are his coworkers, as sons and friends, just as Christ called his disciples no longer servants but friends." Interestingly, the special obedience that the cleric owes his bishop is based on his sharing in the episcopal min-istry itself. This ethical right is found not only in the Code, its commentary, and Vatican documents. It is found also in the rite of ordination. The first question the bishop asks the ordinand is: "Are you resolved, with the help of the Holy Spirit, to discharge without fail the office of priest-hood in the presbyteral order as a conscientious fellow worker with the bishops in caring for the Lord's flock?" Then in the prayer of consecration we hear the bishop say: "Lord, grant also to us such fellow workers, for we are weak and our need is greater. Almighty Father, grant to this servant of yours the dignity of the priesthood. Renew within him the Spirit of holiness. As a coworker with the order of bishops, may he be faithful to the min-istry that he receives from you, Lord God, and be to others a model of right conduct." In sum, various foun-dational texts recognize the priest as having a share in the exercise of episcopal authority. For this to be conveyed as a right, I suggest that it would be implied in "respect-ful" sharing. When we hear of priests' repeated unsuccessful attempts to meet with their ordinary, we learn that this right is not adequately recognized. In fact, when we note the phenomenon of public letters written and signed by priests, we ought to see this not so much as an indication of that right being exercised, but rather as expressing frus- Review for Religious tration that the presumed right has been ignored. Priests are "going public" because in many instances the right has been long bypassed. When routinely exercised and recognized, the right would foster community, the life of the diocese, and the credibility of episcopal leadership. The Right of Association The right of sharing in the ministry of the bishop leads to fostering right relations among the clergy through association. Canon 275, ~1, states: "Since cler-ics all work for the same purpose, namely, the building up of the Body of Christ, they are to be united among themselves by a bond of brotherhood and prayer and strive for cooperation among themselves according to the prescripts of particular law." Immediately after this paragraph, the Code adds, "Clerics are to acknowledge and promote the mission which the laity, each for his or her part, exercises in the church and in the world." Thus, associations of clerics have reason not to create separa-tion from laypersons, but rather to promote their involvement. In fact, in an earlier draft of the Code, priests were called to recognize the laity's mission; in the promulgated Code they are called to promote it. Though canon 215 defined the right of all the Christian faithful, both lay and clergy, to form associa-tions, canon 278 establishes it as the first canonical right for priests. The Code reads: "Secular clerics have the right to associate with others to pursue purposes in keep-ing with the clerical state." This is the first time that canon law recognized this ethical right. Moreover, in developing the revised Code, the com-mission rejected a proposal that placed associations of priests under the local ordinary. To do so would be to infringe on the exercise of the very right that was being promulgated. 64.2 2005 Keenan * Framing the Ethical Rights of Priests The Code derives its inspiration from the natural law and from the writings of previous pontiffs. For instance, in his encyclical Pacem in terris (§24), Pope John xxIII upholds the natural right to assemble and says that peo-ple "have also the right to give the societies of which they are members the form they consider most suitable for the aim they have in view." He adds: "It is most necessary that a wide variety of societies or intermediate bodies be established equal to the task of accomplishing what the individual cannot by himself efficiently achieve. These societies., are to be regarded as an indispensable means in safeguarding the dignity and liberty of the human per-son, without harm to his sense of responsibility." Thus from the natural law, our own experience, papal encyclicals, and the Code itself, we recognize the ethical right of priests to form associations. Throughout the United States we have seen in the past few years free-standing priests' associations emerge (the Boston Priests Forum, New York's Voice of the Ordained). This ethical right validates these groups. Their recent initiatives to form local movements are congruent with good thinking within the church. Moreover, these organizations do not replace presbyteral councils, but represent a few of what Pope John xxIII referred to as the "wide varieties" of gatherings necessary for human flourishing. The Right to Exercise Their Ministry While priests have an obligation to exercise their priestly ministry, they also have a right to exercise that ministry according to their particular judgment. Here we can think of pastors, for instance, who must discern whether this particular couple is actually ready to get married in the church. And there are instances where the appropriate place or time for a child's baptism is something that pastors must discern. Review for Religqous The question of the exercise of ministry was raised recently by the Boston Priests Forum regarding preach-ing. They wanted to reflect on what is at stake when the chancery defends a particular value and a pastor won-ders whether he ought to raise in his sermon another possibly competitive value. To what degree is he called to exercise his ministry as expressing his particular voca-tion? In the USCCB document on Sunday homilies Fulfilled in Your Hearing, we find the bishops calling the pastor to listen to the Scriptures and to the congregation and to respond to that listening. Is there something that hap-pens existentially in that listening that could prompt the pastor to hear the needs of the laity of his parish in some other way than what a statement from the chancery may convey? Could there also be times when laypersons believe that something beyond what the chancery has articulated needs to be recognized? And if the cleric, in all this listening, is also obliged "to foster peace and har-mony based on justice" as canon 287 states, could he find himself eventually perceiving an obligation in con-science to respond as a preacher of the Word to the par-ticular congregation he serves? This is not advocacy for rebel priests. Rather it rec-ognizes both the context in which a cleric exercises his ministry and the process by which he comes to articulate the sermon and other forms of ministry. Though by his faculties a priest exercises his ministry at the bishop's pleasure, there seems to be another claim on the priest that comes not from the bishop directly, but from the people whom the priest serves. If the priest is to truly promote peace and justice and communio, it seems that in discerning how to do so he needs to rely on something in addition to the bishops' particular will. Like other expressions of his ministry that he shares with the bishop 147 64.2 200~ Keenan * Framing the Ethical Rights of Priests and with the laity, a priest's preaching calls for a consci-entious integrity to witness to the gospel as he sees it expressed in his midst. The Right to Fair Treatment To appreciate this right we need to turn to the zero-tolerance policy as it appears (§§56-60) in the Report on the Crisis in the Catholic Church in the United States by the National Review Board for the Protection of Children and Young People. There the ten lay authors note that the policy "was deemed necessary because some bishops and religious superiors in their assessment of sexual abuse of minors by priests under their authority badly under-estimated the seriousness of the misconduct and harm to victims, and allowed wrongdoers to continue in posi-tions of ministry, from which they went on to harm oth-ers." They conclude: "To prevent any recurrence of such situations, the charter and essential norms remove any further discretion on the part of bishops and religious superiors in this regard." But what, then, is the net effect on an offending priest? Here the report notes: "Accordingly, the zero-tolerance policy applies without regard to any assess-ment of the degree of culpability of an offending priest based upon such factors as (i) the nature of the sexual act (e.g., the improper touching of a fully clothed teenager versus the sodomization of a child), (ii) the fre-quency of abuse (e.g., an isolated event versus a pro-tracted history), or (iii) efforts to address the problem (e.g., successful treatment of a problem that had led to an act of abuse years ago versus untreated problems that manifested themselves more recently). The policy also applies with equal fbrce to a priest who reports himself as having engaged in an act of abuse in an effort to obtain help with his problem." Review for Religious Fair treatment usually observes some form of due proportionality. And, though the review board acknowl-edges objections from a variety of observers about the fairness and effectiveness of the policy and though they write "the zero-tolerance policy may seem to be too blunt an instrument for universal application," they believe, nonetheless, "that for the immediate future the zero-tolerance policy is essential to the restoration of the trust of the laity in the leadership of the church, provided that it is appropriately applied. In assessing individual cases in order to determine whether the priest engaged in an act of sexual abuse of a minor, the bishops must consult with the diocesan lay review board, so that they may strive for individualized justice in light of their developing experience and expertise." The report's caveat with regard to appropriate pro-cedures and diocesan lay review could serve, then, as a witness to the fair treatment of priests, but that witness needs to be guaranteed by the national review commit-tee as it endorses the zero-tolerance policy. Inasmuch as review boards recognize disparity regarding their role and the application of appropriate procedures, they need to witness to priests' rights as well as to the rights of the laity, especially children. Finally, they acknowledge "that any discussion of the charter's zero-tolerance provision would be incomplete without noting that there is no equivalent policy of zero tolerance for bishops o.r provincials who allowed preda-tor priests to remain in or return to ministry despite knowledge of the risks. In fact, in the minds of some priests, the impression was created that the Dallas char- Fair treatment usually observes some form of due proportionality. 64.2 200~ Keenan ¯ Framing the Ethical Rights of Priests 1501 ter and the essential norms were the bishops' attempt to deflect criticism from themselves and onto individual priests . Priests, who now stand uneasily under a sword of Damocles, with their every action scrutinized, under-standably may ask why the bishops do not face such con-sequences if they fail to abide by the charter. This distinction has deteriorated the relationship between priests and bishop." The report concludes this section stating that the bishops "must show that they are willing to accept responsibility and consequences for poor leadership." Fairness then cuts two ways. Not only ought due pro-portionality emerge somehow in the treatment of accused and offending priests, but priests alone cannot and should not bear the weight of the scandal. If a zero-tolerance policy is applied to priests, where is an analogous policy for the scandalous bishops? The scandal will only come to rest when justice has been served, but an inequitable justice is not justice. The national review board has, then, two more responsibili-ties: They must somehow guarantee that due process and due proportionality are granted to priests, and they must hold proportionally accountable both the offending priests and the offending bishops. I want to conclude on a hopeful note. When we read the report, there is the impression that the writers are talking to two constituencies: the bishops and the laity. Regarding priests, they are more talking about them than talking to them. This has been in large measure a com-mon way that judges, reporters, advocates, and others have proceeded. Everyone tries to engage the bishops in order to talk about priests. I propose these four rights--one about participatory leadership, another about right to associate, a third about ministerial vocation, the fourth about fairness--with the hope that these may further encourage the voice of the Review for Religious clergy. Throughout these recent years, when occasionally, though not at all often enough, priests have addressed either the harm and shame attached to the abuse of chil-dren or the rights of the laity and bishops, they have usually done so in the place that they are called to be: the parish pulpit. I suggest that if priests begin to recognize the rights due them--especially at a time when many find themselves, as the report states, demoralized--they might in turn be more vocal from that pulpit in recog-nizing the rights of others and in fostering the communio that the Church so desperately needs. Healing grace always accompanies restorative justice. My Novitiate When I arrived, I was bankrupt: empty, nicotine-stained, desperate, hungry and broke. I had been robbed by those who loved me. The vault held nothing sacred. The bed you gave me was comfortable. I hardly felt the stretching. You smiled and I hoped. Copper penny joy clinked as it hit the floor and echoed in my soul. One by one, the nickels came. Prayer became my treasure. I grew rich with coins of every size. Celibacy became an asset, obedience, my wealth. Who knew that poverty could h'old so much? Finally that time has come. At profession I ask. "Where now may I spend?" Grace Gallant $SM 64.2 2005' ANNE MUNLEY Faith and Solidarity in Action At the heart of religious life is a conviction that the healing and liberating mission of Jesus is for all times and all peoples. This grand mission, the impe-tus for apostolic energy and service, is succinctly stated in the Gospel of John: "I came that they may have life and have it abundantly" (Jn 10:10). The mission of bear-ing life is common to women religious throughout the world. Though of many cultures, the nearly one million women religious in today's world are of one heart in pas-sionate commitment to bringing to birth God's dream of unity, justice, peace, and abundance of life for all. Brought into existence to support leaders of women's religious congregations and to link congregations in ful-filling their life-giving mission of love and service, the International Union of Superiors General (UISG) holds a plenary session every three years to bring members together in an atmosphere of prayer and support to con- Anne Munley IHM, a member of the Sisters, Servants of the Immaculate Heart of Mary (Scranton, Pennsylvania), is director of Programs and Social Mission at the International Union of Superiors General (UISG); Piazza di Ponte Sant'Angelo 28; 00186 Roma; Italy. Review for Religious sider urgent matters facing religious life and God's peo-ple. In May 2004 almost eight hundred members gath-ered in Rome for five days to reflect on the theme "Women Disciples of Jesus--Bearers of Reconciliation for Our World." This was an apt theme at a time when millions of people in various parts of the world are suf-fering the consequences of war, violence, abuse of power, and divisions of every kind. Before coming to the UISG plenary session, each con-gregational leader was asked to reflect prayerfully on the following scriptural passage: "For anyone who is in Christ, there is a new creation . It is all God's work. It was God who reconciled us to himself, and gave us the work of handing on this reconciliation" (2 Co 5:17- 18). Those planning the session also requested that each participant, bring a symbol that reflected efforts of the sisters of her congregation to enter into God's work of reconciliation in those parts of the world in which the congregation ministers. Since UISG consists of approx-imately thirty-five regional groups called constellations, delegates representing the constellations were similarly requested to bring pertinent symbols. To engage all UISG members in reflection on the theme, the UISG Bulletin (No. 123, 2003, 21-33) pub-lished in five languages an article by Robert Schreiter CPPS tided "A Spirituality of Reconciliation." It explores the biblical basis for a spirituality of reconciliation and suggests five principles that flow from Paul's reflections on reconciliation in 2 Corinthians 5:17-20: (1) Reconciliation is first and foremost the work of God; (2) God's reconciling work begins with the victim; (3) God makes of both victim and wrongdoer a "new creation"; (4) we place our suffering inside the story of the suffer-ing, death, and resurrection of Christ; and (5) full rec-onciliation will happen only when God will be all in all. 64.2 2005 Munley ¯ Faith and Solidarity in Action A strength of the UISG plenary session is that it gathers congregational leaders who have direct experience of religious life and the joys and sufferings of people in all parts of theworld. 1,54 Schreiter speaks of wounds the wounds of victims and of those who would help them as entry points for a spirituality of reconciliation that connects people's sto-ries to the story of Jesus, the "wounded healer." This image speaks to the experience of women religious who, though recognizing their woundedness, persist in efforts to bring about reconciliation because through their faith they are enlivened by God's healing action in their lives. For the God of life nothing is impossible. Hope arises out of confidence in what God will bring forth. A strength of the UISG plenary session is that it gath-ers in one place at one time congregational leaders who have direct expe-rience of religious life and the joys and sufferings of people in all parts of the world. In a multicultural and multilingual meet-ing, prayer, ritual, liturgy, music, dance, and other artistic media are path-ways to mutual understanding and relationship. Explanations of con-gregational and constellation symbols enabled partici-pants to enter into situations in need of reconciliation in other parts of the world and to glimpse the realities of women religious seeking to respond to various circum-stances crying out for healing. It was a humbling expe-rience to hear stories of what being called to be "bearers of reconciliation" means in different parts of the world. Some were stories of steadfast witness in the face of incomprehensible human suffering. Table conversations Review for Religious helped us to understand the stories more intimately, to see into these stories with the "eyes" and "hearts" of oth-ers. Prayer, ritual, and a Power Point presentation of images of people's needs and of sisters' endeavors towards reconciliation and healing provided an enriching pre-lude for further theological development of the theme by Diane Bergant CSA. Working with the biblical accounts of the reconciliation of Jacob and Esau and of Joseph and his brothers, Bergant stressed that it is will-ingness to forgive on the part of the one offended that opens up possibilities for reconciliation and healing of relationships. Participants reflected as well on stories of particular efforts to bring reconciliation to painful situations within the church, society, and religious congregations. These stories were told with eloquent simplicity by three con-gregational leaders. They shared personal experiences of serving in leadership at a time when issues of abuse, life-and-death consequences of ethnic and tribal war-fare, and the need to reconcile long-standing congrega-tional divisions demanded great outpouring of time and energy and unremitting trust in the guidance of the Spirit. Sharing on the part of two congregational leaders from Iraq about the impact of the war on the people among whom their sisters minister evoked poignant response and heartfelt expressions of support and soli-darity. These presentations put flesh on what it means to lead as a "wounded healer." What wove the plenary session, together was a reflec-tion model that moved from sharing experiences (see-ing) to situating reflection in the word of God (judging) to acting on the basis of shared convictions. Throughout the session a writing committee gleaned key ideas and various suggested action steps and fashioned them into a 64.2 200~ Munley ¯ Faith and Solidarity in Action draft version that was brought back and discussed, then further revised, and ultimately approved unanimously in an atmosphere of expectant hope and joy. Here is that approved declaration: Declaration of the International Union of Superior.s General Women Disciples of Jesus Christ: Bearers of Reconciliation in Our World For anyone who is in Christ there is a new creation . It is all God's work. It was God who reconciled us to him-self and gave us the work of handing on this reconcilia-tion. (2 Corinthians Y:17-18) We live in a time of extreme violence, a time when lights of hope and reconciliation are desper-ately needed.We are nearly 800 women leaders from 69 countries and five continents. The International Union of Superiors General repre-sents members of Catholic religious institutes in 98 countries throughout the world. We believe that no more important mission exists at this time than to be bearers of the reconciling hope for which the world cries. Believing that reconciliation is God's desire for the world, we humbly declare our reliance upon God, the source of reconciliation and the source of all healing and forgiveness. We know too that we are not alone as we journey with people of many faiths and traditions who long for a reconciled world. We walk with them in our insecurity, fragility, and need for continuous conversion of heart, recognizing our common desire to make inclusive love and the search for truth the basic principles that govern our lives. As leaders we commit ourselves to work with one another, with the members of our institutes and Review for Religious national conferences of religious by: Living a spirituality of reconciliation. We will witness in community this spirituality of compas-sion, respect, courage, truth, and reconciling hope. Proclaiming publicly our commitment to be bear-ers of reconciliation. We will: ¯ collaborate with other associations for justice, res-olution of conflict, and an end to war in all its forms. ¯ use the media to announce an alternative vision, tell stories of reconciliation, and denounce violence and injustice. ¯ create and promote dialogue, understanding, and reconciliation among peoples, cultures, and reli-gions. ¯ intensify efforts toward healing, reconciliation, and right relationships between women and men. ¯ continue to intensify our efforts, as bearers of rec-onciliation in the world, to eradicate the traffick-ing of women and children. ¯ promote the education and formation of women and girls. ¯ be proactive in peace building and in caring for all creation. We move forward as women religious leaders, disciples of Jesus Christ. We are firm in our belief that, in solidarity with others, our members will collaborate in the Spirit's work of transforming the world. While this 2004 UISG declaration is a Wonderful out-come of the plenary session, an even more precious out-come is the strengthening of the "invisible ties" that bind the women religious of the world together in a spirit of solidarity and collaboration. A poetic prayer by Macrina Wiederkehr suggests an image that pertains not only to 64.2 2005 Munley ¯ Faith and Solidarity in Action the work of the UISG session, but also to the ~uture that is yet to be born: On tiptoe we stand, Lord Jesus ,, eagerly awaiting always expecting you to come some more. Our hands and heart are open to your grace. Our lives are still waiting for the fullness of your presence. We are those who have been promised a kingdom, and we can never forget. Yet we have a foot in both worlds and so we stumble. But we stand on tiptoe, owning our-kingdom-loving hearts and our earth-eyes. We lean forward and hope. (Seasons of Your Heart, 69) Those who had been present left the 2004 UISG ses-sion deeply aware that the women religious of the world are indeed "standing on tiptoe" together. Review for Religiou~ MILLIE CARGAS Women Religious in Treatment for Addictions In early childhood Sister Miriam was sexually assaulted by a family member, a parish assistant, and a neighbor down the road. These malefac-tors never had to answer for their uncon-scionable acts, but Sister Miriam (names have been changed) has paid a high price for them. After many years of competent service in the nursing profession, she was directed to go for treatment of her serious addiction to substance abuse. Sister Miriam is not alone. Many other women religious, with differing stories, have ceased functioning healthily in their ministries and communities. "Women religious" means in this article Catholic women who have taken vows of chastity, poverty, and obedience in one or other religious institute or congregation. Sisters with addictions? Women religious in rehabilitative psychological treatment programs is a difficult concept to accept when typical feel-ings toward sisters are of good, giving, self-sac- Millie Cargas is a registered art therapist (ATR), and her address is 127 Park Avenue; St. Louis, Missouri 63122. 64. 2 200Y Cargas ¯ Women Religious in Treatment for Addictions 160 rificing persons. We remember these valiant women as our teachers, as nurses, parish administrators, and other professional helpers. Often they have been highly respected and admired; people have emulated them. They are capable and articulate persons who have for-saken the materialistic world for the kingdom beyond-- and now they need therapeutic treatment? Yes, for they are human. Like all of us, they need help sometimes. No religious order has escaped the scourge of dys-functions caused by addictive behaviors. The life of Sister Anne had spiraled out of control as her weight climbed to a dangerous three hundred pounds. She could no longer play kickball with eager boys or jump rope with high-spirited girls. During a visit to her internist, Sister Anne was sternly warned of imminent death unless she took immediate steps to reduce the strain on heart and lungs. In response she claimed she had always had a weight problem just as her whole family did; it was not her fault, and nothing could be done. Her intractable anger and alarming obesity, however, limited her physical and professional activities severely and made her a difficult, contrary, and noncontributing member of her community. Sister Anne's uncontrolled addiction to food was not only causing havoc in her pro-fessional life, but was deeply affecting all her relation-ships. Though she did not see the need for treatment, leadership mandated it. This is not always the case. A significant number of other sisters ask for help, realizing, as one said, "I can no longer live this way." Humbled, she admitted her powerlessness. There are various treatment centers in North America. To mention a few: Guest House in Lake Orion, Michigan, and Emmaus Community in Elberon, New Jersey, are for sisters only. Behavioral Medicine Institute and St. Louis Consultation Center, both in St. Louis, Review for Religious Missouri, St. Luke's in Silver Spring, Maryland, Ecclesia Center in Girard, Pennsylvania, and Southdown in Ontario, Canada, are for both men and women religious. Before acceptance into a treatment program, the applicant participates in a series of pretreatment evalu-ations comprising interviews by various staff members, extensive psychological test-ing, and a thorough medical exam. Although therapeutic programs vary, the major components are individual counseling, group sessions, physical activities, spiritual direction, and programs tai-lored to individuals. Sister - - William Mary was a master gardener. Itwas her profes-sion. But gambling was her downfall. Her healthcare facility allowed, her to include gardening in her treat-ment program as long as it contributed to her recovery and was not distracting or distancing her from others. A simple definition of art therapy is using artistic materials in therapy or as therapy. Art Therapy Some treatment curriculums have incorporated art therapy as an effective therapy. This is my area of exper-tise. I have worked with Catholic women and men reli-gious for twenty-five years. I have ~ecently conducted several week-long art-therapy workshops specifically for religious women. A simple definition of art therapy is using artistic materials in therapy or as therapy. For exam-ple, the resident is given a subject and asked to paint or draw images and/or abstract designs. The imagery and other graphic dimensions of art therapy offer a unique way of identifying feelings and expressing oneself. It dif-fers considerably from verbal communication, which can 64.2 2005 Cargas ¯ Wo~nen Religious in Treat~nent for Addictions be insufficient or restricting. A case study illustrates this. Sister Katherine had joined a teaching order even though she was woefully shy and became almost inartic-ulate in group settings. She became the community financial officer. To bolster her much-needed self-con-fidence, she went on shopping sprees that her financial .resources were able to fund. This gave her illusions of power that brought her deeper and deeper into her addiction. This irresponsible money management landed her in therapy, Because she had no experience in art, Sister Katherine felt great risk at getting into it. She did so only reluctantly and even ~belligerently. But, to her great surprise and indeed pleasure, she discovered that her images had a way of speaking and engaging others that her hesitant words and extravagant spending had not. This was real progress for her. Understandably, people fear getting into something new. They fear to make mistakes, to expose their lack of artistic ability. They bring up such familiar objections as "I can't draw a straight line" and "I'm no artist" and "I haven't done art since grade school" as they fight the fears of appearing awkward and becoming embarrassed. Finding a new way of expressing oneself in colors, shapes, and designs in either representational or abstract imagery takes courage. Once they get over their fears, their endeavors are often richly rewarded. Some women revealed skills that they were unaware they had. Others had allowed their artistic talent to lie dormant for far too long. But in art therapy, whether or not the persons are artistically skilled, they eventually welcome the opportunity to go beyond words. An art-therapy badge at one convention appropriately declared, "When words are not enough!" The women in the workshops often relish their wordless therapy once they have worked through their initial resist~ince to art therapy or, more Revie~ for Religious commonly, their anger at finding themselves in treat-ment in the first place. Art Therapy Described The actual week-long art-therapy workshops are all group oriented. After a brief introduction I define the type of art which will be used in the workshop. I stress that artistic talent, no matter how people understand it, is less important than each one's own innate creativity and willingness to plunge into the activity. In these cir-cumstances there is no right or wrong way to do art. I emphasize that one cannot make mistakes, and I advise the group to ignore their own all-too-dominating inner critics. I repeatedly state throughout the week that the process is as important as the product, if not more so. Each session begins with a particular focus. Sometimes I hand out a picture, a poem, or a brief essay to assist creativity, and I always have some music played to support the theme. At age seventy-five Sister Jeanne just knew she was not going to like this mandatory part of her treatment program. But, being a prayerful per-son, she would listen to the proposed topics with her eyes closed, allow the music to seep in, and pray to the Holy Spirit for help. And helpful imagery did appear to her receptive mind and soul. She allowed her initial resis-tance to bow out gracefully and opened herself to lis-tening, ready to entertain new possibilities. Sister Jeanne was a pharmacist, and her issue was addiction to pur-loined prescription medicines. Now, if she could open herself up to some new and different perceptions and experiences, perhaps she could also consider trying alter-native ways of alleviating the pain of her arthritic con-dition. The broad themes of art therapy range from fun and pleasure to themes that are darker and more threatening. 64.2 2005 Cargas * Women Religious in Treatment for Addictions The artistic creations take on a life of their own. Sister Ren~, from Germany, had been sexually abused at a very early age. Paradoxically, she had never actually accepted the art-therapy discipline and yet always com-pleted the assignments--though without enthusiasm. Her colleagues, however, were astonished by her pow-erful imagery done in blacks and grays and blurred opaques. Even though she "resisted" art therapy, she was illuminating, minimally but really, the darkness of her horrendous experiences. Participants are free to work with the broad theme that has been proposed or to select just a small aspect of it to explore more intensively. The themes are vast and varied. Here are just a few that have proved provocative and success-ful: journey, relationships, aging, play, transforma-tion of issues, sexuality, ambiguities, emotions, self-worth, self-identity, joys, anxieties, mixed messages, and change. The "journey" theme can be depicted in any number of ways, including the classic one of marking each milestone in life. Or highlights of success or failure might be featured. Or perhaps the sisters emphasize the eternal goal of their journey. When they have completed their art pieces, each sis-ter presents hers to the group for comments and reac-tions, but specifically not for analysis. The meaning of her work is primarily for her to determine, not those who have not lived her experiences--although the oth-ers' reactions, questions, and support may bring her to deeper insights or different revelations than she origi-nally had in mind. Sister Jude, an elementary teacher with addictions to both food and alcohol, created many figures of herself. Although she was fifty-five years old, Review for Religious they all looked like little girls. She was startled when this was pointed out, but now she was in a position to acknowledge such a "disconnect" in other therapies if she so wished. At the end of the week, each person displays her total body of work to the group. There is always amazement that so much could be done in a short time, that so many issues could be covered in some depth in just a week. As Sister Norine finished presenting all of her works, she said she felt empty, completely drained. She had exhausted her psychic energy. Others in the group read-ily realized that they had similar feelings. Summing Up The art belongs to its creator. Each person does what-ever she wishes with it. Many use a particular piece in their ongoing counseling as it illustrates or illuminates a specific issue. Sister Irene's picture of her attempted sui-cide was more frightening than her bland emotionless oral description. Some pictures have deservedly been framed. Others have been shown with pride or for disclosure to trusted empathetic friends. Others have been destroyed for reasons only to be surmised. No one seems to have been untouched by the week's experiences, which brought forth a myriad of emotions, memories, and hopes. The artistic creations take on a life of their own. They give graphic evidence of people's psychic state and are more permanent than spoken words. They lend themselves to further explorations as the client grows in self-knowledge. They reveal aspects that perhaps were not noted on first viewing. During one workshop the spiritual director asked the group to bring their art on spirituality to the group session the following week. She was impressed by the images created with regard to such a profound and elusive subject. Spirituality is the bedrock 64.2 2005 Cargus * Women Religious in Treatment for Addictions for religious women, and so their attempts to capture it in art are as challenging as they are moving. It is exhilarating to observe artistry and creativity emerge while clients are learning to trust and appreciate their own endeavors. Those who never considered them-selves artistic are often amazed and delighted with their creative results. They have not become "more" artistic, but they have gone beyond their own all-too-limited per-ceptions of their creative abilities. Art has a transformative effect through its ability to transcend time, space, and earthly boundaries. The clients just described have taken risks in telling the group their own sacred stories with the help of original art that enlightens their listeners but most importantly them-selves. One treatment center director told me about being confronted by a new group of residents .upset by the announcement that the regular week's schedule was suspended and that art therapy would replace it. She told them she could not adequately explain why art therapy works or what its therapeutic benefits are, but promised it would work. The group would understand art's bene-fit more clearly and convincingly later. And they did. Creativity is healing. To call forth new possibilities-- a definition of creativity--is to find new directions toward healthier lifestyles. To create new views, rather than remain stuck in old destructive patterns, is some-thing that art can offer. The overeater can picture a thin-ner body; the alcoholic can picture a cornucopia of renewal; the burnt-out person can picture a serene land-scape; and the spendthrift can visualize a pleasing bal-ance and proportion. Art therapy cannot guarantee change, of course, but it can offer graphic glimpses of hope, and hope is a'forerunner to change. It is important to appreciate that these previously functioning women who have gone into treatment have Review for Religious been given and are taking time out for themselves, per-haps for the first time. In a lifetime of giving to others, they are now receiving. Such a respite from their ordi-nary busyness allows them to tell their stories and to explore their concerns by means of art, and art can enlarge and deepen their creative potential. The art-therapy experience encourages people to leave the abyss of addictive behavior behind and try something new. Homemade imagery can reinvigorate deadened or tired emotions and bring joy back into their lives and their spiritual selves. Accepting and working with their cre-ativity assists wounded souls to move from humiliation to humbleness and towards the kingdom where we are all meant to dwell. Easter Monday Morning Prayer 0 God of my forever rising who alone can slip twixt bones and sinews probing the marrow of my being to the dark recesses of my heart wherein by my sin you have been entombed, carving away the stone, I beg you, up-raise me this day with you again and always and forever. Alleluia. Amen. Elizabeth McDonough OP 64.2 200~ VILMA SEELAUS Asceticism and Chaste Celibate Love T biblical understanding of God is captured in ee words: God is love. Created as we are in the image and likeness of God, the core of our being is a "being-in-love" with God.1 Because of our radical con-nection with God, we are conceived and born into the world as preconscious predispositions for love. As Rahner puts it, "man is the event of God's absolute self-com-munication.'' 2 Love therefore is the root and foundation of our being. Life's deepest challenge is to fully accept and give human expression to this foundational reality of love. The vow we call consecrated chastity, or chaste celibacy, has everything to do with love. By it we open ourselves to becoming fully loving persons. Chaste love is love that is single-hearted. Single-hearted love does not of itself exclude a genital expres-sion. Chaste loving is the universal call that includes both married persons and persons who remain single. In mar- Vilma Seelaus OCD last wrote for us in September-October 1999. Her address is Carmelite Monastery; 25 Watson Avenue; Barrington, Rhode Island 02806. Review for Religious riage, love is meant to have a genital expression. The religious vow is not only of chaste love, but also of chaste celibacy intended as a total response to God's uncondi-tional love. The single-hearted love to which religious vow themselves is at the heart of the kind of loving to which we are all invited as human beings. As consecrated celibates we vow to live out in a chaste celibate way the love relationship with God, and with one another, to which all persons are invited.3 Fidelity in chaste celibate loving has its own unique call for asceticism; celibate love must include asceticism. Celibacy for God means that one has a desire to receive God's love and to become passionately in love with God, expressing it in the vow of chaste celibacy. Today we increasingly recognize what the mystics have known for centuries: that, in our universe and in the heart of every human l~erson, there is an energy which as Christians we know to be God's creating love in all that exists. St. Teresa of Avila in her Sixth Dwelling Places describes a remarkable vision in which she sees all things in God. In this vision, "God is like an immense and beautiful dwelling or palace, and this palace is God himself." Teresa now sees all things as taking place in God and therefore in Love. All human love is either an expres-sion or a distortion of this one love, namely, God's unconditional love embracing and encircling the human family. Teresa writes: Could the sinner, perhaps, so as to engage in his evil deeds leave this palace? No, certainly not; rather, within the palace itself, that is, within God himself, the abominations, indecent actions, and evil deeds committed by us sinners take place . The greatest evil of the world is that God, our Creator, suffers so many evil things from his creatures within his very self and that we sometimes resent a word said in our absence and perhaps with no evil intention.4 [16.9 64.2 2005 Seelaus * Asceticism and Chaste Celibate Lo~e How true isoit that even self-centered, narcissistic love contains within itself in a diffused, distorted way the energies ' of divine°iove? 170 Our life unfolds in God! Postmodern Christian ecolog-ical theologians see this reality as the basis of God's rad-ical immanence in the world and as the human challenge to respect and care for the ecological systems of our planet earth, symbolized as the body of God.5 Chaste loving extends itself to loving care of the world in which we live, which, in one of his less-known poems, John of the Cross images as the palace created by God for "all the members of the just," who are "the body of the bride" of the eter-nal Word.6 In viewing all of human love within the ambience of God's creat-ing energy of love, we see how out of harmony is the so-called "sexual revolu-tion," which seeks sexual pleasure apart from genuine love between persons. Yet even self-centered, narcissistic love contains within itself in a diffused, distorted way the energies of divine love. The human urgency for union with God, who alone can offer unconditional love, easily finds expression in dif-fused and distorted ways when God's love is unrecog-nized or rejected. Aware of this reality, Jesus had and has great compassion for all of us, who in ways small or great live love's distortions. Asceticism enlarges the heart to receive a greater out-pouring of God's love. It also allows the energies of divine love to flow more freely through us into the lives of others. This asceticism is a matter of self-denial and self-emptying.7 What we deny ourselves and allow God to empty out are the things within us or around us that we tend to hold on to tenaciously. The purpose of asceti- Review for Religious cism is freedom for self-surrender, not self-punishment, not the giving up of things out of self-hate. Rather, gen-uine asceticism springs from a desire to be rooted in love. It is an expression of our willingness for our love to be freed of its distortions. The asceticism that leads to self-surrender can be sustained only in prayerful com-munion with God and is itself a form of prayer. Self-sur-render softens the soil of our inner being so that stubborn willfulness may more easily be uprooted by God, leaving room for God to plant seeds of willing-ness. 8 These are seeds of the Christ-life. Frans JozefVan Beeck, the Dutch theologian, in an early work of his titled Christ Proclaimed, points out that Jesus "was with-out the need for anxious self-possession, self-mainte-nance, and self-affirmation." Jesus was content to receive his being in a stance of total surrender to his Father.9 To love is to love someone--other persons as well as God. Self-denial can be psychologically harmful and even sinful outside of the context of our relationship with other people and with God. There is, however, some-thing in our being that clings to aloneness, to private and even narcissistic self-possession, distorting the inner solitude of our uniqueness. This distortion, the denial of relatedness, is sin. Sin would have us cling to our sep-arateness as something absolute. This is an ontological illusion, but it nevertheless lures us to rest on its com-forting bosom in the hope of avoiding the pain that comes with reaching out in love. Relatedness can be painful, as we discover early. Although other persons reflect our uniqueness and help us discover our gifts and potential, they also mirror our inadequacies. As we struggle with the demands of friend-ship and human encounter, that relatedness undermines personal myths of omnipotence and reveals our finitude. The insecurity of finitude is hard to accept, and, just as 7171 64.2 200~ Seelaus * Asceticism and Chaste Celibate Love 172 others willy-nilly make demands of us, we place all kinds of expectations on ourselves to be all-knowing and all-capable, to be fully adequate to every situation. Amid these usually unconscious self-expectations, the gifts and talents of others threaten us, so we turn them off or become defensive. Insofar as we are out of touch with these inner movements, enW, jealousy, and competi-tiveness keep us outside of the unifying energies of God's love that flow between people. The opposite can also happen. Self-doubt can so overwhelm us that we give up trying. The gentle vigilance of self-knowledge is an excel-lent form of asceticism. Self-knowledge keeps us in touch with the polluting elements that can be present in love's stream. Self-knowledge looks squarely at emotional and attitudinal dams that cause love's flow to stagnate.1° It strengthens us to bear the pain of our failures as we struggle to learn new patterns of behavior more expres-sive of love. The asceticism of self-knowledge necessar-ily opens us to a deeper understanding of God in our life. God is compassionate, unconditional love; God accepts us just as we are. Imperfection is normative to our finitude. For us to be perfect is to accept the reality of our imperfection. God's only expectation seems to be that we surrender to God's Trinitarian love and that we ourselves become passionate lovers. Fasting is a very traditional and helpful form of asceticism. As self-punishment it is harmful; nevertheless, fasting can be sincere worship. It can express genuine love toward God, who is father, mother, beloved, and friend, the source of all we have and are. The stomach's empty feeling reminds us that we are a hunger for God, who alone can fill our emptiness. Fasting can be an expression of praise and adoration of the One in whom we live and move and have our being. Jesus, alive in his Review for Religious Spirit worshiping in us, becomes more than a desire; he fills our emptiness with his own praise of his Father. Like the young Carmelite Blessed Elizabeth of the Trinity, we too are destined to be a "praise of His Glory." Fasting is a form of worship; it is also a form of the prayer of petition. Our finitude has many needs. We eas-ily come to the limits of our human potential, especially in the realm of love and relat-edness. Times exist when a , relationship reaches an impasse or when persons dear to us seem stuck in self-destructive tendencies, or are struggling with seemingly impossible sit-uations. Our fasting for them can be a hidden silent petition that God nourish the loved one to newness of life. Fasting can also be a prayer for the gift of detachment from the things we cling to in anxious self-possession and which keep us from self-surrender. Asceticism therefore can take many forms. It is cru-cial to the critical moments when a committed celibate is being tempted along a path whose ending would inevitably be genital intimacy. Here one is faced with the asceticism of choice. One. needs to set appropriate boundaries to love's expression while still fostering warmth and caring in the relationship. Fidelity to love is always a paschal experience. The asceticism of choice, in this instance the appropriate channeling of love's warmth, can be painful. But it is pain that is life-giving. Unlike the repression of feelings, which imprisons the self in the turmoil of unacknowledged emotions, the asceticism of choice is an encounter with greater inner freedom and is a call to growth in love. One's pain How would I explain that fasting is a form of worship and also a form of the prayer of petition ? 64.2 200Y Seelaus ¯ Asceticism and Cbaste Celibate Love becomes redemptive not only for oneself and the loved person, but for others as well, because it springs from genuine love and is a true love response. Because love is the creating energy that sustains the universe, and its energies flow through all of'humankind, it is necessarily the very heart of the church. Therefore any decision that one makes out of love and with the intent of fostering love has apostolic value. It shares in the life-giving, redemptive mission of Christ. This real-ity is worth pondering. It broadens one's understanding of the apostolate and of the meaning of mission for con-secrated celibates. We participate in God's creating action through the choices we make, and in doing so we inevitably affect the lives of others. Decisions drawn from the deep well of love enter into love's stream flowing from the womb of God, the source of life, the one life that flows through all of humankind. Even the smallest of our decisions is like the proverbial pebble thrown into the water whose ripples expand in ever widening circles. Here I am reminded of an experience in my own life that becomes increasingly meaningful. My monastery in Rhode Island is located on Narragansett Bay. Occasionally I take an early morning walk along the beach to enjoy the sunrise reflecting itself across the water. One such morning the bay was unusually calm. As I walked along I heard a sudden strong swish of incoming surf. This usually announces the changing of the tide, but the waters of the last high tide had not yet fully ebbed out. I turned and scanned the bay. In the far distance a tiny craft was speeding across the water, split-ting its quiet surface and leaving behind rolling waves of water. As the craft disappeared between the islands, the waters returned .to their previous unruffled state. The swish at my feet settled to a calm. I have experienced this phenomenon many times, Review for Religious and it never ceases to amaze me that the movements of such a small craft, hardly visible in the distance, can affect such a large expanse of water even to a distant shore. This symbolizes for me the awesome reality that the choices we make, no matter how small, are not insignif-icant. Humanity is bonded in a common stream of con-sciousness and love; the movements of one person, toward life or toward diminishment, necessarily affect the whole. Asceticism in its many forms is a prayerful desire that not only our activity but also our entire being may be apostolic, that is, life-giving for others. It fos-ters human solidarity as an enduring reality, by creating a fleer channeling of divine life through the collective body of humankind.12 Notes 1 See Bernard Lonergan, Method in Theology (New York: Seabury Press, 1972), p. 105. 2 Karl Rahner, Foundations of Christian Faith (New York: Seabury Press, 1978), p. 126. 3 This paper was first written in the 1970s. Since then, much of great value has been written regarding the vows. In this recent minor revi-sion, no attempt was made to connect with the fine work of recent authors. 4 In terior Castle, VI. 10.2- 3. Collected Works of St. Teresa ofAvila, Vol. 2, trans. Otilio Rodriguez OCD and Kieran Kavanaugh OCD (Washington, D.C.: ICS Publications, 1980), p. 419. s See Life Abundant: Rethinking Theology and Economy for a Planet in Peril by Sallie McFague (Minneapolis: Fortress Press, 2001), pp. 138ff. See also the writings of Thomas Berry and Brian Swimme. 6 Romances, nos. 3-6, "On Creation," in The Collected Works of St. John of the Cross, trans. Kieran Kavanaugh OCD and Otilio Rodriguez OCD (Washington, D.C.: ICS Publications, 1991), pp. 62ff. [See especially no. 4, pp. 63-64. Ed.] 7 See Vilma Seelaus OCD, Self-Emptying: Philippians 2 and the Carmelite Tradition (Washington D.C.: ICS [Audio] Publications, 2004). 8 See Gerald May MD, Will and Spirit: A Contemplative Psychology (San Francisco: Harper and Row, 1982). 64.2 200Y Seelaus * Asceticism and Chaste Celibate Love 9 Frans Jozef Van Beeck sJ, Christ Proclaimed (New York: Paulist Press, 1979), p. 421. ,0 For a further development of the value of self-knowledge, see Vilma Seelaus OCD, "Effective Ministry through Contemplative Self- Knowledge," Review for Religious 41 (May-June 1982): 390-399. " See Elizabeth of the Trinity, The Complete Works (Washington, D.C.: ICS Publications, 1984). ~2 The asceticism of chaste celibate love has yet a deeper dimension, which is the asceticism of prayer, especially contemplative prayer. To remain faithful to love and to prayer during the painful times of dark night and the seeming void of love would be a topic in itself. See Hein Blommestijn, Jos Huls, and Kees Waaijman, The Footprints of Love: John of the Cross as Guide in the Wilderness, trans. John Vriend (Leuven [Bondgenontenlaan, 153; B-3000 Leuven; Belgium]: Peeters, 2000). Prayer Psalm 73 Let the words of the psalm help you pray: Yet with you I shall always be; you have hold of my right hand; With your counsel you guide me, and in the end you will receive me in glory. Whom else have I in heaven? And when I am with you, the earth delights me not. Though my flesh and my heart waste away, God is the rock of my heart and my portion forever. But, for me, to be near God is my good; to make the Lord God my refuge. I shall declare all your works in the gates of the daughter of Zion. Revie~v for Religious ROBBER E MALONEY Snapshots of Three Lesser-Known "Saints" In 1918 the historian Lytton Strachey said in the preface of his Eminent Victorians that in writ-ing history less is often more. In other words, true selectivity is more important than volume. He wrote: "It is not by the direct method of scrupulous narration that the explorer of the past can hope to depict a singular epoch [or per-son]. If he is wise, he will adopt a subtler strat-egy. He will row out over the great ocean of material and lower down into it, here and there, a little bucket, which will bring to the light of day some characteristic specimen . . . to be examined with a careful curiosity." Surely few events say more about pex~sons than their death. Death not only closes life, it defines it. Christians have always regarded mar-tyrdom as the preeminent form of the follow-ing of Christ. From the earliest time, martyrs captured the Christian imagination and inspired Robert E Maloney CM, the former superior general of the Congregation of the Mission (Vincentians), continues to live at Via dei Capasso, 30; 00164 Roma, Italy. 64.2 2005 Maloney ¯ Snapshots of Three Lesser-Known "Saints" 1781 others to incredible heroism in living the Gospels even to the end. The Book of Revelation sings the praise of these heroes: "Love for life did not deter them from death" (12:11). Some, of course, renounce their faith rather than die a martyr's death. But for others, some-times even people whose lives seemed mediocre, death is their finest hour. In Shakespeare's Macbeth (I,iv), Malcolm says of the previous thane of Cawdor: "Nothing in his life / became him like the leaving it; he died / as one that had been studied in his death / to throw away the dear-est thing he ow'd / as 'twere a careless trifle." In this brief article, I offer a snapshots of the deaths of three lesser-known martyrs who in turbulent times were like a "lamp shining in a dark place" (2 P 1:19). Joseph Chow Tsi-Che Did you ever want to be pope? I have sometimes heard Catholics say, with a bit of humor and a bit of frus-tration: "If I were pope for a week, here is what I would do!" Of course, very few of us get that opportunity. But a priest of my own community, whom some of my older friends knew, was actually offered the job. Joseph Chow was born in 1891 in Shijiazhuang, about 180 miles south of Beijing. He made his vows in the Congregation of the Mission in 1915 and was ordained to the priesthood four years later. After serving as a pro-fessor in the minor seminary in his hometown and then as a philosophy professor in the major seminary of Beijing, he was ordained a bishop in 1931, serving ini-tially as the vicar apostolic in Baoding, not far from his birthplace. In 1946 he was named the archbishop of Nanchang, much farther to the south, a city I visited a number of years ago, where his memory is still revered. In 1950, soon after the establishment of the revolu-tionary government in China, Joseph received the invi- Review for Religious tation to become pope. A delegation from Beijing came to visit him. A writer of the time describes their con-versation as follows: "Because you have so many gifts, you have been des-ignated to be the head of the Progressive Chinese Church. Are you willing to become the pope of China?" "Do you really believe that I have the necessary qualities?" "We do." "In that case, I would prefer to become the pope of the entire world." The delegation left, angry at his refusal. From then on, he was kept under constant surveillance. In May 1951 he was arrested, tried, found guilty, and thrown into prison. The charges against him were that he had opposed the reform of the church, that he had listened to the Voice of America, and that he had recruited members for the Legion of Mary. He was condemned to forced labor, toiling in isol'ation for twenty-two Joseph Chow renounced a very prestigious offer: to be the pope of China. ConSequently, he endured a slow, arduous, hidden martyrdom. years. Just before his death he was released, so that he would not die in prison, and was carried to the home of a Christian in Nanchang. There he went peacefully to the Lord. By all accounts Joseph Chow was an extraordinarily gifted man. Those who knew him attest that he was good-humored, quite funny at times, but very clear in what he believed. He surely knew what he was willing 179 64.2 2005 Maloney ¯ Snapshots of Tbree Lesser-Known "Saints" to die for. He renounced a very prestigious offer: to be the pope of China. Consequently, he endured a slow, arduous, hidden martyrdom. In the end the government, by freeing him from prison several days before his death, tried to deprive him of the title of martyr, but Catholics in China today recognize that he was precisely that. 180 Jean Le Vacher I doubt that Jean Le Vacher will ever be beatified, even though the cause for his beatification was actually introduced in 1923. Jean was born in Val-d'Oise, France, on 15 March 1619 and entered the seminary along with his brother Philippe on 5 October 1643. He was ordained a priest in 1647 and went to Tunis almost immediately. Within a year after his arrival, the superior of the mission there died, as did the French government's representative in Tunis. Jean, at the age of twenty-nine, was named both head of the mission and French consul, a combi-nation of jobs which seems strange to us today. Two years later he also became vicar apostolic. Twenty-five years later, history repeated itself in Jean's life. Having been named vicar apostolic of both Algeria and Tunis, he again became the French consul, this time in Algeria. That is the root of the problems surrounding his beatification. On the one hand, Jean was a remarkably zealous missionary, laboring for years among the slaves in the capital, whom he estimated to number about fifteen thousand. But he was also the con-sul, a difficult political post at a time when relations between France and Algeria were steadily worsening. In late June 1683, fighting broke out. The French fleet began to bombard the capital. At the same time a plague raged within the city. The Turkish forces in Algeria asked Le Vacher to mediate peace. He, two Turkish diplomats, and an interpreter arrived under a Review for Religious white flag at the French admiral's ship. As negotiations dragged on, Admiral Duquesne was inflexible and at one point yelled at Le Vacher: "You,re more a Turk than a Christian!" During the negotiations one of the Turkish diplomats deceived the French, promising to work with them to reinstate their control over Algeria. But, once back on land, he himself seized power and began to fire on the fleet again. When the French retaliated, Le Vacher was arrested, along with the few other French citizens who remained in the capital. Le Vacher's martyrdom took place on 16 July 1683, toward sunset, on a small pier in the port. He was asked to renounce his faith and declare himself a Muslim. Instead, he bade farewell to the Christian slaves in a loud clear voice and exhorted them to remain firm in their faith. He was tied to a wooden frame which was then attached to the mouth of a cannon. Then a little drama occurred which it is affecting to recall in the midst of all the strife in the Middle East and North Africa today. None of the Muslims in the crowd was willing to light the cannon's fuse. Many Jews were there, but they too were unwilling. Finally a renegade Christian lit the fuse. Le Vacher was blown to pieces. Ten other Frenchmen followed him to the same type of death. The French campaign was ultimately unsuccessful; a shortage of supplies forced Admiral Duquesne to return home. Because of Jean Le Vacher's political post, some have questioned whether he was really a martyr. Reading the accounts of his death, I have little doubt myself. He died professing his faith courageously and encouraging others to profess it too. In fact, many followed him to death. Marguerite Rutan Marguerite Rutan was born in Metz in 1736. There, at the age of twenty, she began her postulancy in a hos- 181 64.2 200Y Maloney ¯ Snapshots of Three Lesser-Known "Saints" 182 pital as a Daughter of Charity. A year later, on her birth-day, she entered the novitiate in Paris and just five months afterwards was sent to serve at a hospital in Pau. She had the happiness of seeing her two sisters enter the same community shortly after her and the sadness of seeing both of them die at a young age. From Pau she moved to several other hospitals, finally arriving in Dax, near the border of Spain, where in 1779 she was named superior. Ten years later, with the outbreak of the French rev-olution, life became increasingly difficult for the sisters. Resources for the running of the hospital were scarce. The government provided fewer and fewer funds. After 3 October 1793 all sisters employed in running hospitals and schools had to choose between taking the oath of allegiance to the state church or leaving the institutions where they served. Sister Marguerite and her companions refused the oath. From then on they were constantly under surveillance, but their services in the hospital were so needed that they were allowed to continue. Finally, however, on 24 December 1793, Marguerite was arrested on charges of "corrupting the revolutionary, republican spirit of the soldiers who went to this hospital." What had happened, in fact, was that a group of sol-diers, to express gratitude for the care given in the hos-pital, returned to do some songs for the sisters. Sister Marguerite stopped to listen to them, offered them refreshments, and gave them some money. That was her crime. She was taken to a prison at the nearby Carmelite house. At the beginning of March 1794, a guillotine was constructed in the central ~quare of Dax. Simultaneously most prisoners were transferred to another city, but Marguerite was left in the Carmelite prison, a sign that her fate had already been decided. After a brief trial, her name was placed upon the list of those to be guillotined. A commission arrived in Dax Review for Religious to review the cases of those facing capital punishment. On 9 April after a quick hearing in which the same charges were repeated, Marguerite was condemned to death. The sentence was to be carried out immediately. She and the local cur~, also condemned, were tied back to back, placed on a cart with soldiers surrounding them, and rushed to the execution place accompanied by the sound of tambourines. Having first witnessed the behead-ing of the cur~, Marguerite asked the executioner not to assist her and mounted the scaffold by herself, removed the shawl from around her shoulders, put her head on the guillotine, and was executed. In their accounts of Marguerite's death, all observers noted her dignity. She seems to have been undaunted by the prospect of death, wearing those around her gently while speaking her mind clearly and unflinchingly right to the end. Tertullian tells us that "the blood of Christians is seed" (Apology 50.13). The martyrs strengthen those who come after them. They demonstrate that some things are worth dying for. By their witness they proclaim that fidelity to one's central commitments is more important than life itself. In the darkness of persecutions or of oppressive regimes, martyrs are like flashes of lightning that illumi-nate the nighttime sky, a surge of electricity that ener-gizes those who live on beyond them. The church has been blessed by many such martyrs right up to the present. This great "cloud of witnesses" (Heb 12:1) strengthens us to be faithful, no matter what the cost. 183 64.2 2005 JULIANA DEVOY Learning to Live Serenely: The Wisdom of Francis de Sales 184, Ewvery day in the Eucharistic liturgy we pray the ords "Protect us from all anxiety." The daily repetition of this invocation is not without meaning. We have only to open the newspaper or turn on the evening news to find plenty of material for angst. After 9/11 and its consequences, not only individuals but whole nations are experiencing increased anxiety. But it is not only the world scene that disturbs us. We witness divisions in the church, breakdowns of family life, loved ones' illnesses, financial reversals, and many other problems that threaten our peace of heart. Undue worry, anxiety, and agitation not only are detrimental to our psychological well-being, but also impede our spiritual growth. A spiritual guide who can teach us serenity and Christian optimism no matter what happens in the world is St. Francis de Sales (1567-1622), bishop and doctor of the church, a man with a wonderfully balanced and integrated personality, who combined a deep spirituality Juliana Devoy RGS last wrote for us in May-June 1999. Her address remains Good Shepherd Sisters; 30 Estrada da Vitoria; Macao. with a penetrating insight into human psychology. Separated from him by a cultural, theological, and linguistic gulf of four centuries, we nevertheless find in his published works and in his letters of spiritual direction gems of wisdom which, if we take the trouble to extract them, will both counsel and console us on our spiritual journey. In this essay we will examine several points of Salesian spirituality that can aid us in gracious living and tranquillity of spirit. Befriending Reality In his Introduction to the Devout Life, Francis says that, aside from sin, anxiety is the greatest evil that can happen to us. "It proceeds," he says, "from an inordinate desire to be freed from a present evil or to acquire a hoped-for good. Yet there is nothing that tends more to increase evil and prevent enjoyment of good than to be disturbed and anxious.''~ In one of his colorful images, he likens anxiety to birds caught in a net: the more they flap their wings trying to escape, the more they become entangled. Francis knew well what he was talking about. As a nineteen-year-old student in Paris, he had undergone a spiritual crisis over predestination, asking himself whether it was possible for him to be separated from God for all eternity. The moral and spiritual anguish that he suffered was so great that he fell ill and could not sleep or eat. The crisis was resolved only when he abandoned himself unconditionally to God's love, praying for the grace to love God here and now if he could not love God in eternity.2 Francis emerged from his persOnal "dark night" with two profound convictions about reality: his radical dependence on God and God's utter trustworthiness. In the Salesian worldview, creation is suffused with God's goodness and our peace is found in conformity to 64.2 2005 Devoy ¯ Learning to Live Serenely ~DO we live ,the truth, that every vocation is the lo~cus fo~" meeting God andeve~ Christian is called to a life of holiness,? -°186 God's will because God is a GodJbr us. Our particular life circumstances are where we will find God. Francis, therefore, counsels a loving acceptance of the situation in ¯ . which we find ourselves. His Introduction was written especially for lay people who desired to live in closer intimacy with God. Predating Vatican Council II by hundreds of years, he taught that every vocation is the locus for meeting God and that every Christian is called to a life of holiness. But the way to holiness would be different for everyone because the practice of devotion must "be adapted to the strength, activities, and duties of each particular person." A bishop is not called to live like a Carthusian, nor a skilled workman to spend his day in church like a religious. There is no need to emulate the lifestyle or the virtues proper to a vocation that is not one's own. His letters of direction illustrate this teaching in practice: I should like you to consider how many saints, both men and women, have lived in the married state like you, and that they all accepted this vocation readily and gladly. We must love all that God loves, and he loves our vocation; so let us love it too and not waste our energy hankering after a different sort of life, but get on with our own job. Know that God wishes nothing else of you save what he sends at the moment, and do not be on the lookout for other things . What is the use of building castles in Spain when you have to live in France? What a marvelous thing you said when you wrote to me: as long as I am serving God I don't care what kind of sauce he puts me in . Come now, you Review for Religious know very well into what sauce he has put you, into what state of life and condition; and, tell me, is it all the same to you?3 But it would be a mistake to imagine that what is being advocated is a passive acceptance of the status quo. In his Treatise on the Love of God, Francis devotes a large section to "The Will of God.''4 He distinguishes between God's signified will and the will of God's good pleasure. Although obviously God has only one will, our discernment of what God wants of us will have to take account of two different sets of realities. In the first case we are guided by the commandments, the counsels, teachings of the church, and holy inspirations. When there is question of something clearly ordained by God, there is nothing to discern; we have only to obey. For choosing a vocation, however, or choosing one action rather than another, Francis counsels a great liberty of spirit since it is impossible to know God's will absolutely. In important matters we should pray, consult a spiritual director, and then do what we think is best. Even if doubts arise afterwards about whether we chose well, we should remain in peace and continue on the course we have chosen. In lesser matters we should "do freely what seems good to us, so as not to weary our minds, waste our time, and put ourselves in danger of disquiet, scruples, and superstition." The "will of God's good pleasure" is God's will already done. It is the actual circumstances of our lives, the "sauce in which God has placed us," the events that take place and the things that exist outside our control. It is not that God causes everything that happens, but that "whatever is, is in some way within God's providence; it is not outside the loving embrace of the creative and redempt

Issue 58.5 of the Review for Religious, September/October 1999. ; f'o r reli i , C~stian Heritages and Contempora~ Living SEPTEMBER-OCTOBER1999 ¯ VOLUME58 ~°~NUMBER5 Review for Religious is a forum for shared r(flection on the lived experience of all who find that the church's rich heritages of spirituality support their personal and apostolic Christian lives. Tbe articles in tbe journal are meant to be informative, practical, historical, or inspirational, written from a theological or spiritual or ~ometimes canonical point of view. Review for Religious (ISSN 0034-639X) is published hi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: foppema@slu.edu Manuscripts, books for review, and correspondence with the editor: Review for Religious ° 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP P.O. Box 29260; Washington, D.C. 20017 POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ¯ Duluth, MN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back c~)ver for information on subscription rates. ©1999 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. for religious Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming SJ Clare Boehmer ASC Philip C. Fischer SJ Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm James and Joan Felling Kathryn Richards FSP Joel Rippinger OSB Bishop Carlos A. Sevilla SJ David Werthmann CSSR Patricia Wittberg SC Christian Heritages and Contemporary Living SEPTEMBER-OCTOBER'1999 ¯ VOLUME58 ¯ NUMBER5 contents 454 perspectives The Self in Postmodern Thought: A Carmelite Response Vilma Seelaus OCD places the biblical God-related understanding of the. self, on which the Carmelite tradition rests, in conversation with the postmodern self. 470 The "World" from Anthony of Egypt to Vatican II Frederick E. Crowe SJ examines some major transitions in the Christian attitude toward the world, especially as a new context for the meaning of consecrated life. 490 brothers "Come Closer. I Am Your Brother": Being and Doing Brotherhood Joel Giallanza CSC reflects on the very identity of the religious vocation of "brother" as providing both brothers themselves and the church with a rich and prophetic spirituality. Religious Brothers: One Vocation Director's Perspective Paul Bednarczyk CSC shares his reflections on why fewer people are choosing to be brothers and on some possible countermeasures. Review for Religious 5OO journeying On Promise Making, Leave-Taking, and Becoming Avis Clendenen brings together personal experience and psychological and theological insight in addressing the reality of making and breaking commitments. 515 Charism and Membership: Surpassing the Institutional Limits of Religious Life Deborah M. Cerullo SSND proposes that emphasis on becoming grounded in the charism through a common novitiate experience would create a better synthesis of diverse ways of being members. 524 associates Identity, Purpose, Organization: Ongoing Associate Programs Rose McDermott SSJ presents a brief historical overview of associates and associations joined to religious institutes, reviews church legislation, and then raises issues about sound future development. 537 Similarity and Uniqueness in the Association Experience: Theological Reflection Roberta Archibald SSJ, Joanne Bauer SBS, Mary Mester RSM, and Jean Ustasiewski OSF share their experience of using theological reflection in a regional gathering of associates and sisters. departments 452 Prisms 546 Canonical Counsel: Impediments to Admission 552 Book Reviews September-October 1999 prisms Thy kingdom come The words kingdom and reign sound off-putting to most Americans. We have little tra-dition of kings and queens. What we have of it stems from a relatively brief past of early colonizers looking back to European roots. But when we Christians pray the Lord's prayer, we find ourselves begging God--the one we address by Jesus' word Father--that "your king-dom will come." By Jesus' teaching us a way to pray as he prays, we seem to be using language that pictures God as ruler or king and God's area of influence as a kingdom. What do we mean when we pray "Thy kingdom come"? Perhaps we can gain some cl,arity by identifying first what we do not mean. Kingdom is not to be identi-fied with any political entity. Even the age-old notion of Christendom was not tl~e same as this kingdom, and so the breakup of Christendom was not a dissolution of the kingdom. Kingdom is not a certain physical locale. The Roman Catholic Church as an institutional structure is not identified with the kingdom. The church has an important role to play in the kingdom, but it is not the kingdom itself. The church continues the mission of Jesus in proclaiming the kingdom. The church is at the service of the kingdom; it is meant to be a sign, a sacrament of its presence. The kingdom is not something that we human beings fashion or build. We may sing some songs about Review for Religious our "building the kingdom of God," but there is no reality to be done corresponding to our words. According to the gospel imper-ative, we seek first the kingdom of God. We want what God wants. We desire to be totally available to God, ready to serve, eager to do God's will. Doing the will of God involves discipleship--hear-ing the call of Jesus and responding with the total gift of self. Doing the will of God makes the kingdom present, because we are busy about what God is busy about, and so we are where God is. Above all, as our petition teaches us, we pray for the coming of the kingdom since it is God's doing, it is God's work. Jesus himself never gives a definition of kingdom, and we may be surprised that no one seems to question him. In the synoptic Gospels, he never claims the kingdom as his; it always is identified with the one he calls Abba. Only through parables do we find Jesus giving some description of the kingdom. Our Christian Eucharist anticipates the frequent parable allusions to the eating and drink-ing at the Lord's table in the kingdom. For in every Eucharist we place ourselves with Jesus in his total availability to God as he prays "not my will, but yours be done." So what are we to say about the kingdom? How are we to make this petition our own every time we pray the Our Father? The kingdom is the inbreaking presence of God to our human world and our responsive relating to God's being with us. God continues to pour out divine life--what we name as grace--and, when human cooperation is present, then the kingdom is right at hand. Just as the disciples experienced the transfiguration of Jesus, so too the kingdom is often experienced by our touching into this transfiguration kind of moment of a deeper-down reality shining out through our ordinary world. As we enter into this jubilee year, not through the alarms of some millenarians, but rather through the gospel introduction of Jesus, we hear anew Jesus' call to conversion and repentance, his admonition of obedience and watchfulness, and his appeal to be ready and waiting. We are like members of a wedding party--joy-ful, expectant. But it is no bride or groom whom we serve and cel-ebrate. It is our triune God--shining out as the redemptive presence of the Father in Jesus through the power of their Spirit of love. What do we want for ourselves and for our world? "Thy Kingdom come." David L. Fleming sJ September-October 1999 perspectives VILMA SEELAUS The Self in Postmodern Thought: A Carmelite Response This article was conceived at the end of the Carmelite Seminar of 1997 at St. Mary's College in South Bend. I had an opportunity to browse in the Notre Dame book-store, and two titles in different sections waved for my attention. The first was The Thought of the Heart and the Soul of the World, in which Jungian author James Hillman takes archetypal psychology in a new direction. He claims that, with the soul of the world sick as evidenced by violence and corruption, individuals become sick at heart and suffer heart attacks. To restore the heart's courage and its imaginative power, therefore, the soul of the world needs the same attention that we have been giving to the soul of individual persons. Situating the individual self within the heart of the world challenges the rugged individualism of the modern self.1 The other book that caught my attention was Anthony Thiselton's Interpreting God and the Postmodern Self, in which he offers a hermeneutic of selfhood. Thiselton compares and assesses both modern and post-modern interpretations of the self in relation to Christian Vilma Seelaus OCD made this presentation in June 1998 at the Carmelite Seminar at St. Mary's College in South Bend, Indiana. It is being published also on audio- and videocas-sette by ICS Publications and the Carmelite Institute. Her address is Carmelite Monastery; Barrington, Rhode Island 02806. Review for Religious theology. Postmodern interpretations, he acknowledges, perceive the self as trapped within a network of role performances imposed on it by the power interests of others, but he argues for a deeper understanding of the self and its destiny. Postmodernism de-cen-ters the self; it denies any permanent, integrated reality to the self. It claims that identity is socially constructed and that people in different kinds of societies have quite different identity-forming experiences. Thiselton accepts the force of this, but argues for a deeper understanding of the self in relation to the biblical vision of reality and Christian theology.2 Reading Hillman and Thiselton enticed me into further study of postmodern thought in relation to the self. Before long, the complexity of the topic had my head spinning) Furthermore, post-modern debates about the very nature of reality challenged beliefs that shape my life as a Carmelite. And yet, the more perplexed I became, the more firmly did an inner conviction stand its ground: that our Carmelite mystical tradition has perennial values and insights for our postmodern world and perhaps for many worlds yet to come. In these reflections, therefore, I place the biblical God-related understanding of the self, on which the Carmelite tradition rests, in conversation with the postmodern self. I do this in two parts. Part One brings together important insights from both the mod-ern and the postmodern movements, showing a shift in under-standing the self. Part Two looks into the writings of Teresa of Avila and John of the Cross for what they offer by way of chal-lenge, expansion, or depth in regard to the self and in regard to our own spiritual journey.as we enter the new millennium. Part One Walter Truett Anderson's insightful and witty book titled: Reality Isn't What It Used to Be helped me to realize that the self in particular is not what it used to be. What did the self use to be that it no longer is? What are the shifts in self-understanding, which, for better or for worse, postmodernism names for us? How might we as Christians respond appropriately to the challenge of post-modernism? First, what do we mean by postmodern? Postmoderns claim to have superseded, to have gone beyond, previous ways of thinking, feeling, and behaving which developed in the so-called modern September-October 1999 Seelaus ¯ The Self in Postmodern Thought period. It deconstructs them, to use the "in" term. At the same time, postmodernism is far from a developed, coherent social theory. Scholars dispute whether or not it is a form of radical modernism or something distinctive after modernism, or some of each. According to Philip Endean in his foreword to an issue of The Way dedicated to postmodernism and spirituality: As the structure of the word implies, the postmodern cannot be understood for what it is in itself, but only in terms of what has preceded it: the postmodern is a gamut of reac-tions to the modern, swinging between two moods: a mood of disillusionment, as previously unquestioned assumptions and standards are found wanting, and a mood of exhilara-tion, as new and better alternatives are explored, develop&d, and advocated. Postmodern thinking draws on a wide range of sources: from cybernetics to feminism, from literary the-ory to the new physics, from cultural history to psychoanal-ysis and linguistics. Perhaps for this reason its expression can be, notoriously, opaque.4 Although the philosopher Kant back in the 18th century.paved the way, the 1960s are considered the true beginning of the post-modern era. At that time everything came into question, and all belief systems, with their traditional values, came under attack. People in the '60s began to question what they called the myth of objective consciousness: that, when you looked at things, what you saw and described was what was actually there. (At the scene of an accident, eyewitnesses often give conflicting accounts of what happened.) Today constructivists hold that the "real world" is an ever changing social creation. In the 1960s, thoughts about the self were also changing. As Anderson points out: In the '60s, people assumed that, if you developed enough contempt for your old socially adapted self, a new True Self, unsullied by any conformity, would magically appear, that a True Culture and a True Politics likewise stood in the wings--and that when they appeared they would not have to coexist with old selves, old cultures, old politics. Things didn't work that way!6 Though the '60s were the time of eruption, postmodernism con-tinues and radicalizes trends that actually began during the Enlightenment, at the dawn of what philosophers call the "mod-ern period." Descartes (1596-1650), the classical modern philoso-pher of clear and distinct ideas, attempted to provide clear and Revieva for Religious certain criteria against which our knowledge can be tested for truth. He was also intensely preoccupied with the subject who knows these ideas: the knowing person. For today's radical deconstructionists, like Derrida, such Cartesian objectivity is anathema. Derrida holds all reality to be socially constructed. Reality is simply the interpretation of the perceiving subject. Derrida insists that we cannot grasp reality because it slips by before we can catch hold of it. Everything, then, is interpreta-tion. Nevertheless, Derrida and the other decon-structionists are in a way Descartes's descendants. Descartes understands the self as an active agent, whereas for Derrida the self shifts from active agent to passive situatedness. Instead of a core something (called selJ) determining how it will respond to different situations, the situation cre-ates the self. Different situations call forth a dif-ferent self to be expressed.7 On the whole, postmoderns recognize the importance, for its time, of the modern move-ment. It brought new values to the fore. We ben-efit from the knowledge that scientific objectivity makes possible. From it come the many techno-logical wonders that are integral to our everyday life. In the moral and political spheres, modernity made room for personal autonomy and liberty and for the development of a liberal society wherein diversity is possible. Religion, too, has been enriched by modernity. Most Jewish and Christian believers, for example, no longer subscribe to a literal understanding of the Bible's story of creation in six days.8 But the improvements of modernity have a dark side: the exploitation of nature and its resources, the emergence of indi-vidualism and the consequent collapse of the sense of community, the divorce of technology from moral values, and denials of the worth of ethnic, tribal, and religious traditions. While the modern period gave us universal abstract systems and scientific "metanar-ratives," accounts of the origins and development of the universe, these often denied the existence of God or denied that God could ¯ be discovered by the conscious self. As a result, in today's world many lives are governed by efficiency, profit, success, and the will Modernity made room for personal autonomy and liberty and for the development of a liberal society wherein diversity is possible. September-October 1999 Seelaus ¯ The Self in Postmodern Thought to power without regard for ultimate human values. Talk of love, truthfulness, belief, loyalty, and so forth has little meaning. Further, advanced technology, the offspring of the modern period, has introduced a world of ceaseless change. New models quickly replace the old. Things are made not to endure, but to be consumed and replaced. Think of how quickly appliances need replacement or upgrading. Indeed, today we struggle with both the benefits and the dark side of the modern period. As science enabled the modern self more and more to carve out and control its own destiny, the self tended to be assured and opti-mistic. But today, as postmodern thinkers become increasingly aware of the self's arrogant, power-hungry dark side, the self appears to be, in fact, de-centered--no longer an active agent, but instead taking its identity from the variable roles imposed upon it by society and by its own inner drives and conflicts, conflicts which the communications media keep in constant motion. The media, especially the advertising world, tell it who it should be, how it should look, what it should own, and where it needs to travel in order to feel good about itself. Postmoderns see our opinions formed for us by the collective perceptions of the media. Under such conditions, notions of a true self give way to the self as wear-ing different masks to suit the occasion, with little sense of a solid identity underneath. We tend to become who we think others want us to be. In theory, the will of the individual is still supreme, but often it has no strong center, no belief system to serve as anchor. When everything is up for grabs, the self lacks the support of collective meaning. There is too much to choose from; this can leave indi-viduals feeling alone in a sea of options. Many people today feel estranged from others and even from themselves. When people see no value to their lives other than the imperatives of efficiency, success, or serving the power interests of others, when their "real-ity" depends on what the TV screen says is real, no wonder there are high r~ites of suicide and physician-assisted death. Veronica Brady, in an article in The Way, describes it well: "Caught in this ceaseless flow of images, the self almost ceases to exist, breaking into fragments, identifying only with the flow. Right and wrong become a matter of personal taste, depending not so much on what is done but who does it. The center does not hold because there is no center.''9 A character in Salman Rushdie's Satanic Verses says: "Information got abolished sometime in the Review for Religious twentieth century, can't say just when, stands to reason, that's part of the information that got., abolished. Since then we've been living in a fairy-story . Everything happens by magic. [We] haven't a. notion what's going on. So how do we know if it's right or wrong? We don't even know what it is.'''° Rushdie's world of illusion hangs within the "actual" world of extremes of rich and poor, with millions dying of starvation as nations invest billions of dollars in developing new and deadlier weapons that are then sold to warring ethnic and tribal groups intent on destroying each other. In this context the theories of deconstructionists like Derrida and Lyotard begin to make sense. The absurdity of human confidence in its power to rule the world is becoming more and more apparent as the products of the human mind threaten to destroy us. At the same time, on the positive side, the modern period highlighted one of the deepest urges of the human heart: to be someone. The drift of cultural change is in the direction of human rights, of wanting everyone to be free to create personal identity and experience, even though, for many in our world, resources are not available. No wonder people become dishonest--seeking to have and be and do what the TV ads say they should have and be and do. The struggle to be someone is now a global struggle. Some years ago I had occasion to live in Israel for three months. The incongruities of the struggle became vivid for me when I saw, above Bedouin tents in the desert, TV antennas con-necting them with the modern/postmodern world. As Walter Truett Anderson puts it: "Every morning billions of pairs of eyes open, and billions of societies of mind set forth on the adventures of selfhood. For many the adventure only rarely rises above the level of a struggle to keep the body alive, but even the most mis-erable among us also hear the aspirations of the self---the 'me' craving reassurance that it exists and is good and the modern me that pursues happiness and believes that, whatever happiness it finds, will be what it has taken or created and not what has been handed down by fate.''~ To add a further dimension, the global struggle to be someone is seen with fresh and deep insight by postmodern psychologists who have been influenced by Buddhism. Psychologists Robert Rosenbaum and John Dyckman hold with Buddhism that self/oth-ers are empty. This does not mean that they are void; it means they have no existence other than in relationships that are con- Septentber-October 1999 Seelaus ¯ The Self in Postmodern Thought World and self mutually influence and create one another. stantly arising in the immediate experience of the moment. To say that the self is empty means that the self is not a thing and there-fore has no unchanging core characteristics or essence. It is a way of indicating that self is always completely connected to its imme-diate experience, that in the immediacy of the moment, uncon-strained by past residue or future expectations, self is always free. As the Buddhist Diamond Sutra notes, the past is gone, the future is not here, and the present cannot be grasped. This is perfect freedom.12 As the authors point out, freedom here is not to be confused with a pseudofreedom that seeks to abandon all constraints. Instead, to understand emptiness as being connected to immedi-ate experience can lead to greater generosity and compassion toward the self and others. Past experience no longer has the last word. The empty self, actualized in immediate expe-rience, binds together apparent opposites: the dynamic interchange of oneness and separate-ness. These are not mutually exclusive. The empty self is the connected self which is actu-alized in context and in relationships. Observation reveals self-identity to be fluid and constantly changing according to context and relationships. As the Rosenbaum-Dyckman article puts it, "At work we may be decisive and authoritative; when out to dinner with our spouse, we may be hesitant and deferent about what to order for dinner. Yet we believe ourselves to be the same person.°13 Postmodern psychologists repeatedly make the point that our person is not encapsulated by our skin, but exists in relation. The self is always self in relation, in action, and as such is always con-textual. They hold that emotions are always a reliving in the pre-sent rather than a recall from the dead past. If we do not need to be attached to an unchanging self, and can see change as the only constant, it becomes somewhat easier to image change in prob-lem behaviors24 Although the self may be fluid and constantly changing, it must nevertheless have a boundary, but, according to Rosenbaum and Dyckman, a boundary with infinite length enclosing a finite, definable area, different from the rigid boundaries of lines on a map. Human boundaries are not abstract, conceptual schemas, but are always embodied in constant interaction with a world from Review for Religious which they are not separate. World and self mutually influence and create one another. Such mutual influencing has the potential to stretch present definable boundaries and give glimpses into the infinite. Here the parable of the Pharisee and the Publican comes to mind. If our attitude is one of self-righteousness that places us over against the rest of the world, we will be unable to hear the challenges that postmodern psychologists offer us for continued growth in our postmodern world. Our boundaries become sealed in finitude, and the infinite capacity that is ours becomes rigid, like the lines of a map. Psychologists in increasing numbers address the postmodern shift in regard to the self, and they offer valuable insights for living healthily in today's changing world. At the same time, postmodern philosophers and psychologists do not have the last word, and so now we turn to the mystics for their insights into the self. Part Two Since human boundaries are not abstract, but are embodied and are in constant interaction with the world from which they are not separate, precisely here does the biblically based Carmelite tradition offer timeless help. Back in 16th-century Spain, Teresa of Avila wrote a book to help her daughters of the reformed Carmel relate to one another and to the world, from which they were not separate even in their cloister. In her Way of Perfection, she gives her daughters some advice that flows with meaning into our post-modern age: "I shall enlarge on only three things., for it is very important that we understand how much the practice of these three things helps us to possess inwardly and outwardly the peace our Lord recommended so highly to us. The first of these is love for one another; the second is detachment from all created things; the third is true humility, which, even though I speak of it last, is the main practice and embraces all the others.''~s Many centuries separate us from Teresa and the particularity of her issues, but the interrelated dynamic of love, detachment, and humility are integral to spiritual growth in today's confusing world. Postmodernity challenges much of what we cling to by way of values and beliefs and, in particular, our self-understanding. To understand the self as fluid and constantly changing invites a deeper penetration into the Christian, Carmelite Understanding of Septentber-October 1999 Seelaus ¯ The Self in Postmodern Thought detachment. It would have us be attached to nothing, not even the most innocent of things, for in time of need they fail us com-pletely. John of the Cross insists: "To come to the knowledge you have not, you must go by a way in which you know not. To come to the possession you' have not, you must go by a way in which you possess not. To come to be what you are not, you must go by a way in which you are not . This places us in our center of humility.''16 Detachment and humility go hand in hand. They cre-ate an openness to new ideas, a willingness to let go of the past an, d let the context of the present create us anew. The contextual pre-sent is the place of encounter with God. The past, while it may continue to influence present behavior, is in fact nonexistent, and the future evolves out of each passing moment. Detachment opens up roads less traveled; but, if we feel attached to our current road, we may all too readily say, "This is me; this is my self." We have heard people say, "I'm a one on the enneagram or an INFP on the Myers-Briggs, so you have to take me as I am." With such a self-fixated attitude, we will less likely hear God's invitation into the infinite realms of potential self-realization. If we conceive of the self as determined by the pathways already taken, a composite of past experiences, it will be hard to let go when unknown paths beckon us onward. As Rosenbaum and Dyckman put it, "The self, as an accumulation of experience, is a prison; the self as empty, as shimmering potentiality, is a prism that, depending on its positioning, gives forth many different colors."17 In his Spiritual Canticle, John of the Cross reminds us that the woods and thicket in which we find ourselves today have been planted by the hand of the Beloved.18 God's self revelation con-tinues right within the human story. The density and darkness of postmodernity--which holds that there is a multiplicity of per-spectives in the search for truth, which denies a stable foundation of self and of knowledge--can generate extremes of uncertainty. But the de-centered self of postmodernity has its own gift to offer. It invites us, beyond the limits of what can be known and con-trolled, into a self that is mystery, into God as ultimate Mystery. The temptation is either to stay blinded in self-righteous cling-ing to the limitations of human knowledge, or to despair before the uncertainties of life. Detachment itself can be the void of despair, unless it is grounded in faith and in the experience of God. The Dutch theologian Frans Jozef van Beeck, in his contem-porary. Catholic systematic-theology series titled God Encountered, Review for Religious reminds us that "the human subject., is naturally and radically 'de-centered': the mature person's true center does not repose in the person. Authentic persons live on the strength of unfulfillable desire . Grace graciously enables human persons, along with their world, to that most natural, yet most divine of all things: freely to move toward God in total faith and abandon."'gIn the midst of alternative versions of reality, and many different ways of being in the world, with the postmodern tolerance for a plethora of possibilities, choosing to believe in something is vital. We can be respectful of others with differing beliefs and still stand firm in the faith that is ours, a faith that centers the self in God. According to the philosopher Kierkegaard, faith is the pas-sionate embrace of objective uncertainty.2° Faith bypasses the postmodern self that interprets, even cre-ates, its own reality. It bypasses human reason to plunge us into mystical depths where being and nonbeing are held in cre-ative tension by God's abiding presence to human life. At this level Rahner rightly speaks of the experience of God and the experience of self as one.2' In his insis-tence upon the possibility open to all of an immediate experience of God, Rahner writes: "I am convinced that such an immediacy between God and the human person., is of greater significance today than ever before. All the societal supports of religion are collapsing and dying out in this secularized and pluralistic society. If, nonetheless, there is to be real Christian spirituality, .it cannot be kept alive and healthy by external helps, not even those which the church offers., but only through an ulti-mate, immediate encounter ofthe individual with God.''22 The Harvard psychologist Charles Verge names this place of encounter "the divine self.''23 Here the self and God mirror each other.24 The longing of the human heart to be someone issues from God, in whose image we are made and whose love holds us in being. "Beloved of God" defines the self. The Spiritual Canticle of John of the Cross is a text that writes the self of each one of us. In the Canticle, God's passionate love for the soul, enfleshed in Christ, The longing of the human heart to be someone issues from God, in whose image we are made and whose love holds us in being. Septentber-October 1999 Seelaus ¯ The Self in Postmodern Thought stirs a passionate response and gives meaning and direction to life right within the extremes of uncertainty that surround us. To be transformed into the image of Christ, to become like Christ, con-stitutes the heart of the divine promise. Faith enables us to embrace, with passion, the ultimate objec-tive uncertainty that the mystery of God revealed in Christ is. Christ lifts the self out of its predefined situatedness with its self-interest, into love for God and love for others. God's love trans-forms the will to power, to possession, to lust, into will to love. The detachment that faith calls forth issues in genuine love even for those who differ from us. Postmodernism stretches our capacity to love. Life today beckons toward a global embrace of love; love for those who may look different from us, love for those who may think differently from us, and love for those whose values may be different, even opposed to ours. Today, in the face of our differences, love holds the special challenge of intense, respectful listening, which can only happen if the heart is humble. A humble heart is a heart detached from pre-conceived ideas and personal prejudice. According to Teresa, humil-ity is truth, and our truth is that we are all, without exception, finite, fragile creatures capable of sin and that as such we always stand on the threshold of ongoing conversion. At the same time, integral to truth is that each one of us is always infinitely loved and possessed by God. Insofar as we fall short, God invites us to continued conversion and, even more, to divine transformation. Our challenge is to live Christ's gospel of love. Such love dissolves the disharmony of suspicion and distrust, it detaches us from self-interest, and it opens us to others in humility and genuine con-cern. As Rahner sagely asks, "Why should there be any need for deception, which serves to protect the self, if the self is loved, wel-comed, accepted, and reconciled-as-one with the Other?''2s Receiving the self from God in Christ, giving the self to others in love, and serving the other's interests as one's own are mirrorings of God, the divine self-giving Trinity, in whose image we are. In trinitarian theology, love constitutes the ground of selfhood. The gospel account of Jesus at table, encircled by the outcasts of his time, symbolizes the self today cast out from itself and in need of re-centering in Christ. From the horizon of Christ, we see the incompleteness of all that is human in relation to our total commitment to Christ, but in Christ we also see ourselves con-nected with the heart of all that is. Revie~v for Religious The archetypal psychology of James Hillman invites us to this from a psychological perspective. He would have us see ourselves and others as intimately connected with what he calls the soul of the world. Today conversion extends to claiming our part in what Hillman rightly names the sickness of the soul of the world. He claims that the world, because of its breakdown, is entering a new moment of consciousness by having its attention drawn to itself by means of its symptoms. It is becoming aware of itself as a psychic reality. We now encounter pathology in the psyche of politics and medicine, of language and design, of the food we eat. Sickness, says Hillman, is now "out there" as well as "in here.''26 To situate our individual self within the heart of the world not only challenges the rugged individualism of the modern self; it also invites a deeper awareness of our connectedness with others and with planet Earth, whose beauty and balance are today oppressed by our violent consumer world. The world itself is now a patient in need of hea~ling. Postmodernism offers a broader understanding of the redeeming mission of Christ. The entire cos-mos becomes the locus of redemption. Like us, our church and civilization and even planet are all in need of Christ's redeeming, healing, transforming love. Postmodernism is globalism; as such it is the half-discovered truth of the one unity that transcends all our differences. The language of postmodernism would be alien to Teresa, and yet, as she increasingly experienced herself as centered in God, her self became increasingly fluid. She seems astonished as the boundaries of the self continue to expand. There are many exam-pies, but in her Autobiography, her Vida (chap. 15, para. 7), Teresa, experiencing herself infused with the light of God, comments: "And I, though being what I am, seem to be another person." In 23.1, recalling how God freed her from herself, she writes that "here begins another new life." In 27.1, having placed herself com-pletely in the hands of God, she says, "l saw that I was a com-pletely different person." In 27.9 she says, "One of these graces is enough to change a soul completely.''27 In the context of these remarks, Teresa specifically mentions that she is growing in either love, detachment, or humility. At the height of her mystical life, Teresa has a profound expe-rience that, on the level of the divine self, reflects the empty, de-centered, but relational, contextual self of postmodernity. In 40.5 of her Vida, she writes: Septentber-October 1999 Seelaus ¯ The Self in Postmodern Thought Once, while I was reciting with all the sisters the hours of the divine office, my soul suddenly became recollected; and it seemed to me to be like a brightly polished mirror, without any part on the back or sides or top or bottom that wasn't totally clear. In its center Christ our Lord was shown to me, in the way I usually see him. It seemed to me I saw him clearly in every part of my soul, as though in a mirror¯ And this mirror also--I don't know how to explain it--was com-pletely engraved upon the Lord Himself by means of a very loving communication I wouldn't know how to describe. ¯ I was given understanding of what it is for a soul to be in mortal sin. It amounts to clouding this mirror with mist and leaving it black; and thus this Lord cannot be revealed or seen, even though he is always present giving us being. In God, Teresa is connected with the world's sin, even as she affirms the ever present graciousness of God always giving us being within the darkness of sin. God is present in Teresa, not with power and might, but in love and with an invitation to self-transcendence that is as pertinent and penetrating for us today as it was for Teresa. In 3 7.11 of her l/ida, Teresa sounds as though she is living in our present age. After lamenting the foibles of her honor-bound society, with its elaborate system of etiquette, she says, "I don't know how it's all going to end up; even though I'm not y.et fifty, I've already seen so many changes I don't even know how to live anymore. What will they do who are now being born and will live for many years?" What will we do, we who have been born in this postmodern era, this era in which we live for many years, often into our nineties? Like Teresa, we do not know where it is all going to end up. Many would say that dark night engulfs our entire world and the times in which we live. The Carmelite tradition, however, assures us that God is in the night. John of the Cross eloquently describes the meaning of the soul's journey into the night of God. In this night of faith, we discover that love is the eye of God and we in turn are to see and interpret all things through the eyes of God. From this perspective we see that we are all one in God's love and that we bear one another's burdens. By the quality of our lives, Christ would have us be bearers of hope for all who suffer the travails of poverty, violence, injustice, and oppression. Right within the many forms of death that surround us is the seed of resurrec-tion impatient for new life. As we work with our differences in families, in our civic and Review for Religious church communities, we can dare to hope that our graced strug-gle will energize efforts toward understanding, toward finding common ground within the extremes of diversity that ctiaracterize our postmodern world. What we see in Teresa's writings is a devel-opment in her understanding of herself and of Christ, who com-panions her journey. Today,. as we find the self anew, we also find new ways of seeing Christ and the Christian mysteries right within our postmodern world, without getting caught in nostalgia for the past. Again, like Teresa, we do not know where it will all end up. What we do know is that the future is present, like a seed, in today's disconcerting moment. Our challenge is to live now, to live fully (but with humility, detachment, and love) what we say we believe. The sufferings of our time are not meaningless, as sec-ular postmodernity might see them. They are integral to the groan-ing of creation in labor until it brings forth redemption, the final triumph of God's love. At its deepest level the self is caught up in the incomprehensible mystery of Love we call God. Notes I James Hillman, The Thought of the Heart and the Soul of the World (Woodstock, Connecticut: Spring Publications, 1995). 2 Anthony C. Thiselton, Interpreting God and the Postmodern Self'. On Meaning, Manipulation, and Promise (Grand Rapids: William B. Eerdmans Publishing Company, 1998). 3 It also leaves me with a little anxiety that the many authors that I read be given due credit. As I prepare this paper for publication, I real-ize that much of what I read merged in my thinking as I internalized the material. 4 See The Way 36, no. 3 (July 1996): 175. s According to Anderson, Kant's work in the 18th century began with a problem that was as divisive in its time as the objectivist-con-structivist one is in ours--in this case a conflict between the British empiricists such as Locke and Hume, who saw thought as merely an instrument for understanding or using "real world experience," and the Continental philosophers such as Descartes and Leibniz, who saw the mind as the supreme organizer and discoverer of all reality. This was not a postmodern debate. All parties assumed that people could appre-hend unchanging and universal truth. Kant's attempt to resolve the con-flict was his own contribution to the search for "foundational" knowledge or reality--beyond historical and cultural relativism--but it pointed toward a view of the mind as a creator of reality. Kant describes the mind as an active organ that orders and forms the raw data of experience, 1-467-- September-October 1999 Seela~s ¯ The Self in Postmodern Thought imposing upon them its own structure; we do not experience things in themselves but rather representations of them. See Walter Truett Anderson, Reality Isn't What It Used to Be (San Francisco: Harper, 1990), pp. 59-60. 6 Anderson, Reality, p. 48. 7 See Robert Rosenbaum and John Dyckman, "Integrating Self and System: An Empty Intersection?" Family Process 34 (March 1995): 26- 27, and Kenneth J. Gergen, "The Social Construction of Self- Knowledge," in Daniel Kolak and Raymond Martin, Self and Identity: Contemporary Philosophical Issues (New York: Macmillan Publishing Company, 1991), pp. 372-403. 8 See Max Charlesworth, "Postmodernism and Theology," The Way 36, no. 3 (July 1996): 188-202, for an interesting summary of the devel-opment of modern to postmodern thought. 9 Veronica Brady, "Postmodernism and the Spiritual Life," in The Way 36, no. 3 (July 1996): 181. 10 Salman Rushdie, The Satanic Verses (London: Viking, 1988), p. 313, quoted in Brady, "Postmodernism." 11 Walter Truett Anderson, Reality, p. 132. 12 Rosenbaum and Dyckman, "Integrating," pp. 28-33. 13 Rosenbaum and Dyckman, "Integrating," p. 26. 14 According to Rosenbaum and Dyckman, "Integrating," pp. 35-37, acknowledging memory as constructive, as a present contextual experi-ence, rather than as retrieval of the past, helps to avoid difficulties such as the controversies over recovered memories of trauma and abuse, which are a sensitive contemporary issue. ~s Teresa of Avila, Way of Perfection (Washington, D.C.: ICS Publications, 1980), chap. 4, para. 4, p. 54. 16 The Collected Works of St. John of the Cross, trans. Kieran Kavanaugh OCD and Otilio Rodriguez OCD (Washington, D.C.: ICS Publications, 1991), p. 150. 17 Rosenbaum and Dyckman, "Integrating," p. 37. is See his Spiritual Canticle, stanza 4, in Collected Works, p. 494. 19 Frans Jozef van Beeck, God Encountered: A Contemporary Catholic Systematic Theology, Vol. 2/1 (Collegeville: Liturgical Press, 1993), p. 238. 20 Soren Kierkegaard, "Truth Is Subjectivity," in Concluding Unscientific Postscript, ed. and trans. Howard V. Hong and Edna H. Hong (Princeton: Princeton University Press, 1992), pp. 169ff. "Truth is precisely the con° tradiction between the infinite passion of the individual's inwardness and the objective uncertainty. If I am capable of grasping God objectively, I do not believe, but precisely because I cannot do this I must believe. If I wish to preserve myself in faith, I must constantly be intent upon hold-ing fast the objective uncertainty, so as to remain out upon the deep, over seventy thousand fathoms of water, still preserving my faith . " Review for Religious 2~ See Karl Rahner, "Experience of Self and Experience of God," in Theological Investigations, vol. 13 (New York: Crossroad, 1983), pp. 122- 132. 22 See "The Immediate Experience of God in the Spiritual Exercises of Saint Ignatius of Loyola," in Karl Rahner in Dialogue, ed. Paul Imhof and Hubert Biallowons, trans. Harvey D. Egan (New York: Crossroad, 1986), p. 176. 20 See Charles Verge, "Foundations for a Spiritually Based Psychotherapy," in Religion and Family, ed. L. Burton (Hayworth Press, 1992), pp. 41-59. 24 See also her Autobiography in Collected Works of Teresa of Avila, Vol. 1, trans. Kieran Kavanaugh OCD and Otilio Rodriguez OCD (Washington, D.C.: ICS Publications, 1976), chap. 40, paras. 5 ~nd 10. Teresa here recounts two visions in which God and the soul mirror each other. See also Spiritual Canticle, stanza 12, in Collected Works of John of the Cross, pp. 515-519. 2s Quoted in Thiselton, Interpreting God, p. 160. z6 Hillman, Thought of the Heart, pp. 96-99. 27 With only a quick glance, I found chap. 20, paras. 23, 25, and 26- 28; chap. 21, paras. 8-9; and chap. 25, paras. 18-19--all referring to Teresa experiencing herself as a different person. The Salvation Cup I raise my fragile, broken cup. Accept it empty. Nothing I own can f!ll it. This is the cup of my truth, my faith in the promise, my salvation cup. Fill it with the wine of the Spirit, the river that makes fertile my barren ground, the ocean of never ending mystery. This is my cup. With it I offer my fragileness, my sinfulness and my broken promises. Heal me, Spirit of God, with theelixir of salvation. Virginia Skrdlant SHCJ September-October 1999 FREDERICK E. CROWE The "World" from Anthony of Egypt to Vatican II An old proverb, once thought to be scriptural, warns us that where there is no understanding the people perish. Scriptural or not, the proverb itself is sound enough, and I would apply it to the institution of religious life. On all sides the question is heard: Is religious life dying? I refuse to believe that the God who gave us Anthony of Egypt, Benedict, Francis, Dominic, Ignatius, and so many others down to Mother Teresa is a God who intends religious life to perish. But I do believe in the need for under-standing, so that through our input God's operative grace may become cooperative. The Pattern of Human Thinking This essay is, then, an essay in understanding, but much more modest in scope than the preceding paragraph would suggest. It does not attempt td study religious life in its essence, its proper-ties, its various manifestations. It goes back rather to a prelimi-nary question and takes one small point for study: the Christian attitude toward what we call the "world." It is my hope that, if we gain some understanding on this background question, we will have a context for an eventual rethinking of religious life itself. Frederick E. Crowe SJ wrote "The Ignatian Exercises and Jesuit Spirituality" for our July-August 1994 issue. His address remains Lonergan Research Institute; 10 St. Mary Street, Suite 500; Toronto, Ontario; M4Y 1P9 Canada. Review for Religious My approach is historical rather than analytic. It examines the major transitions in the Christian attitude toward the world. It finds a dialectic running through history, a dialectic of to and fro that is not a mere alternation, but a progressively unfolding pat-tern in which each alternation is a step forward. It concludes with the way the church is finding new meaning for its role in the world, and proposes this as a new context in which religious too might find today the meaning of their consecrated life. The advantage of approaching history as a dialectic in the sense described is twofold. First, it may lift us out of our "crisis" mood, in which we think of our present situation as a spiritual fever, as a low point from which the patient may either die or recover and resume life as it was before the crisis. In a dialectical understanding, that is not the case. The low point is an opening on a new high. Second, a dialectic follows an intelligible pattern, with each step part of a natural, though not necessarily logical, sequence. This means that, if we can plot the sequence up to the present, we may be able to establish the direction of movement and discern the path we should take into the developing and unknown future. That "natural sequence" is the pattern of human thinking in time, the way the human mind naturally works as it progresses toward fuller and fuller understanding. In itself the pattern is sim-ple enough. Faced with a problem area of any complexity, the human mind will first find some specific factor of explanation, will tend to make that the whole explanation, but will eventually see that it is insufficient as a total view. It will then discover a generic factor and will in turn make that the full explanation, only to dis-cover that this too is insufficient as a total view. Eventually, in the dialectical oscillation of specific and generic, the mind will arrive at a higher viewpoint and hold the specific and the generic in the unity of a full understanding. The Pattern Illustrated That is terribly abstract. So, before applying it to the history of Christian thinking on the world, let me offer two concrete illus-trations that show the pattern as realized in actual history. First, the natural priority of the specific is easily illustrated in human lan-guage. "So in Homer there were words for such specific activities as glancing, peering, staring, but no generic word for seeing.''1 This is "both the strength and the weakness of'early language";~ it Septentber-October 1999 Crowe ¯ The "WorM"from Anthony of Egypt to Vatican ll The term vocation was appropriated to the religious life (as it commonly still is). has the power of the concrete, but is unable to reason in abstract or generic terms. And so in learning to write English we are told to search for the specific, for the concrete descriptive word, but in the strict reasoning of, say, a legal question we may have to resort to technical and abstract language. What is true of human language is true also of human think-ing, and so my second illustration is taken from the theology of our need for divine grace. Here there was first the discovery of a specific explana-tion, namely, the fall of our first parents. This was largely the focus of St. Augustine's thinking, which centered on the difference between their state before the fall and ours after it. This idea ran its course for about seven centuries, cul-minating in the position of Peter Lombard, namely, that there are in the grace-history of our human race "four states of human liberty: the earthly paradise, fallen man, man redeemed, and heaven.''3 Our need for divine grace is understood in relation to those states. Meanwhile, however, the insufficiency of this specific step was gradually becoming apparent. There was difficulty in defining lib-erty; the doctrine of merit tended to hang in mid air; even grace itself lacked a clear definition, for what is there that is not a free gift of God and therefore grace?4 The dialectic of ideas was prepar-ing theologians for the next step, the discovery of the generic the-orem of two orders with quite distinct status in the universe of being, the supernatural order and the natural: "not only was there the familiar series of grace, faith, charity, and merit, but also nature, reason, and the natural love of God.''5 This was largely the work of Philip the Chancellor in Paris in the early 1200s. It was an epoch-making discovery, and it put the question of our need for divine grace on an entirely new basis, releasing a whole series of developments. But so intoxicating was Philip's idea that theologians made a mistake exactly parallel to the one their predecessors made in the use of Augustine: the view that this was a complete and adequate explanation. Thomas Aquinas himself, in his early writings, shows hints of this one-sidedness, not giving sufficient attention to the moral impotence that is the result of Adam's fall. Nevertheless, it was Thomas who finally Review for Religious brought, the two factors, the specific and the generic, into unity. Peter Lombard's four states remain in the Thomist synthesis, but as applying to a specific question within the genus of the total divine plan.6 The Pattern Verified in the Specific Idea of "World" I have illustrated the way the human mind naturally works in time as it advances in understanding: first, a specific idea; then, exaggeration of this idea; next, a generic idea; exaggeration of this in its turn; eventually a synthesis. I believe the pattern is discernible also in the history of Christian thinking on the idea of the world. There too I find a specific and a generic factor, with the specific the first to be discovered and exploited beyond its potentiality, and the generic the next to be discovered and in its turn exploited beyond due measure. Again let us turn from the abstract to the concrete. Concretely the first step may be located in, or at least represented by, Anthony of Egypt. Toward the end of the 3rd century, "Anthony gave away his possessions, and devoted himself to a life of asceticism, and c. 285 retired completely into the desert . Towards the end of his life, the numbers of those who turned to the solitary life of the desert increased as the result of the secularization of the church.''7 It is possible to see this development in too simplistic a fash-ion, but at least one characteristic feature is clear: flight from the world. So it produced works with titles like De contemptu mundi (On contempt of the world). It filled Europe with hermitages, con-vents, and monasteries. For twelve centuries the idea ran its course with enormous impact on Christian v.alues, Christian living, Christian institutions.8 But it suffered the handicap of being a specific idea attempt-ing to provide a total view. For one example, the term vocation was appropriated to the religious life (as it commonly still is). In this respect the laity of the church and even the diocesan clergy were deemed to belong to a lower class: they did not have a "voca-tion." A reaction was inevitable, but it was centuries taking shape. Many diverse influences were at work promoting it. Its history is a complex interweaving of those influences. There were subver-sive along with legitimate movements. But what was positive and valid in the reaction, and quite natural and basic in the unfolding Septentber-October 1999 Crowe ¯ The "WorM"from Anthony of Egypt to Vatican II dialectic, was the emergence of the generic factor in the concept of the world. The Pattern Verified in the Generic Idea of "World" The quite basic event, then, in the. emergence of the generic concept of the world was the discovery by Philip the Chancellor of the two orders: natural and supernatural. I used this earlier to illustrate the pattern of human thinking as it is found in theology (not only was there the familiar series of grace, faith, charity, and merit, but also nature, reason, an'd the natural love of God). I use it now as a basic explanatory factor for the new stage of our dialec-tic. That is no accident. It is an idea so fundamental that it is bound to appear in the history of any theological idea. It underpins all that I have to say in this section and the following. Every discovery makes its way against opposition from an estab-lishment. The recognition of the natural order had to be followed by a recognition of its rightful autonomy, and that could not fail to be a traumatic experience for the church. The history of this strug-gle need not detain us here. In essence the point is that the human race was not only created divine; it was also created human, with a need for hunting, fishing, farming, for song and dance, for math-ematics, science, philosophy, whatever lies within its potency for development. Without grace we are able, Thomas Aquinas would say, using his favorite example, to cultivate our fields and build our houses. But the full extent of that principle means that without grace we can marry and be given in marriage, form guilds among artisans, establish universities, function as nations, join in a world union of peoples, explore the boundaries of space. Further, the natural has its own laws. Natures operate uni-formly: we do not gather grapes from thorns or figs from thistles (Mr 7:17). And those natural laws can be isolated in thought and allowed to develop and flourish according to their own potential. For to be human is to learn: to learn that there are human tech-niques for producing good crops, human means for controlling nature, human means of self-government, human means for gain-ing wisdom and educating upcoming generations, and so on through the list. If, then, we take a broad view of the forest, not stopping to study individual trees, we can discern here the generic factor in Review for Religious the concept of the world, the needed complement to the specific factor provided by Anthony. This generic factor is the recogni-tion of the world as good in its own right. God did not create an evil universe, but made all things that they might have being and life (Ws 1:13-14; 1 Tm 4:4). That means that we can no longer be satisfied with the negative connotation of "flight from the world." There is a positive side to Anthony's strategy: its focus on the transcen-dent. The negative side is not repudiated, but it has to be seen in relation to that focus and has to be complemented by a generic view of the goodness of all creation. But the pattern of the dialectic suggests that this step too will be exaggerated, and that is exactly what happened. In the intoxication of this new idea, there was a widespread repudia-tion of the age-old flight from the world. Convents and monasteries were emptied; instead of contemptus mundi, there was a glorification of the secular.9 And so secularism arose: what was legitimate in the discovery of the natural, what was legitimate in the declaration of its auton-omy was magnified to an ism. What was a genetic idea that should have been brought into union with the specific paraded as the full explanation of the universe. A movement for the liberation of the secular became a secularism. The secular and the sacred have to do with human thought and feeling and the human use of creation. Uniting the Specific and the Generic: New Categories Christian thinking on th~ world has gone through the two phases inherent in the dialectic of human learning: the discovery and undue exploitation of a specific factor, followed by a reaction, and the discovery and undue exploitation of a generic factor, fol-lowed in its turn by a reaction. The current need is for the inte-gration of the two factors, and the categories that offer hope of that are the sacred and the secular. This pair of terms has crept into our discussion as related to, but not identical with, the supernatural and the natural. They need more careful definition. The natural and the supernatural provide the framework of creation; they are what philosophers would call Septentber-October 1999 Crowe ¯ The "WorM"from Anthony of Egypt to Vatican 11 the ontological constituents of the universe. But the secular and the sacred have to do with human thought and feeling and the human use of creation; they pertain to the cultural sphere rather than the ontological. The natural cannot be made supernatural: as Isaiah reports the word of the Lord, "my thoughts are not your thoughts, and your ways are not my ways" (Is 55:8, NEB). God is the wholly other. Grace perfects nature but does not destroy it. The natural, then, maintains its identity within the unity of God's creative plan. Catholic schools do not use a different mathematics to add and subtract, to divide and multiply. But while the natural remains what it was created to be, it can be invested with the aura of the supernatural, and in this sense the natural can be sacralized, become sacred. Bernard Lonergan provides a context in which to locate this cultural transformation: "The whole world of sense is to be. a token, a mystery, of God"; and again: "the world of sense is. a mystery that signifies God as we know him and symbolizes the fur-ther depths that lie beyond our comprehension.''~° This means that the secular, not only as a world but also in its various aspects, can in human thought and feeling be given the character of the sacred. So in primitive peoples there was a religious ritual for plant-ing and harvesting, for coming to puberty and marrying, for rev-erent remembering of the dead, and so on. All these activities are given a sacred aspect, though their natural basis allows for their secular use. But they are only potentially secular; they are not at first recognized to have that aspect. For the human race is funda-mentally religious, in the sense of being created with a religious consciousness, and has remained religious despite all the protests of unbelievers. One may say: In the beginning was the sacred. That is, what later became distinguished as the two zones of the sacred and the secular was at first all one zone, and it was sacred. Now, just as in the ontological sphere the natural component of the universe had to be recognized for what it was, the natural, so too in the sphere of the cultural the legitimately secular aspect had to escape from the domination of the sacred and assume its independent role in the plan of creation. In the course of this development, there was inevitably a conflict with the representa-tives of the sacred; inevitably too the secular won its rightful inde-pendence. "For this sacralized construct of man and his universe was impugned and impugned successfully by Copernicus, Galileo, Review for Relig4ous and Newton, by Darwin and Freud, and by the swarm of philoso-phies" at least since Descartes.~l So the struggle between natural and supernatural was repeated here, with the same exaggerations. The extremists were not con-tent to liberate the secular; they were driven also to desecrate the sacred. Concretely we might think of the relation between a sec-ular day of rest and the Lord's Day. There has been a strong ten-dency in this matter for the sacral to dictate to the secular, imposing a religious observance so strict as to frustrate the secu-lar purpose of a day of rest. But on the other side there is the des-ecration of the Lord's Day represented in past history by the extremists in the French Revolution and, some would say, by the present Sunday shopping. Uniting the Specific and the Generic: New Strategy Perhaps it is possible now to sketch the lines we might follow to achieve the desired integration of our specific and generic fac-tors. Our question is: How is the church to achieve the unity of Anthony and Aristotle, of Jerusalem and Athens, of the transcen-dent and the this-worldly, and now in particular of the sacred and the secular? Our suggestion is that what had been at first unwit-tingly sacralized was then wittingly secularized. Bur what was wit-tingly secularized can be wittingly resacralized for Christian purposes as the need arises. The pagans of Rome sacralized their meat by offering it to their gods, but the Christians could, in effect, desacralize these meats with a good conscience and, if they wished, resacralize them to their own purpose: "he who eats meat has the Lord in mind when he eats" (Rm 14:6). Again, a game of golf may be just what workers need on their day of secular rest, and present discipline in the church allows them to keep holy the Sabbath and still go golfing. But the new sacralization will be different. There will be a new understanding and a new humility. The sacred will not dictate to the secular in the latter's own sphere. It will be a sacralization through the intention of believers, using the natural end of a nat-ural entity to their religious purpose. They who eat meat have the Lord in mind when they eat; they who golf give thanks alike in the weekly Eucharist and in their outdoor exercise. A final point brings us back to larger issues: sacralization will not be merely extrinsic to the natural world. On this question Septentber-October 1999 Crowe ¯ The "WorM"from Anthony of Egypt to Vatican II Marie Dominique Chenu Op has some helpful remarks. He sees a purer presence of the church in the world creating a new kind of Christians in the world: missionaries of the gospel, and not the protectors of a civilization that they themselves have organized. The real vocation of lay people will be to show that Christianity does not despise the world, but lifts it up, consecrates it, and ful-fills it. And this new presence will unite intrinsically with the world, will make it a true partner, for the believers will read the signs of the times and through them discern the elements in the world and human history that are, as it were, naturally open to the sacred, offering the possibility of a new praeparatio evangelica. They now look for a spirituality that will integrate their life in a world that has become the main field where they must seek their sanctifica-tion. 12 Religious Life in the Ongoing Dialectic The focus of my attention has been the new path for the church in the world today, along the lines of the Vatican Council II document Gaudium et spes. We must be clear on the church in the new age before venturing to discuss religious life in the new age, for religious are Christian before they are religious; that is the order of the council in its document on the church, Lumen gen-tium.~ 3 But of course that means that the dialectic we have dis-cerned in history will apply also to the features of Christian living that religious have in common with all Christians. In that context we may anticipate the direction that applying the dialectic to religious life should take. We will understand how the religious state began as a "flight" from the "world," and we will realize that, as our conception and knowledge of that world has changed enormously, so also must our notion of flight from it. We have come a long way from St. Anthony of Egypt. I trust, never-theless, that we have not left him behind. With all reverence we may conceive an analogy with a hymn of Thomas Aquinas that the church uses in Holy Week: "The word of God, proceeding forth / Yet leaving not his Father's side." Our task is not to aban-don Anthony, but "proceeding forth" to retain his insight and transpose it into a realization of Vatican II's "church in the mod-ern world" and of religious life as it is to be lived in the coming millennium. Our task is to achieve in our own way the unity of the specific and ~he generic concepts of the world. Review for Religious Religious, then, will retain their vows, and the vows will have the meaning they had for Aquinas, a revocatio ab affectu temporalium, a withdrawal from affection for this world.14 They will have the meaning also that Anthony's flight from the world had for him in his time of secularization. And that meaning will remain even in the most sacred of times. A focus on the transcendent and the escha-tological state will necessarily involve the reevaluation of the world that the saints have always shown: not a contempt for the good of creation, but a love for the better to which the good is open. Correspondingly, there will be far more attention to the positive aspects of the vows. This movement has already begun, but it should undergo an extensive development. Similarly for the pos-itive counterpart of the "flight": contemplation of the divine. The cloistered will redouble attention to their contemplative role, and the active will redouble attention to their role as contemplatives in action. As we follow the dialectic in its future course, we would do well to consider our starting point. The first word in the gospel message is "repent" (Mt 4:17; and see the same in Mk 1:15, but with a preface, "The time has come . . ."). Our examination of conscience in this respect might ask in what degree, if any, we transferred to ourselves as perfection what belongs rather to the realm of the sacred. Medieval theologians argued at length about holiness and the more perfect state. Should the operative word be, not "holy" in the sense of personal virtue, but rather "sacred" in the sense of "consecrated to God"? Notes 1 Bernard Lonergan, Method in Theology (Toronto: University of Toronto Press, 1994 reprint), p. 87. 2 Lonergan, Method, p. 87. 3 Grace and Freedom: Operative Grace in the Thought of St. Thomas Aquinas (London: Darton, Longman, and Todd, 1971), p. I0. 4 Grace and Freedom, pp. 14-15. s Grace and Freedom, pp. 15-16. 6 Bernard Lonergan, "Gratia Operans: A Study of Speculative Development in the Writings of St. Thomas Aquinas," doctoral disser-tation, Gregorian University, Rome, 1940, pp. 36-37. The preface and introduction, from which the dialectical pattern is taken, were published in Method: Journal of Lonergan Studies 3, no. 2 (October 1985): 9-46. The whole dissertation will he published in volume 1 of the Collected September-October 1999 Crowe ¯ The "World"from Anthony of Egypt to Vatican 11 Works of Bernard Lonergan, soon to appear from University of Toronto Press. This section of my article simply paraphrases Lonergan's position as set forth in that dissertation. 7 The Oxford Dictionary of the Christian Church, ed. EL. Cross (London: Oxford University Press, 1958), article, "Antony, St., of Egypt." s See, for an example, G.J. Engelhardt, "The De contemptu mundi of Bernardus Morevalensis," Mediaeval Studies 22 (1960): 108-135; 26 (1964): 109-142; 29 (1967): 243-272. On the same topic Robert Bultot published widely in books and periodicals of the 1960s under the title La doctrine du m~pris du monde. 9 The turnaround had an interesting development in the Lutheran idea. Lutheranism "does not consider the call of the pastor any more sacred than the call of each Christian to witness to the lordship of Christ in his life and work. The universal priesthood of believers., makes the vocation of every man a holy calling"; see "Lutheranism" in A Handbook of Christian Theology (Cleveland and New York: World Publishing Company, 1958). Here too there is a valuable insight, namely, the vocation of every Christian, but it is not integrated into the dialectical development on the "world." 10 Bernard Lonergan, Insight: A Study of Human Understanding (Toronto: University of Toronto Press, 1992), pp. 689, 692. '~ Bernard Lonergan, "Sacralization and Secularization," unpublished MS of a 1974 lecture (originally given 1973), p. 23. My whole article relies heavily on this lecture. ~2 Spirituality in the Secular City (Concilium 19), pp. 114-115. I have paraphrased, with frequent verbatim quotations, two pages of "Desacralization and the Spiritual Life" by Claude J. Geffr~ op. ~3 See chap. 6, §§43-47, on religious, in Lumen gentium, the coun-cil's Dogmatic Constitution on the Church. 14 On "revocatio ab affectu temporalium," see Thomas Aquinas, De perfectione vitae spiritual#, chap. 6. Review for Religious JOEL GIALLANZA "Come Closer. I Am Your Brother": Being and Doing Brotherhood In Genesis, chapter 45, Joseph, one of Jacob's sons, has the delicate task of revealing his identity to his brothers. Having sold him into slavery several years before, they do not recognize him now in this powerful Egyptian official, second only to Pharaoh. In his self-revelation Joseph tells his brothers, "Come closer to me. I am your brother" (Gn 45:4). To be convincing, Joseph has to do more than tell his brothers who he is; he must demonstrate this through his attitudes and actions toward them. If he was truly to be their brother, then he had to do what brothers do. Only then was he gen-uinely recognizable to them. This story has a valuable reminder for religious brothers today. The name by which we identify our-selves in life and in the church reflects a rich and prophetic spirituality. "Brother" is not only a title, it is what we are. Even more, it is what we are called and committed to do among ourselves, among the people, and for the church. Also, it is ever a reality we must become: it cannot be fully and finally accompJished at the time of our religious profession. In my experience of the church and sodety today, several forces outside lay religious life often contribute Joel Giallanza csc wrote for us as recently as our May-June issue. His formation work continues at Charles Andersen Residence; 320 Brahan Boulevard; San Antonio, Texas 78215. Septe~nber-October 1999 brothers Giallanza ¯ "Come Closer. I Am Your Brotber" We need one another to be who we say we are and to do what we say we do by our very vocation. to making brothers unrecognizable, unknown, or unappreciated. One of them is that the church's administration emphasizes-- implicitly and explicitly--the clerical state as normative for min-istry and governance within the church, while brotherhood tends to become invisible or at least peripheral. Another is that in a vari-ety of cultures the term brother is used to designate seminarians and other candidates for presbyteral ordination. From this perspective brotherhood tends to be inter-preted as a transitional stage. These outside forces, how-ever, are not alone in influencing the public perception of brothers. Two internal forces come to mind. Sometimes we define our-selves or allow ourselves to be defined in negative terms, that is, by what we are not: unordained or nonclerical men religious. To go through life with "un" or "non" as the beginning of our self-iden-tity is not a good basis for explaining our vocation. It is even a less good basis for promoting vocations. And sometimes we do not reflect upon sufflciendy and articulate clearly our own identity, including the challenges we face simply because we dare to call ourselves brothers. Being Brother Immediately striking about the term brother is its relational character. It expresses both a specific relationship and a way of being in relationship. For us it assumes that we are willing to enter into relationships with others. It assumes we choose to be involved, not isolated. Though Vita consecrata does not speak extensively about the vocation of brothers in the church, it recognizes four relationships that are to characterize our way of life. These religious are called to be brothers of Christ, deeply united with him, "the firstborn among many brothers" (Rm 8:29); brothers to one another in mutual love and working together in the church in the same service of what is good; brothers to everyone in their witness to Christ's love for all, especially the lowliest, the neediest; brothers for a greater brotherhood in the church (Vita consecrata, §60). Review for Religious I would like to comment on these four relationships and on their prophetic implications. Brothers of the Lord Whatever else we may do, whatever our ministry, the rela-tionship that defines and shapes religious life is our relationship with the Lord. This must be the first and deepest of all our rela-tionships. Jesus says to the disciples, "You are my friends, if you do what I command you . I call you friends because I have made known to you everything I have learned from my Father" On 15:14-15). Our relationship with the Lord, our friendship with God, is rooted in knowing and doing what we have learned from the Lord. To be brothers of the Lord is to know the ways of God and to do what the Lord asks of us. To be brothers of the Lord, we must be people of discernment and people of fidelity. We must probe God's will ever deeper and then faithfully put into action all that we discover. We must be skilled in seeing God in all and in seeing all in God. We thereby proclaim and live the intimate closeness of God to this world, even when global events or personal experi-ences provide no evidence or apparently contrary evidence of such intimacy. Brothers with One Another Everything we say about ourselves and about our life together will not be authentic if we do not live in such a way that our com-mon life is marked by love, mutual care and concern, courtesy, hospitality, and a genuine interdependence. Jesus tells us that we will be recognized as his followers if we love one another (see Jn 13:3 5). Note that Jesus does not say what we would be recognized as, if we did not love one another. Could we become completely invisible, thereby rendering impossible any kind of recognition? To be brothers with one another in a religious community is much more than merely getting along; it must go beyond friendly tolerance. There are two important elements here. First, to be brothers with one anothdr is to recognize and accept that we do not live this way of life alone. We need one another to be who we say we are and to do what we say we do by our very vocation. There must be a mutuality and an interdependence among us by which we September-October 1999 Giallanza ¯ "Come Closer. I Am Your Brother" strengthen and support one another. Second, to be brothers with one another is apostolic. The quality of our life together commu-nicates something about God's presence and activity in our world. In some areas of the world, we may be the only witnesses people see, the only evidenc~ they have that God is alive and active in their lives and in their culture and society. Brothers to the People Our very title brothers excludes distinctions among us. Nationality, culture, ethnic heritage, education, ministry, natural and acquired skills--all these are gifts that are to unite us, not dif-ferences to be made into walls of division among us. So too our presence among the people must communicate without compro-mise that we make no distinctions, that we welcome and are hos-pitable to all people. To be brothers to the people also influences the way we approach ministry, whatever our ministry. Our apostolic activity among the people must be a model and a means of unity for them. We must be skilled in guiding people to work together, to appre-ciate one another's gifts, and to share those gifts with one another for the good of all. Regardless of the specific nature of our min-istry, this task of facilitating union among the people is a primary aspect of our mission and message as brothers in the church and society today. Brothers for the Church There are many unnecessary distinctions in our church today. Among the most dominant are those between women and men, between lay and ordained persons. Our presence and activity in the church must strive to communicate a perspective free of the kinds of distinctions that can and sometimes do deteriorate into divisions. To be brothers for the church is to live and proclaim, in St. Paul's terms, "There is no longer Jew or Greek, there is no longer slave or free, there is no longer male 6r female; for all of you are one in Christ Jesus" (Ga 3:28). We know it was a risk for St. Paul to preach such a message two thousand years ago. In truth, it is still a risk to preach this today precisely because people can and do establish their identity in distinctions. Any message that seeks to Review for Religious remove distinctions tends to disrupt that identity, thereby stimu-lating responses that range from simple admonition to sharp antag-onism. I believe it is part of the mission of brothers in the church today to preach and to live such a message regardless of the con-sequences. Doing What Brothers Do What I have said so far pertains to being brothers, pertains to our basic identity as lay religious in the church and society. To be brothers of the Lord, with one another, to the people, and for the church will have a definite influence on our doing what brothers do. Doing what brothers do is the prophetic dimension of our life as lay religious. In terms of these four basic relationships, what do we do as brothers? Through our relationship to the Lord, we demonstrate the possibility of living the example of Jesus in today's world. Jesus' example of selflessness, of compassion, of service to others is not popular today. We observe the sustained promotion and tenacity of an individualism which condones and constructs self-contained and closed styles of life that do not readily respond to the influence or needs of others. The danger is that Jesus' example could be placed on the shelf of items that are no longer realistic or useful for our world: items that are fine for museums of ancient artifacts, but not really relevant for everyday life in contemporary culture. To do what brothers do is a clear expression of the importance, necessity, and urgency of Jesus' example for today. Through our relationship with one another, we demonstrate the possibility of love and reconciliation. In a world where self-ishness and self-containment become the ways of relating to one another, love and reconciliation become ever more rare. Personal histories, past mistakes, and present weaknesses become conve-nient excuses for not reaching beyond ourselves to love, to for-give, to be reconciled with others. And yet it is only through our humanity--with our histories and mistakes and weaknesses--that we can love one another. To do what brothers do means commit-ting ourselves to love and forgive and reconcile, and to take up whatever means are necessary to live that commitment every day. Through our relationship to the people, we demonstrate the possibility of living in peace and unity. The rich diversity repre-sented in social, political, religious, cultural, and ethnic differ- September-October 1999 Giallanza ¯ "Come Closer. I Am Your Brother" ences is too often used as a basis for creating divisions among peo-ple. And as the barriers supporting those divisions become stronger, mutual destruction appears more effective and efficient than coop-erative dialogue. Conflict, violence, war then become the usual ways of dealing with differences in life. To do what brothers do means making every effort to show that the differences among people are graces and blessings to be celebrated, not burdens and bothers to be shunned. Through our brotherly relationship with the church, we demonstrate the possibility of living and ministering in equality. This equality is not uniformity; there can and must be distinctions among the many necessary ministries within the church. The important and imperative idea here is to help maintain the link between those many ministries and the common good of the Body of Christ. To create and then vindicate situations in which peo-ple are excluded or treated slightingly is not acceptable. Ignoring such situations is also not acceptable. To do what brothers do means pointing out injustices and inconsistencies--in our society, but most especially in our church. We will not be popular for iden-tifying such realities, but to neglect doing so would contradict what we profess to be and to do. The Haunting Question Male lay religious are often confronted with the simple but haunting question "What is a brother?" Brothers themselves, as well as other church ministers, struggle with formulating a satis-factory response. I do not believe that any response, however elo-quent and theologically sound, will ever be satisfactory. Indeed, it cannot be. If being a brother and doing what brothers do is at heart a matter of relationship, then our identity as brothers will be found in our actions, in our witness and our way of relating to the Lord, to one another, to others, and to the church. Thus, the only worthy answer to "What is a brother?" is simply "Watch us! Watch what we do, how we behave. Observe our love, care, concern, com-passion. Watch us. Then you will see and know what being a brother is." Are we willing to make that response? Will the integrity, consistency, and quality of our lives withstand such close scrutiny? The precedent for this response has been established already. When asked by John the Baptist's disciples, "Are you the one who Review for Religious is to come, or are we to wait for another?" Jesus responds, "Go and tell John what you hear and see: the blind receive their sight, the lame walk, the leper~ are cleansed, the deaf hear, the dead are raised, and the poor have good news brought to them" (Mt 11:3- 5). Jesus' response invites a simple and direct method: observe, then report what you see. Could it be that we work to enhance the eloquence of our language and the soundness of our theology in responding to "What is a brother?" because we hesitate to say "Watch us"? Obviously, to invite close observation is to imply an integrity and a quality of life that are beyond question or com-promise. Writing to the Corinthians, St. Paul is boldly explicit in continuing Jesus' precedent: "Be imitators of me, as I am of Christ" (1 Co 11:1). In fact, no less than seven times does Paul make this recommendation in his correspon-dence with the early Christian commu-nities (see 1 Co 4:16 and 11:1; Ph 3:17 and 4:19; 1 Th 1:6; 2 Th 3:7 and 9). We might wince at the bluntness--almost arrogance--of his recommendation. Nevertheless, the only way to avoid rel-egating Jesus' example to the realm of theoretical ideals is by a practical demonstration of it. Only a living example can accomplish that demonstration effectively. Brothers must live in such a way that we can make this Pauline recommendation with confidence and integrity. If we believe that our God is incarnational, then the example of our own lives must be the first of all our responses to the simple question "What is a brother?" Again, we must ask ourselves about our willingness and ability to make that response. Any other response, whether from an individual religious or froma general chapter, will fall short of the convincing and transforming power inherent in a living example. Being brothers and doing what brothers do involve decisions regarding a belief and a behavior. The belief is that the example of our brotherhood, as a reflection of Jesus' own, is necessary for society and for the church today--and tomorrow. The behavior is our effort to follow Jesus with integri.ty, simplicity, and fidelity. Through our brotherly .relationship with the church, we demonstrate the possibility Of living and ministering in equality. September-October 1999 Giallanza * "Come Closer. I Am Your Brother" This belief and behavior must stem from deliberate decisions, for they will not and cannot come into being by themselves. If they do not find explicit expression in our daily lives and activities, then they do not exist at all. If we cannot invite the world to "Watch us" when we are asked about the identity and meaning of our life as brothers, then we have only words. Such words die in thin air without living exam-ples to certify their truth. Action verifies articulations; witness confirms words. When action and witness are separated from artic-ulations and words, credibility is compromised. To speak and to act, together, must constitute our effort to define who and what we are as religious brothers and, being brothers, what we do. All else is shifting sand. All else contributes to the continued invisibility of religious brothers within the church and society. Being and Doing To be brothers and to do what brothers do are inseparable. We must strive for consistency in our life so that what we per-ceive and profess ourselves to be and what we do become a single reality. Otherwise we compromise the quality of any prophetic presence and activity we would have in the world. To be and to do as brothers of the Lord, we must be men of integrity, firmly rooted in the Lord. To be and to do as brothers with one another, we must be men of communion, who willingly choose the interdependence necessary for a healthy and whole life. To be and to do as brothers to others, we must be men of mis-sion, who love others through compassion and service. To be and to do as brothers for the church, we must be men willing to pro-vide challenge, whose commitment to the church enables us to question its inconsistencies even as we continue to love it. In the Book of Genesis, the challenge confronting Joseph is both to reveal his identity and to witness to the truth of that rev-elation. He begins with a simple invitation, "Come closer to me." He invites closer scrutiny and careful listening, confident that he will be recognized and accepted for who and what he claims to be. We religious brothers, by the very nature of our vocation, must extend the same invitation in all our relationships. The witness of our integrity, our sense of communion and mission, and the chal-lenge we present will confirm or contradict the truth of what we claim to be and profess to do. Vita consecrata says that brothers participate in the "mission of proclaiming the gospel and bearing witness to it with charity in everyday life" (§60). Such proclamation and such witness are responsibilities we bear and services we provide. They are the heart of our invitation to "Watch us"--to "Come closer" and see ¯. "I am your brother." Questions for Personal and Communal Reflection These brief reflections need fi~rther refinement from the particular cultures and contexts in which brothers live and minister around the world today. In fact, the most sound theologies of religious brotherhood today will conte from within those cultures and contexts. Generic theologies of religious life, by attempting to speak to everyone, run the risk of speaking to no one. As we continue to reflect on and discuss various dimensions of our religious life, we must remain ever attentive to the specific culture and context in which we live and minis-ter. The following questions are offered as a starting point for individuals and for communities. For us as brothers of the Lord, what aspects of Jesus' example and teaching are particularly striking and significant, given the heritage of our religious congregation and the particular culture in which we live and minister? As brothers with one another, what do we desire people to see in us through our life together? What do we believe our wimess communicates to people? What evidence do we have to support that belief?. As brothers to the people, what means do we use to foster peace and unity among them? How do our ministries serve towards dialogue and reconciliation? As brothers for the church, what efforts do we or could we make in our local area to emphasize the equality of persons within the church? With what specific challenges does our heritage as a congregation con-front the church? In which aspects of our life are we confident in saying "Come closer"? In which aspects of our life fire we hesitant about saying "Watch us" in response to people's questions about our vocation? What are the principal gifts we bring as brothers to this cultural set-ring? What are the principal social and ecclesial challenges confronting us today as brothers in this cultural setting? What is the most attractive quality about our religious life in this cultural setting? What is least attractive? What means would be effective in the particular culture where we live and minister for educating the people and the church about the voca-tion of brothers? In addition to the witness of our life, what are effective strategies for promoting vocations to religious brotherhood today? Septentber-October 1999 PAUL BEDNARCZYK Religious Brothers: One Vocation Director's Perspective Religious congregations of brothers can no longer ignore the question of new membership. The "vocation crisis" is staring us in the face. We can debate more effective governmen-tal structures, we can plan new mission orientations, and we can write more documents about solidarity with the poor, but, unless new members join our communities, what will it all mean fifty years from now? The membership crunch seems to be hitting home more now than ever. In many dioceses and religious congregations, the vocation question has been moved to the forefront. At their annual national meeting three years ago, the United States bishops agreed on a comprehensive strategy for vocations to the priesthood and reli-gious life. In June 1998 the U.S. bishops' committee on vocations sponsored a national symposium that had an overwhelming atten-dance. In addition, both the men's and women's religious leader-ship conferences--the Conferences of Major Superiors of Men (CMSM), the Leadership Conference of Women Religious (LCWR), and the Conference of Major Superiors of Women Religious (CMSWR)--are exploring how leadership corporately can be more active in promoting the priesthood and religious life. For the past thirty-some years, we have quietly and sometimes unconsciously watched more brothers leave our corigregations than Paul Bednarczyk CSC, of his congregation's eastern province, first published this article in Horizon, a journal for vocation directors. His address is Congregation of Holy Cross; 85 Overlook Circle; New Rochelle, New York 10804. Review for Religious enter them. We prayed for vocations, and many communities even maintained their commitment to a full-time vocation director, but few prospects have joined our prenovitiate programs. Although over the years there was a general concern about the lack of new members, still--because numbers of brothers remained in the "work force"--we felt somewhat comfortable regarding our num-bers. These days are now gone. Our congregations are aging, men are retiring, and fewer members remain in full-time ministry. Our younger members continue to be few. We must confront the new-membership question. Much has been written about societal factors that create a cli-mate unfavorable to religious vocations. Family and neighborhood structures are no longer what they once were. We are witnessing changing definitions of family: single-parent homes, blended fam-ilies, children being raised by gay or lesbian couples. In addition, physical, sexual, drug, and alcohol abuse have greatly impacted the trust and stability that families need. Individualism and mate-rialism have consumed our American culture. Authority is looked upon cynically and institutions are considered suspect. Combine that with young people's inability or reluctance to make commit-ments, and religious vocations become an uphill battle. The changing face of the American Catholic and the tension between Catholic teaching and American values also have an impact on the numbers of religious vocations. The rising multi-culturalism of U.S. Catholics challenges us. Many Hispanic peo-ple continue to abandon the Catholic faith of their ancestors for fundamental and evangelical groups. Polls claim that many Catholics believe that the church's teaching on contraception, homosexuality, and premarital sex is outdated. Although young adults in general do not see the difference between clerical and religious celibacy, they will say that celibacy is the primary rea-son why they would not be a priest or a religious. Likewise, given our democratic values, American Catholics must reconcile them-selves with a church that does not function democratically. I believe it important to mention these factors at the outset because, although they are beyond our control, they have an effect on our religious-vocation promotion. In this paper I intend to share my own reflections on why fewer people are choosing to be brothers. Although I belong to the Congregation of Holy Cross, I have shared some of these ideas with brothers in other religious congregations. We are not alone in our struggle. After five years Septentber-October 1999 Bednarczyk ¯ Religious Brothers as vocation director, I offer thoughts I have gleaned from numer-ous vocation talks I have heard and given, from many meetings and discussions withadolescents and young adults, from direct-ing men and women on both personal and group discernment retreats, and from my association with other vocation directors both regionally and nationally. 492 A Question of Visibility We religious brothers are invisible. To put it more precisely, people generally have no clear idea about who or what we are. I say this neither cavalierly nor despairingly, but as simple truth. Part of this is the reality that we are fewer in number. In the United States, according to thd 1998 official Catholic Directory, the number of religious brothers dropped in 1997-98 by 178, resulting in a national total of 6115. Of course, many of these are retired or infirm and therefore no longer engaged in part- or full-time min-istry- and so are even more invisible. Brothers in teaching congregations cannot assume that the freshmen entering our high schools in September know what a religious brother is. Even though some come to us from Catholic grade schools, many have not met a religious brother or sister and know little or nothing about religious life. If they do have a min-imal understanding oic our life, most likely their perceptions have been influenced by what they see in the media, which is often dis-torted, stereotyped, and scandal ridden. Their parents, too, a generation that had greater exposure to religious in classrooms and parishes, have limited understandings of religious life. They may have romanticized notions of who we once were or, on the other hand, may endlessly repeat stories of brothers and sisters maintaining uncompromising discipline and inflicting harsh corporal punishments. In addition, people are con-fused by the polarization of the various religious lifestyles. How do lay people find a balance among various extreme "liberal" and "conservative" positions taken by religious men and women? How do they understand community when the religious they know live in private apartments or are in scattered communities of twos and threes? Although there are justifications for various places on the spectrum, the average persons in the pews just do not understand. I think it safe to say that they are confused, just as we are at times. The question of visibility is more complex than the reality of Review for Relig~o~!s fewer members. It is, I believe, also related to a greater issue in the church. Without a doubt, within the past twenty years our church has become increasingly clerical. At a time when there are fewer and fewer priests, lay religious life is not always promoted in the church as enthusiastically or emphatically as it could be. In litur-gies all of us have heard public prayers for vocations to the priest-hood and privately wondered why we were not also praying for vocations to the religious life. I do not think these omissions are intentional. When I have respectfully asked presiders to include in their future prayers of petition a mention of an increase in candi-dates for religious life as well, I was usually met with sincere apolo-gies and a response such as "To tell you the truth, I didn't even think of it." Such admitted forgetfulness is disarming, but the response remains a telling one. Another reality is that many bishops and priests are "gun shy" of religious men and women. Since many of their dealings with us have been confrontational and neg-ative, it seems they may be choosing to either ignore or avoid us in order to avoid future hostile situa-tions. Likewise, we religious have suffered from our own antago-nisms with the clergy and the hierarchy, and we too may choose to either ignore or avoid them. My point is not to say that we are right and they are wrong, but rather that stereotypes and false generalizations held by either party only lead to further break-downs in communication and in understanding one another's voca-tions in the church. If we assume an "us and them" mentality, we add to the divisiveness that already exists here and there in our church, and it is the church, the people of God, that ultimately suffers from such internal strife. To pin the blame of our invisibility solely on the church would be both unjust and inaccurate. We brothers must own the fact that some of us have chosen to be invisible. In the neighborhoods of some of our communities, I would conjecture that most of the neighbors are unaware that there is a religious community of men living on their block. Instead of participating in the life of our local parish community, some of us have chosen instead to par-ticipate anonymously in a nearby parish that may provide a better liturgy or choir. At a time when many teaching congregations have made concerted and successful efforts at connecting the mission of We religious brothers are invisible. September-October 1999 Bednarczyk ¯ Religious Brotbers their schools with the mission and charism of their community, some brothers choose not to participate in school activities, often to the dismay and wonder of lay colleagues, parents, and alumni. Although reasons for these examples may be acceptable to us, we must realize that such choices promote further invisibility and anonymity, something which we brothers can no longer afford. Without a public presence, our hope for future vocations is dim. The old clich~ has much truth: "Out of sight, out of mind." Not being part of the clerical hierarchy has given us a unique freedom that is comfortable. I heard one brother say about the hierarchy: "It's good that they forget about us--this way they leave us alone!" We come to a religious community not to dis-tance ourselves from the existing tensions or authority in the institutional church, nor to find a supportive haven for our anger against church authority, nor, for that matter, to promote our own church agenda. As consecrated religious we are men of the church and in the church. Our vocation by its very nature calls us to deepen our baptismal commitment and our relationship with the people of God. The faithful see us and look to us for who and what we are: men who through our vows have consecrated ourselves totally to God and to service within the church. They expect us to be integral to the church: when they do not see this, they are surprised and confused. If we are going to welcome men into our communities, I believe that we must all realistically deal with our feelings and beliefs about the church of today--not the church of yesterday or tomorrow, but the church of today in all of its glory and weakness. Generational Differences The majority of us have lived through the social, political, and ecclesial turbulence of the 1960s. We experienced the devastation of political assassinations, the power of the people in working for justice, and the sense of betrayal and shame that resulted from Watergate. We mourned the violence and casualties of the Vietnam War and of the racial wars that were erupting in our city streets. We underwent our own personal and spiritual transformations after the drastic changes set in motion by the Second Vatican Council. Suddenly our equilibrium was shaken. We experienced a shift in values from uniformity to diversity, from authoritarianism to collegiality, from commonality to individuality. Review for Religious We dealt with these dramatic events and changes in a variety of ways. Some simply left religious life. It seems to have been a good decision for some, once they discovered they .may have become brothers for the wrong reasons. On the other hand, oth-ers left and we still wonder why. Regarding these departures we still grieve. And, into the bargain, some of us have stayed. What are our reasons for remaining? After these radical shifts in church, society, and culture, has our dependence upon God and one another deepened, or have we learned instead to place more trust in our own self and in our material security? Have our vows increased our joy and appreciation for life, or have they regretfully only made our life burdensome? Do we face the uncertainty of the future with excitement and hope, or with cynicism and despair? If we are to witness to an attractive lifestyle option, we must answer these questions honestly and reexamine our own commitment to religious life. Unlike many of us who were brought up with the order and constancy of a triumphal church, our young people today have experienced conflicting messages from a church in transition, and they seek, simply, truth. In the face of New Age spirituality and watered-down Christianity, there are those who, in their desire to know more of what it means to be Catholic, resort to tangible, traditionally Catholic symbols. I find it fascinating that Exposition and Adoration of the Blessed Sacrament is making a comeback on college campuses. In the midst of the noise and rush of their aca-demic lives, students appreciate the hour of silence in the pres-ence of Mystery. Similarly, young adults are rediscovering the virtue of Mary, and have found the rosary to be an attractive form of prayer that is identifiably Catholic. Some ofos may be quick to categorize these young people as conservative or wacky, but these are students who volunteer weekly at local soup kitchens and par-ticipate in "alternative" spring breaks with Habitat for Humanity. They are also class officers, athletes, and students on the dean's list. As I have discovered, our younger people defy the neat and tight boxes in which we tend to categorize them. Have our VOWS increased our joy and appreciation for life, or have they regretfully only made our life burdensome? Septentber-October 1999 Bednarczyk ¯ Relig4ous Brothers To live with the ideals, hopes, and dreams of the young is inconvenient and at times even uncomfortable. In my meetings with men who are exploring a vocation, I have found that it is not because of ministry, education, or social-justice convictions that they are drawn to religious life. Our church has evolved to where, if this were their primary desire, they could eas-ily do this in a Catholic institution as laypersons. They are com-ing to us first and foremost for the religious life itself. To live in the secular world as a committed Christian espousing Catholic values is difficult for them. They admit their need for a community of like-minded individuals who could strengthen their love for God and their Catholic convic-tions. They are not looking for just a nice group of people who do good work. They are looking for men who know and can lead them to God and who can give them a sense of hope in a world that has become increasingly pessimistic and destructive. They want to pray together, share their faith, and bring the Good News to people through their ministry. They acknowledge the Eucharist as central to our faith, and they have devotion to it. Since they often come from an unchurched, nontraditional back-ground, they seek structure and definition. From our community perspective, that is quite an order to fill! Some of you who are reading this are probably wincing and saying, "I thought we got away from that years ago!" To put it simply, I believe we find ourselves in the middle of a generation gap. Thirty years ago some brothers retained their habits, sat in their pews, and looked with distaste upon those who wore jeans and colored shirts and prayed on throw pillows. They thought that, for sure, religious life was quickly going down the tubes. The younger brothers, however, challenged the older brothers to renew their zeal for religious life by adapting to a different lifestyle, one that was based more on shared expressions of faith and on more interpersonal, communal living. Likewise, the younger members were taught by the elders to appreciate the tradition of our life and consequently were enriched by their fidelity to their vows in the face of change. Since some of us have lost a younger generation in our con-gregations, we have forgotten what it is like to be challenged by the young. The lively community dynamic that occurs with the mix- Review for Religious ture of generations--the elderly, the middle-aged, the young--does not happen in many of our local communities. As a result, many of us have grown comfortable with one another and in our life together. For the majority of us, the mutual challenges and exchanges that we all remember from our earlier years and that occur naturally between the young and old do not happen anymore. At forty-one years old, I am still considered one of the "young" brothers in my community. I realize that much of my religious life has been lived with men older than myself. Although I am thank-ful for the benefit of their example and wisdom, as I enter my own midlife I realize that I have been deprived of living with the con-tagious energy and enthusiasm of much younger religious. I know that I need at times to be challenged to think in new ways and to experience life differently. Most of us are middle-aged or older. If we are to have a newer generation following us, we must--even if it becomes increasingly more difficult as we age--be open to the renewal of our basic val-ues: prayer, community, and lifestyle. Ironically, those who are considering religious life look for deeper community experiences while some veterans of thirty or forty years say they are tired of the routine and demands in community. How do we bridge this gap? To live with the ideals, hopes, and dreams of the young is incon-venient and at times even uncomfortable, but I know of no other way. Although youthful idealism may need some tempering, we must admit that at least it is refreshing. We have now become the "older" brothers of yesterday, and, like the older ones of thirty years ago, we too are invited to new ways of thinking and being as we look to the next generation in religious life. I do not believe that age has to be a deterring factor. When I hosted discernment retreats for prospective candidates at our retire-ment facility, I would invite three of our elderly brothers to tell their vocation stories. The combined witness of almost two hundred years of faithful religious life is better than any vocation brochure I could ever design! Their authentic fulfillment in Holy Cross and their continuing joy and vitality were always evidence to these interested men that this life can be lived and can be lived well. Our young people look to their elders for inspiration. They hunger for the wisdom that comes from living a prayerful and reflective life with God. If, however, they see stagnation, apathy, and cynicism, they are left disillusioned and wanting. For many of us, our lives as religious have been deeply enriching and grace filled, and yet some September-October 1999 Bednarczyk * ReligiousBrotbers of us are reluctant to share these experiences with each other. We underestimate at times the power of our stories. In many religious congregations it has been the tradition to respond to "the signs of the times" and to the contemporary needs of the church. I maintain that we need to continue this spirit of openness not only to our mission and ministries, but also to our religious lives as well. The Answer Is in the Present I do not claim to have the answers for the future. To be truth-ful, my worry is not for the future, nor is it for the past. It is the present that is my concern. We can only theorize about the future, as we can only reminisce about the past. Such intellectual exer-cises tend to distance us from the responsibility of making neces-sary choices about our lives and our community in the present. In general, given the societal changes and challenges discussed above, some recerit shifts in our culture seem to coalesce with our lives as religious brothers. For example, our society displays a renewed interest in spirituality. Celebrities from Oprah to Madonna have made daily meditation chic again! With the pro-liferation of self-help and support groups for every issue imagin-able, people long for connection and belonging. They desire "to share their story" and to be validated by a group. Corporations are supportive of community service, and some school systems have included service components in their curricula. As a result, volunteerism is at an all-time high. Ironically, many authors are making lots of money with their best-selling books on how to sim-plify one's lifestyle. It would seem that religious brotherhood would somehow fit into this picture. Our life is a wonderful secret that needs to be shared more now than ever before. As religious brothers we bring, I believe, a special gift to the church. Our faith teaches us about a God whose love is uncondi-tional and whose mercy is unlimited. If faithfully and genuinely lived, our vows attest that fulfillment is to be found more in the transcendent than in the transitory. Where division and broken relationships characterize many families and marriages, our com-mitment to community life, despite its inherent struggles, myste-riously witnesses to welcome, order, acceptance, and equality. I have read many books and articles detailing futures for reli-gious life in temporary vowed commitments, lay associate mem- Review for Religious bership, satellite communities, blended communities, and so forth. All of that makes for interesting reading and good discussion, but I return to the question: What about now? How do we live now the vows we professed, however many years ago? Do we do so with the passion, zeal, and love of our early years? I do not believe that the answer to the challenges of our pre-sent situation is as simple as the reconstruction of past external structures. Our lives are much more complex today than they were thirty years ago. No one can deny that our traditional structures served us well, considering the church and spirituality of the time, but it would be naive to expect the former ways to meet our con-temporary needs. We can romanticize about the past, but we know that it is impossible to turn the clock back. I am, however, not convinced--at least in my own congrega-tion- that we are at present compelled to create new models and forms of vowed religious life. We do not need to reinvent the wheel. We need to insure that the wheel we already have is on the right track. Besides, since Vatican II, a number of experimental lay and religious communities have already been formed, imple-menting exciting new models of lifestyle and commitment. How they will fare in the future, only time will tell. I am convinced that as brothers we need to reclaim who and what we are. We are men of the church vowed to a life of poverty, celibacy, and obedience. We commit ourselves to a life of prayer and mission with each other in community. Given today's society and culture, these core values are what make us countercultural. Our vows are meant to be lived joyfully, with hope. This life was meant to be lived in relationship with God and with one another. Our challenging times invite us to probe and to enter more deeply into the essence of our vows and the mysterious grace that comes with this life. I believe in the gift of religious life, and particularly in the gift of religious brotherhood. I want a future for us because I believe the church would b6 lacking without us. Knowing how much I have been enriched by my own vocation to Holy Cross, I desire to share this gift with a new generation of religious. I am sure that the majority of members in our communities desires the same, but to do this requires conversion and a courageous open-ness to the Spirit that speaks to us today--and not yesterday and not tomorrow. [--z~00 September-October 1999 AVIS CLENDENEN II On Promise Making, Leave-Taking, and Becoming journeying It has been sixteen years since I requested and received a dispensation from my religious vows. The following reflection explores--from ethical, psychological, and theological perspectives-- the experience of malting and breaking promises and leaving the vowed religious life. Principally I will be drawing upon the ethical con-siderafions of Sister Margaret Farley RSM, the psycho-logical insights of Dr. Carl Rogers, and the theological depth of Father Karl Rahner SJ. These pages reveal a slice of an experience shared by many--that is, the mak-ing of a religious commitment, living in a vowed reli-gious community for years, developing bonds of trust and friendship, experiencing a crisis of fidelity, discov-ering the personal inability/choice to sustain the orig-inal commitment, and ultimately breaking the commitment and leaving religious life. A suspicion I had as I thought about examining the psychology and theology behind the making and break-ing of promises was that Rogers and Rahner had more than their first names in common. I sensed they shared a fundamental understanding of the human person, the Avis Clendenen PhD, associate professor of religious stud-ies and director of the Pastoral Ministry Institute, teaches pastoral theology and ministry at Saint Xavier University in Chicago, where she can be reached: 3700 West |03rd Street; Chicago, Illinois 60655. Revie~v for Religimts human dilemma, and the graced and flawed human quest of becom-ing whole and free. The following reflection reveals some signif-icant connections between Rogerian psychology and Rahnerian theology and offers a way of viewing the painful process of leave-taking and becoming. The painful and hopeful contours of this all-too-familiar experience can be traversed again in openness to the possibility of deeper revelations about the choices we make that sustain our word of love. Sixteen years from my departure after a thirteen-year commitment gives me perspective and a desire to return and examine the process of making promises, breaking promises, and becoming. In the fall of 1969 at nineteen years of age I entered the Sisters of Mercy. My letter of request to enter was all of two paragraphs composed by a nineteen-year-old touched and transformed, as late teens can be, by the turbulent events of the 1960s: My reason for choosing religious life as my way of life is because this in the only life that makes sense to me, as an individual. I want to express my life as a commitment of love to God and His Church. I am not quite sure why there is an attraction to the Mercy order in particular, but I believe my potential for giving and receiving, of freedom and ful-fillment, lie within this community. By the time I would profess my final vows in 1978, all refer-ences to God in the masculine pronoun were to be stricken from my vocabulary. By 1978 1 would be a graduate of the Jesuit School of Theology, having been the first woman admitted to its master-of- divinity program. Throughout the 1970s I struggled with the weight of a patriarchal church, including the graces and conflicts surrounding the inclusion of women in all ministries of the church. I would, over the expanse of years, come to greater clarity as to my "attraction" to the Sisters of Mercy as women of valor and vision, with a deepening sense of gratitude for the reciprocity of our rela-tionship. The issues of freedom and fulfillment became bemus-ing, and the turbulent times never did seem to abate. At thirty-three years of age, thirteen years after my entrance and less than four years after my final profession, I received a dis-pensation from my vows of poverty, celibacy, and obedience. The following are excerpts from the letter I wrote to the provincial administrator, initiating the formal leave-taking process: To try and summarize all the spiritual and psychological investigations I have done would be an injustice to all that has September-October 1999 Clendenen ¯ On Promise Making, Leave-Taking, and Becoming gone into this decision. To say too little would be an injus-tice to the quality of relationship I have shared as a Sister of Mercy throughout these years. I feel great pain as I accept responsibility for breaking my promises. But it was the pain of remaining in religious community that finally made the decision. I have asked myself again and again about the truth and integrity of the final commitment professed in 1978. That moment expressed the insight and honesty that was available to me; and while only four years ago, it's been a lifetime. In the months I have lived alone, I have read all the journals from my thirteen years as a Sister of Mercy. I saw the patterns of my struggles repeated year upon year. I read and remembered delightful times in community. My loneli-ness lines many pages. Notes from numerous retreats reminded me of my love for God. And, oh, the growing rage at the institutional church as it demeaned me and our efforts for women's voice and body to be celebrated all places, including the altar. I do not believe that in asking for a dispensation from my religious vows I am walking away from the vision of Catherine McAuley, the works of mercy, the body of Christ, or the commitment with feminists to liberate ourselves from the patriarchy. I am stepping away from a vowed relationship among you. I promised to persevere for life. I believe I per-severed until there .was no more life for me. I am so very sorry. I do not look for understanding, I~ut I will always expect compassion for that is why we bear our name. For the compassion that has been shown me and I have shared with you, for the years of service given expres-sion to as a Sister of Mercy, for the treasured moments and persons, I will always be grateful. I remain a believer and a daughter of Catherine McAuley. I hold now with courage and trepidation her legacy, my Bible, and I turn a corner. And trust. To Give One's Word Yale University Professor of Christian Ethics and Sister of Mercy Margaret Farley's tough thinking on the meaning of fidelity and its claim of obligation form an important frame of reference in analyzing whether one has the moral sanction to end a com-mitment. Sister Margaret Farley wrote her book on commitment in the late 1980s, when the permanency of commitments in American marriages teetered at a fifty-percent divorce rate and when "defection" from the priesthood and religious life in the Review for Religious American Catholic Church continued to deplete the ranks of ordained and vowed Catholic ecclesial leaders. For many years I successfully avoided Margaret Farley's 1986 book Personal Commitments: Beginning. Keeping. Changing. Research for this article inevitably led me back to her work and the challenges to think hard about why we give our word in mak-ing commitments, why we are obliged to keep them, and under what circumstances we may be morally released from them. Farley suggests that the rise of the human-potential movement served to shift the goals of many from the challenges of permanent commit-ment, fidelity, and responsibility, toward the increasing warrant of the call for per-sonal growth and self-actualization. It was as if these two venues for being and becoming were mutually exclusive. Those who had previously interpreted their life in terms of a religious vocation began to claim the. need to transfer voca-tion from one locus to another. "It was not always easy to tell whether these were expressions of faithfulness or of irresponsibility and betrayal."' What does it mean to say you make a promise with a sense of its truth and integrity and then years later suggest that your insights and sense of integrity have changed so signifi-cantly as to justify a breaking of the bonds and a release from obli-gation? Is emotional pain and lack of personal fulfillment sufficient cause to be dispensed fr6m the vows professed in an act of freedom, a free action always given into the hands of an uncertain future? As Farley eloquently explains, commitment has to do with the free action of free persons who give their word as part of them-selves. Commitment m~ans to give my word because that word belongs to me and I freely choose to entrust it to another's keep-ing. In a sense, commitment means to share with one or more per-sons claims on my being there in a promised way with and for them. While my word is "given away," paradoxically I still pos-sess it because it is myself. In commitment we freely take on an obligation to do as we have promised. The motivation for the kind of commitment we are discussing here is always love. "By assuming certain frameworks for love, we Is emotional pain and lack of personal fulfillment sufficient cause to be dispensed from the vows professed in an act of freedom, September-October 1999 Clendenen ¯ On Promise Making, Leave-Taking, and Becoming commit ourselves to whatever we understand essentially to con-stitute this framework."2 The profession of religious vows to be lived in the mic

Issue 16.5 of the Review for Religious, 1957. ; A. M. D. G. Review for Religious SEPTEMBER 15, 1957 God's Living Sermon . Bonaventure Balsam Dismissal in Lay Institutes . Jo,eph g. ~,allen Our Supernatural Organism . Daniel J. M. Callahan Book Reviews Questions and Answers Roman Documents VOLUME 16 NUMBER 5 RI::VII:::W FOR RI:LIGIOU.S VOLUME 16 SEPTEMBER, 1957 NUMBER, 5 CONTENTS GOD'S LIVING SERMON AND MYSTERY-- Bonaventure Balsam, O.P . 257 DISMISSAL OF RELIGIOUS IN LAY INSTITUTES-- Joseph F. Gallen, S.J . 265 SOME BOOKS RECEIVED . 292 OUR SUPERNATURAL ORGANISMu Daniel J. M. Callahan, S.J . 293 OUR CONTRIBUTORS . i99 SURVEY OF ROMAN DOCUMENTS--R. F. Smith, S.J . 300 QUESTIONS AND ANSWERS: 29. Professed of Temporary Vows and Return to Motherhouse for Perpetual Profession . " . '.309 30. Adaptation and Renovation and New Laws on Poverty . 310 31. Last Gospel According to the Simplified Rubrics .312 32. Masses. Permitted on the Saturday of Our Lady . 312 33. Personal Gifts and Poverty . 312 BOOK REVIEWS AND ANNOUNCEMENTS: Editor: Bernard A. Hausmann, S.J. West Baden College West Baden Springs, Indiana . 313 REVIEW FOR RELIGIOUS, September, 1957. Vol. 16, No. 5. Published bi-monthly by The Queen's World, 3115 South Grand Blvd., St. Louis 18, Mo. Edited by the Jesuit Fathers of St. Mary's College, St. Marys, Kansas, with ecclesiastical approval. Second class mail privilege authorized at St. Louis, Mo. Editorial Board: Augustine G. Ellard, S.J.; Gerald Kelly, S.J., Henry Willmering, S.J. Literary Editor: Robert F. Weiss, S.J. Copyright, 1957, by The Queen's Work. Subscription price in U.S.A. and Canada: 3 dollars a year; 50 cents a copy. Printed in U.S.A. Please send all renewals and new subscriptions to: Review for Religious, 3115 South Grand Boulevard. St. Louis 18, Missouri. God's Living Sermon and Myst:ery Bonavent:ure Balsam, O.P. WE CANNOT LOVE, reverence, and respect what we do not know: A religious priest, brother, or sister will never love and appreciate his life and vocation as much as it is lovable unless he first sees and tastes the indescribable nobility of that vocation. We begin to evaluate a thing rightly only when we begin to see it, to understand it, rightly. Misguided love follows on misguided and false knowledge, detestation often follows on the footsteps of ignorance. To a very great extent, the intensity' and scope of our love will depend on the genuineness and grasp of our knowledge. All religious preach God. They do so, not so much by word of mouth as by their whole life. Their preaching--and this is the judgment of the great minds of the Church- since it is by action, can make a far deeper and more lasting im-pression on the world than any or all the sermons preached in Notre Dame Cathedral. For religious are their own sermon and their own cathedral. In preparing and preaching .their sermon to the world, they must study, not so much the spoken word, as the far more powerful and vocal deed. If .we could summarize in a few words the influence which it is the role of a religious to have on the world about him, it is this: it is his vocation in life to teach the whole world this v~ery important lesson, "We have here no lasting city, but we look for 6ne which is to come." By their life, religious must preach that lesson to the world. It is the holy and privileged task of every religious to make the world unworldly, to teach the world to be divine, and to lift up the mind and heart of the world to God in one great offertory. The vocation of a religious is brought home to him every day in the Preface of 257 BONAVENTURE BALSAM. Review for Religious the Mass; he is to lift up the heart of the world to God in love, "Sursum Corda.'" And where a religious does not find love, he must see to.it that God puts love there. As St. John of the Cross says: "~ 'here there is no love, you must put love." To preach that sermon with its double element of detachment from the world and clinging to God is the vocation, par rxcellence, of every religious brother and sister. In a special way, and by special right, religious can apply to themselves the words of the same St. John: "The life of every religious sho~,ld be a complete doctrinal sermon." The life of every religious is one continuous paradox, a divine anomaly. Religious must love the whole world and everyone in it; yet they must ceaselessly try to keep it dis-satisfied with itself, discontented. Their life is one of opposi. tion to the spirit of the world and its maxims, one of constant disagreement and protest. That is a most unenviable task; and, like all opposition and protest, it brings with it much enmity and misunderstanding. That is why the-world often and in many ways misunderstands religious and scorns them. That is why, too, religious sometimes misunderstand them-selves and their role in the salvation of the world. In walk-ing down the street, every step a religious takes is a sort of step of protest, of admonition. He protests to the world and warns it that the glitter and tinsel meeting the eyes on all sides are all too ephemeral and passing and petty and that the only One worth living for and loving with every fibre of one's being is God. The way that they teach this to the world which they live in, but away from, is a most efficacious one. Religious preach to the world by the daily living of their vows which make their life unearthly because heavenly. By their vow of poverty religious lecture on the unending wonders of divine Providence. They lecture on that subject though they may never actually utter a word about it; they do not have to, for they live their subject. By the mere fact that they have freely and gladly relinquished all claim and aspira- 258 September, 1957 GOD'S LIVING SERMON tion to this world's goods, religious proclaim to the world that they trust in God's divine providence with an unshakeable confidence and that "possessing nothing, they have all things." For they have learned to "cast your care upon the Lord, who cares for you." Religious daily experience the truth of St. Paul's words: "As needy though enriching many; as having nothing and possessing all things." By that childlike confi-dence in divine Providence, a confidence solidified andmade a very part of their life and reridered inamissible, as it were, by their vow of poverty, religious take at face value the loving promise of our Lord that, if God is ever careful to feed the birds of the air and clothe the grass of the fields, will He not take infinitely greater care of a religious who is of much more value than they and the rest of the material universe combined? Moreover, by their vow of poverty religious te.ach a materialistic world an important lesson in divine economics, for they teach the world a proper sense of values, a divinely wise and exact evaluation of all creation. Religious appraise things for what they are--and are not--and proper ap-praisal of a thing is indispensable for its true appreciation and enjoyment. One can never love a thing rightly until one knows its true value; j~ust as one can never know its worth unless one knows the value God places on it. All of which means that we can never love a creature rightly except in and through God Who makes it worth whatever it is. In teaching mankind all this by ~he daily living of their vow of poverty, religious are teaching a most wise lesson. In so doing, they themselves become more wise and share their wisdom with others. For it belongs to the wise man to order and evaluate things rightly. By their vow of chastity, religious teach the world another saving lesson; they teach a selfish and unsacrificing world the value of sacrifice. Religious teach the world the fruitfulness of unfruitfulness. They teach the world that in order to win more of the children of God they have given them up. Relig- 259 BONAVENT~JRE BALSAM Review for Religious ious teach a grasping world that, in order to gain what is really worthwhile, one must lose what is really not worthwhile. They teach the world that oi~ten the only way to conquer is to surrender and that everything that one gives up for God he gains back again in God, and "pressed down, in good measure, and flowing over." And God besides. Religious give up a lesser privilege t~or a .greater one; they t~orego the privilege of bringing children into the world because to that privilege they pret~er the greater privilegi~ of bringing God into the world. So, in actuality, the chaste brotherhood or sisterhood of a religious is far more fruitful and noble than wedded t:ather-hood, or motherhood. There is something more that religious can do t~or the world and for God's children which often goes unappreciated even by themselves. Religious should realize the element of personal reparation and vicarious atonement inherent in their vow of chastity./ Vices are not only expelled, but are most fittingly atoned for, by. their opposite virtues. Religious are God's "chosen pedple." They stay the avenging hand of God by the purity of their lives. God, in looking upon the un-earthly purity of His religious, is moved to forgive the morass of impurity in which a great part of mankind is floundering and to give it grace to repent and change its evil ways. Here, again, the life of religious is a living protest to a "wicked and adulterous generation." The protest they lodge against the world is the silent protest ot~ their unassuming though uncon-cealable modesty and purity which, "like a city seated on a mountain top, cannot be hid." By their entire and absolute chastity, religious work to make this carnal world into a holy and pure generation. They must offer up their chastify, which makes them akin to the angels, as a protest to the world and and as a propitiatory sacrifice for its unspeakable impurities. Only the pure o~ heart will ever see God,. and they alone will be able to show God to others. God makes use o~ the conse-crated purity ot~ a religious to sterilize the world ot~ its in~ection 260 September, 1957 GOD'S LIVING. SERMON of impurity. Thus the~ freely chosen childlessness of religious is, .indeed, most fertile of good--their holy barrenness begets countless children of God. By their vow of obedience, religious proclaim to the world that the root of all sin lies in inordinate self-love and inordinate self-will. And they teach the world the remedy fo~ this ill. By their obedience, religious tell the world that the only way to escape out of the maddening labyrinth "of self and selfish-ness is to take one's will in both hands and exchange it for the #111 of God by riveting it to His most Sacred' Heart. The o~nly way to be truly free is.to serve m to serve God without stint. In this exchange of wills one's own narrowness and smallness are exchanged for the infinite generosity of God. The stagnate pool of selfishness ,is displaced by7 the restless sea of love which is God's holy will. And since the will of God is the cause of all good; since, too, religious have exchanged their will for His by vow, then they too will bring into the world and into the lives of men unlimited good. Religiods, by the life they lead, will diffuse through the universe some of the infinite goodness of God. In this vowed exchange of wills with God, religious be-come more and more sinless. For the more God's will dis- 'places theirs and becomes the motive force of their life and actions, the more religious approa.ch the state of impeccability --the impeccability of God's holy will. Hence, the more and longer God's. will works in them, the less will they fall into daily sins and faults, and the more they will do, and diffuse, good about them. The world seeing this transformation in religious, their own fellowmen, will first wonder at them, then admire them, and finally imitate them. And when the world imitates them, religious thus renew the face of the earth. They and the life they live. Besides being a living sermon on G~d, every religious is a living mystery also. Religious must have all the elements 261 BONAVENTURE BALSAM Review for Religious about them of a true mystery of faith. They must be thor-oughly supernatural. They must think, will, and act always on a supernatural plane. They must survey the whole of their own life and every event that befalls them from that super-natural ~vantage point, from the loft~; peaks of faith. Their viewpoint, their perspective of everything will always and every-where be determined by faith. Nothing will be purposeless; everything will be judged according to a divine pattern. All their assignments, and the minutest details and circumstances surrounding those assignments, must be looked upon and judged with the eyes of faith. The hardships and crosses of a par- ' ticular assignment, the trials and difficulties attached to an act of obedience, the misunderstandings and false accusations that may dog their steps, all these must be seen in their supernatural light. They must be seen as~having a definite .place in God's plan for their sanctification and salvation. Never will religious live on the merely natural level mthe level of those who have no faith. Rather, they must, under all circumstances, "live in such a way that their life would not make sense if God did not exist." God and their great faith in God must determine every decision religious make, must be the heart in every one of their motives for acting. By profession, and even more by religious consecration, religious belong to God and are familiar with God's ways. But religious are a living mystery for more reasons than that. As in the case of every' mystery, their life is one of im-penetrable paradox. Religious are in the very midst of the wo~ld, though they can never claim any of it as their own. By profession, they are consecrated down to their fingertips. Though they are vowed to seek after that peace which only God can give, still they are ever stirring up discontent and dissatisfaction. They are ever fomenting a rebellion against the ways of the world. A religious is an aposde of elevation; his whole life tends to. raise the general worth and standards of. mankind by the 262 September, 1957 GOD'S LIVING SERMON unearthliness and loftiness of his own life. He is the divine yeast in the rather inert and formless mass'of humanity without God. He is what the priest has been called, "the minister of restlessness." In looking upon his life, the world is wounded with a sort of tormenting longing for the divine. A religious may be rightly called "an apostle of the abso-lute." He is ever on a relentless search, a quest, not for that which is merely good, but for that which is God, for the Per-fect. His very religious consecration makes him ever a pilgrim, ever a foreigner to this wor/d, and en route to see the face of God. Whatever he finds, good, whether in himself or in others, he must ever try to make better. He is gripped by a continu-ous and divine unrest, which, oddly enough, is the great source of the profound peace which surrounds his life. That unrest takes the form of a hunger to be more united to God, though he knows full well that divine union must entail the painful surrendering of deep-seated attachments. It entails turning a deaf ear to the unending call of the flesh to pla~ riot in the warm fields of its pleasures; it entails purging out of one's spiritual organism the multiplicity of sins which plague it and keep it undeveloped, ~tunted, and impede its more complete union with God. All this means pain, struggle, denial, sacri-fice, and death. But the religious is equally aware that in the midst of all this struggle to embrace his God and never to let Him go there is a joy that makes all this tremendous effort and strife insignificant, short-lived, accountable as nothing at all. He knows that the more he peels away the outer bark of bitter self, the more he sees and tastes of the fruit of God with-in. He knows that the sufferinss of these times are like seasoning, sharp and bitter, but necessary to taste one's God, indeed to consume Him in love. Like ev.ery mystery, the religious .must remain beyond. the ken and grasp of the generality of mankind. He will be misunderstood, his actions misconstrued. So lofty and extra-ordinary is his life that those who see only with a fleshly eye 263 BONAVENTURE BALSAM will say that it is impossible or a huge deception. He will be considered a cowardly fugitive from the world, from reality; 'whereas, in truth, he pursues thd world in its flight from God, takes it in his arms as a father does a recalcitrant child, and offers it up to God in love. Instead of being a dreamer, as he is accused of being, he is the world's greatest realist, for he knows and appreciates God, the cause of all reality, and claims Him as his very own possession and gift to the world. Since he is a sort of special creation of God, the religious must remain unknown; he must n~ver become profane. When his life becomes common, banal, vulgar, a byword among the people, he is no longer a living and sacred mystery; he is now common knowledge. He has then lost that necessary quality of' super-naturalness. He must ever remain like a beautiful tree with its roots hidden in the earth and its head and heart in the heavens. Every religious is a living mystery. Like every divine mystery, he must be accessible to all those who ai, e seeking God. He and his life must ever be a source of awe for the world. Being a pilgrim and an apostle of the absolute, of perfection, he must keep the world dissatisfied, discontented with its smug and mediocre ways. He must be .the tangible and living expres-sion of the life of God and the degree in which it can be shared by grace. His life must be one of elevation, of an offertory. Sworn to pursue perfection, he must make himself and the world one grand host of love offered up to God in adoration, thanksgiving, petition, and atonement. From ttie rising of the sun even to the going down thereof, the religious must be a liv!ng mystery and sermon of God. 264 Dismissal ot: Religious in Lay Insfit:u es Lloseph g. Gallen, S.,J. 1. Definition. Dismissal is the compulsory departure from a religious institute during the time of the vows of the religious. Any religious, whether of solemn or simple vows, perpetual or temporary, may be dismissed. Dismissal is effected by the de-cree of the competent superior and by law, ipso facto, or automatically because of the commission of any of the crimes specified in canon 646. The present article is confined to the dismissal of religious in lay institutes. However, the norms are the same in other institutes for the dismissal of a professed of temporary vows and also for men of perpetual vows in a clerical non-exempt institute. The canonical prescriptions for the dis-missal of a clerical or lay religious man of perpetual vows in a clerical and exempt institute are likewise the same as in a lay institute of men except that in the former the crimes, admoni-tions, and incorrigibility must be proved in a judicial process. The provisional return to secular life is essentially the same in a clerical exempt institute (cc. 653; 668). The laws of the code and of the particular constitutions must be accurately' and sincerely observed in a dismissal. They were enacted to protect the rights of both the institute and the individual religious. It is very likely that an unusual number of highly unsatisfactory religious justifies a complaint against facility of admission and retention during the probationary periods rather than against the difficulty of dismissal. It is evident, also that the age of the religious is to be considered before deciding on the formalities of a dismissal, even though this is not mentioned in the code. Older religious should be dismissed only for most serious reasons. Their adjustment to secular life, especially in the case of a religious woman, is obvi-ousl'y more difficult. A religious whose conduct merits serious 265 JOSEPH F. GALLEN Review for Religious thoughts of dismissal should practically always be first encour-aged to ask for an indult of secularization. Those who are found certainly unsuitable at any time during temporary pro-fession are to be counseled to ask foi: an indult of secularization rather than to wait until the voluntary departure or exclusion at the expiration of temporary vows. I. Competent Authority for Dismissal by Decree and for Final Adjudication of Provisional Sending Back to Secular Life . 2. In pontifical congregations. (a) For professed men and women of temporary vows (c. 647, § 1). The competent authority is the superior general with the deliberative and secret vote of his council. In the few constitutions where his part in any dismissal is mentioned, it is prescribed that the pro-vincial should consult his council before proposing a dismissal to the superior general. The provincial will usually, in fact, initiate a dismissal by proposing it to the superior general, Since the matter is one of greater importance, in prudence he should at lea~t ordinarily consult his council before doing so. (b) For professed of perpetual vows. 1° In congregations of men (c. 650, § 2, 2°). The superior general with the consent of his council is competent to decree the dismissal, but his decree has no effect until it is confirmed by the Sacred Congregation of Religious. 2° In congregations of women (c. 652, § 3). The Sac/ed Congregation of Religious alone is competent to decree the dismissal. 32 For professed of temporary or perpetual vows in diocesan congregations of men or women (cc. 647, § 1; 650, § 2, 1°; 652, § 1). The competent authority in all cases of men or women is the ordinary of the diocese where the house to which the religious is attached is located. The ordinary of the diocese of the generalate is competent only for religious attached to houses' in his diocese. In virtue of canon 647, § 1, the local ordinary may certainly initiate the dismissal of a professed of temporary vows. He probably possesses the same .right with regard to professed men or women of perpetual vows.' If the 266 September, 1957 DISMISSAL IN LAY INSTITUTES ordinary initiates the dismissal, he is obliged to inform the superior general before dismissing the religious. He is also obliged to give consideration to the reasons the superior gen-eral proposes against the dismissal and is forbidden to dismiss a religious, if this superior ha~ just reasons against it. If he does so, the superior general has the right of recurring to the Sacred Congregation of Religious. 4. Societies living in common without~ public vows (c. 681). The norms of dismissal for pontifical and diocesan religious congregations ~pply also to these pontifical and diocesan socie-ties, i. e., the norms for the professed of temporary vows apply to members whose bond is temporary, those for religious of perpetual vows to members whose bond in such a society is per-petual. 5. In monasteries of nuns. (a) For professed of temporary vows .(c. 647, § 1). If the monastery is not subject to regu-lars, the competent authority is the local ordinary of the mon-astery. If the monastery is subject to regulars: two opinions are probable, i. e., the competent authority is either only the regular superior or, the more probable opinion, the regular superior and the local ordinary acting conjointly. (b) For professed of perpetual vows (c. 652, § 2). The competent authority is the Sacred Congregation of Religious, but all the documents and acks of the case are to be transmitted to the congregation by the local ordinary of the monastery with his own vote and that of .the regular superior, if the mon-astery is subject to regulars. 6. Obligation of competent authorities. The competent au-thorities, as well as the superior and his council who propose a dismissal to such authority, have a grave obligation in con-science to observe the norms for dismissal imposed by canon law (cf. c. 647, § 2). ~ Tabera, Corntnent,~rium Pro Reli]io$i$, 13-1932-124-25; 14-1933-35; Schaet:er, De Religiosis, n. 1602; Quinn, Relation of t/~e Local Ordinary to Religious o/ Diocesan/l$/~ro¢,al, 103-105. 267 JOSEPH F. GALLEN Review for Religious . II. Dismissal by Decree of a Professed of Temporary Vows (cc. 647-48) 7. Sufficient" reasons for dismissal. (a) ' General principles (c. 647, § 2, 1°.3°). The authority dismissing a religious of tem-porary vows must have. moral certainty, i. e., a judg,ment that excludes a founded doubt, of the existence and sufficiency of the reasons. The reasons must be external to the extent that they are known by others. They mu~t also be ~sekious'or grave, which does not imply serious moral culp~ibilit~ or any culpa-bility at all. The general principies on the sufficiency 0f the reasons are that it is to the good of the institute not to retain the subject; the institute will suffer a notable harm or serious incon;cenience in retaining him; there is no hope that ~he reli-gious will be able to conform his life in a creditable or praise-worthy manner to the demands of .the constitutions; "lie lacks the general aptitude for the religious life or the special aptitude requisite for the spiritual life or works of. the particular insti-tute; and any reason is sufficient that is of the same or greater import than that stated by way of example in canon 647, § 2, 2°, i. e., a defect of religious spirit that 'is a cause of scandal to others. It is probable, as under exclusion from a further profession,~ that after more than six prescribed years in tem-porary vows a religious may be dismissed or~ly for reasons that are sufficient to dismiss a professed of perpetual vows. (b) Particular sufficient reasons (c. 647, § 2, 2°). A sufficient reason on the part of the institute is the lack of aptitude stated in the preceding paragraph. Sufficient-reasons on the part of the religious himself can be reduced to intelledtual defects, which is included under aptitude above, to health, which will be explained below, and to moral defects. Moral defects constitute" tl~e principal motive for dismissal. The code mentions only one sufficient cause of dismissal by way of ex-ample, and this is a habitual moral defect, i. e., a defect of 2Cf./IEwsw FOg RELXG~OL~S, July, 1957, 216-18. 268 September, 1957 DISMISSAL IN LAY ]INSTITUTES religious spirit that is a cause of scandal to others. This defect can be ascertained from the conduct and motives of the religious and from the effect of his conduct on others. Such a religious seems to lack all supernatural motives, and' acts almost constantly from those that are purely natural. He is de~oid of love, attachment, and devotion to the religious life and its duties. His transgressions arise from habitual negligence, sloth, weariness, perversity, and ill will, not from accidental weakness and frailty. He ,manifests little care or effort for per-sonal sanctification. In his conduct he "habitually violates the constitutions, rules, customs, and usages of the.institute, even if not in relatively serious matters. He obeys superiors with diffi-culty in matters that are not strictly commanded. He habitually omits, performs carelessly, or places little value on religious exer-cises. In its effect on others, the conduct described above is already scandalous in a person consecrated to God. Such conduct and the fact that .the motives and state of his will externally manifest themselves decrease in others respect and 'devotion to the religious life and its duties and make observance of religious disci-pline by others more difficult. Often there, is added the direct insti-gation of others to violations of religious duties and discipline. Among the equivalent habitual moral defects are the follow-ing. 1° Obedience. Habitual, unwilling, and grudging obedience; .habitual murmuring against and criticism of superiors; habitual negligence in fulfilling duties assigned by superiors. 2° Poverty. Repeated violations of the vow and of common life, even if not in serious matters. 3° Anger. One who is habitually quarrelsome or has an" ungovernable temper that~ breaks out in frequent and serious fitsof anger and causes frequent disturb-ance of the peace of the community, loss of peace of soul, insults, and injuries to companions, .and dissensions in the community. 4° Charity. One who is addicted to faults of the tongue that annoy, disturb, or provoke others to quarrels, Or that consist of frequent calumnies, detractions, imprudenc~e in speech or violations of secrets. 5° Disturber of the peace. A 269 JOSEPH F. GALLEN Review for Religious habitual disturber of the peace of the community who creates or fosters dissatisfaction, dissensions, factions, or provokes to quarrels. 8. Necessity of repeated admonition and salutary penance with-out effect (c. 647, § 2, 2°). Any habitual moral defect is a sufficient reason for dismissal only when a repeated admonition together with a salutary penance has produced no effect. The code demands only that the subject should have been admon-ished at least twice, orally or in writing, secretly or in a manner /hat can be proved, by a local or higher superior, to reform his conduct. Canon law does not require here that the admoni-tion be given in virtue of a mandate from a higher superior or that a threat of dismissal be. added to the admonition. The salutary penance to be added to each admonition i~ one suitable for effecting the reform of the religious and the reparation of the scandal" already given. It will consist of the penances in use in the particular institute, e. g., recitation of determined prayers, an act of humility, or a public acknowledgment or reprehension of defects. A sufficient period of time is to be allowed to pass "after the second admonition to permit the religious to reform his conduct. After this period, if he has ¯ nbt reformed his conduct to such an extent that it can no longer be considered a sufficient cause for dismissal, he may be dismissed. Both for the reform of the religious and proof in the eCent of dismissal and recourse, the more secure and prudent ¯ dgctrine is to be followed in practice, i. e., a threat of dismissal is to be added to each admonition and the admonition and penance are to be given in such a way that there will be proof that both were given and received. This can be accomplished b'y¯giving the admonition and penance before two witnesses or in writing. A copy of such a document is to be retained. by the institute. 9. A single act as a sufficient reason. A religious of temporary vows may be dismissed because of a very serious single act, 270 September, 1957 DISMISSAL IN LAY INSTITUTES e. g., a grave external s_in against chastity; formal contempt of the authority of superiors; violation of a formal precept .of obedience; an act that creates a danger of notable harm or infamy to the institute; serious scandal given once or twice in the community, or what is more serious, to seculars, when there are indications that the same thing will happen again.-~ A pro-fessed of temporary vows who becomes a fugitive from religion or does the same thing as an apostate from religion, even though he cannot technically be called an apostate because he is not in perpetual vows, may be dismissed because of either of these acts. :~ 10. Insul/icient reasons (c. 647, ~ 2, 2°). The statement of the religious that he never possessed or has lost a religious vocation or the mere agreement of the institute and the religious that he be dismissed are insufficient reasons. In either case, the religious, giving all the reasons that actually exist, may ask for an indult of secularization or may wait and depart at the expiration of temporary vows. Ill health is a sufficient reason for dismissal only if it was certainly fraudule.ntly concealed or dissimulated before the first profession of temporary' vows. Everything said under exclusion from a further profession because of ill health, lack of ability arising from ill health, ailments such as hysteria and neurasthenia, and insanity apply here also.~ 11. Procedure (c. 647, § 2, 3°). No special process is pre-scribed for attaining certainty of the existence and sufficiency of the reasons for dismissal nor for decreeing the dismissal. If it is d~cided to proceed to dismissal, the .necessary preliminary data should be written out first, i. e., the religious and family name of the subject, age, date of entrance into the postulancy and noviceship, date or dates of temporary profession, and the houses and employments to which the religious had been assigned. To this should be added a brief and accurate descrip-tion of the previous conduct of the religious. The formalities 3 Cf. REVIEW FOR RELIGIOUS, May, 1957, 162-63. -1 Cf. REVIEW FOR RELIGIOUS, July, 1957, 219-20. 271 JOSEPH F. GALLEN Review for Religious of dismissal are practically always preceded by a protracted period o'f most unsatisfactory conduct. The decision on dis-missal is then to be studied and obviously with the greatest care. The matters to be decided are whether certain proof is had of the existence and sufficiency of the reasons, of the admonitions given privately and of those given in writing or before witnesses with a threat of dismissal, and of the lack of effect, of these admonitions. Proof of the existence of the reasons will ordinarily be from signed statements of local superiors and councilors, principals of schools, companions in religion, etc. Canon 647, ~ 2, 3°, prescribes that all the reasons for dismissal, not the proofs nor the names of the witnesses, be manifested to the religious orally or in writing before dismissal. The proposal of the reasons in writing is preferable for proof. The religious must be given full liberty and a su~cient amount of. time to reply to the charges. He is .to be counseled to reply in writing. If his replies are given orally, they are to be taken down immediate!y in writing and he is to be requested to sign them. If he refuses, this is to be noted in the document on which his replies are given. His replies are to be submitted fully to the authority competent for dismissal. Everything given above in this number should have been followed also by the superior general and his council in a diocesan congregation and the superioress and her council in a monastery of nuns before tl~e written petition for dismissal is forwarded to the competent authority. The vote of the council should be given in writing to this authority. In a monastery of nuns, this vote must be deliberative.~ In a diocesan .congregation, the superior general will present the petition for a dismissal to the local ordinary; but the constitutions will frequently require the con-sultive or deliberative vote of his council for such a petition. The local ordinary and the regular superior must have certainty ~Cf. Tabera, Commentarium Pro Religiosis, 12-1931-372-73; Larraona, ibid., 2-1921-364-65; Schaefer, 010. cir., n. 1584. 272 September', 1957 DISMISSAL IN LAY INSTITUTES of the existence and sufficiency of the reasons alleged in the representations of the superior. They accordingly have the right and duty of investigating the existence of the reasons, although this is usually proved in the proposal of the superior, and of weighing the seriousness of these reasons. 12. Dismissal. If the decision is for dismissal, a decree" of dismissal should be drawn up containing the date, name of the religious, the reasons for dismissai, and the statement that the religious is therewith informed of his right of suspensive recourse against the decree to the Sacred Congregation of Religious. The decree should either be read to the religious or he should be given a copy of it. Either the original-or a copy of the decree and of all the proofs and documents in the case is to be retained in the files of the institute. It would be well to give the religi-ous a written statement to the effect that he was l~gitimately dismissed from the institute and freed of all his vows and obligations. In the presence of two religious as witnesses, the dismissed religious is to be asked to sign the following or a similar docu-ment after it has beenread to him. "I realize that I am hereby informed that'I have the 'right of recurring to the Sacred Congregation of Religious against this decree of dismissal and that, if I make this recourse within ten days from this date, such a recourse will suspend the effect of this decree until offi-cial notification is received that the decree has been confirmed by the same Sacred Congregation." The two religious witnesses are also to sign as such. If the dismissed religious will riot sign, this refusal is to be noted on the document; and the two religious witnesses ard also to attest on the document to this refusal. This document also is to be retained by the institute. If the religious has already left the institute illicitly, th'e notification of the decree and of the right of suspensive recourse is to be sent to him by certified mail, which provides for a receipt, to the sender and a record of delivery at the offi~ce of the address. 13. Suspensive recourse (c. 647, § 2, 4°). The one who 273 JOSEPH F. GALLEN Review for Religious communicates the decree of dismissal is counseled in a reply of the Sacred Congregation of Religious to inform the religious of his right of recourse.° This should always be done; and several authors advise that this information be included, as above, in the decree of dismissal. The religious has the right of making a suspensive recourse to the Sacred Congregation of Religious against the decree of dismissal within ten days from the date on which he was informed of the decree. The first day is not counted. If the religious was informed of the decree on June 1, the time begins to run on June 2 and expires ~it midnight of June 11-12. The time does not run for any period during which the subject is ignorant of his right or unable to act, e. g., because of illness. The recourse is to be made by letter, either immediately by the subject or mediately through the superior who communicated the decree to him. The subject is to give his reasons againsf the dismissal. Proof that he had made the recourse is had by the authentic document of his own letter or the testimony of two trustworthy witnesses. The recourse within ten, days suspends the effect of the decree, which is completely ineffective until the authority that issued the decree is notified of its confirmation by the Sacred Congre-gation of Religious. While the recourse is pending, the subject is not dismissed and remains a religious with the same obligations as any other professed of temporary vows. He has the right and obligation of dwelling, under obedience to superiors, in the religious house assigned by them. If the religious does not wish to make recourse but to leave the institute immediately after the. decree is communicated to him, he may do so. Superiors may oblige him to leave immediately only if he has declared in writing that he will not m~ike recourse.7 Otherwise the religious is to remain until the ten days have elapsed without recourse having been 0 Bouscaren, Canon Law Digest, 1,329. ¢ Cf. c. 1880, 9°; Coronata, Manuale Practicum luris Discipli~iaris et Criminalis Regularium, n. 248. 274 September, 1957~ DISMISSAL IN LAY INSTITUTES made. A subject may als6 make recourse after the lapse of the ten-day period, but such recourse does not suspend the effect of the dismissal, 14. Effects of dismissal (c. 648). Canon 648 frees a professed of temporary vows, as soon as the decree of dismissal is effective, from all the vo~,s of his religious profession. There is no need of a dispensation from the vows. The ~ther effects are the same as explained under secularization in the REVIEW FOR RELIGIOUS, September, 1956~ 233-36. III. Dismissal. By Decree of a Professed of~ Perpetual Vows (cc. 649,52; 669, .~ li 672, ~ 1) 15. Sufficient reasons. (a) In institutes of men (cc. 649; 656, I°). Three grave and external crimes of the same or different species in the proper sense of canon 2195, § 1, two admonitions, and incorrigibility a~e necessary. A violation of any positive law accompanied l~y special gravity or scandal is also a crime (c. 2222, § 1). The following are examples of sufficient ¯ reasons:' serious sins against common life, external si~s against chastity, disobedience to formal precepts, formal contempt of authority, rebellion against superiors, seriously impeding the government of superiors, creating or fomenting factions in the community, drunkenness, striking companions in religion, seri-ous diffamation of others or 0f the institute, apostasy or flight from religion, as also violations of the vows or of the ~onstitutions that constitute a specially grave offense or give rise to~ grave scandal in or outside the institute. These acts must be seriously sinful objectively and subjectively. Crimes of different species should be such as to reveal, when viewed collectively, a will obstinate in evil (c. 657).s (b) In institutes of women (c. 651, § 1). The same reasons are required for the dismissal of any religious woman of per-petual vows, whether solemn or simple. The reasons must be s Cf. Creusen, Religious Men and Women in the Code, n. 353; Bastien, Directoire Canonique, n. 634, 1, 1°; Tabera, op. cit., 14-1933-267; Beste, Introductio in Codicem, 443,448. 275 JOSEPH F. GALLEN Review for Religious external, culpable, serious, and joined with incorrigibility. The reasons have to be external to the extent that they are known by others. The code requires culpable but does not certainly demand seriously culpable reasons. Inculpable reasons, e. g., lack of aptitude and physical and intellectual defects do not suffice for the dismissal of a perpetually professed religious. The reasons must be serious or grave. Finally, the reasons must be joined with incorrigibility, i. e., attempts at correction were made and their lack of success proves that there is no hope of amendment. ~The following are general examples of sufficient reasons: violations of the vows, constitutions, and religious dis-cipline that are considered more serious, even though in them-selves they are not mortal sins, or that cause serious scandal in or outside the community; and conduct that causes a notable spiritual or temporal harm to the community. The following are examples of particular sufficient reasons: repeated violations of~the vow of poverty, even after admonitions, reprehensions, penances, and even though the matter in itself does not consti-tute a serious sin; repeated and more serious acts of disobedi-ence; exciting others to rebellion and insubordination; arousing others against superiors by word or conduct; impeding the authority of superiors; disturbing the peace of the community by constant murmuring and complaints; causing dissensions and factions in the community; and the diffamation of the institute or its members among seculars. The reasons given above for men also evidently suffice for the. dismissal of women, since less serious reasons are required for the dismissal of women. Incorrigibility supposes repeated or habitufil actions. There-fore, one violation does not suffice for the dismissal of a per-petually professed religious woman. As in the case of religious men of perpetual vows, there must be at least three violations or one continued violation which, after a double admonition, becomes vi'rtually three violations. These three violations may all be of the same species, e. g., all against poverty; they may be of different species, e. g., one against poverty, the second 276 September, 1957 DISMISSAL IN LAY INSTITUTES against obedience, and the third contrary to charity. The one continued violation is verified in such things as apostasy from religion, being a fugitive from religion, and a refusal to obey. The apostate who has been admonished twice to return to religion and refuses commits virtually three violations, the original act of apostasy and the two refusals to return (c. 657). 16. Attempts at correction and 'incorrigibility (cc. 649; 656- 62; 651, § i). Everything below on the admonitions and incor-rigibility is of obligation 'from canon law in lay institutes of men. The code does not determine just what' 'the attempts at correction are to consist of in the case 'of religious women but leaves these and the judgment of the incorrigibility to the supeiioress. However, the doctrine that is more probable :in itself and to be followed in practice is that the canons on religious men should be extended to women, i. e., there should be two admonitions coupled with suitable corrections and penances. When these produce no effect, the religious wom£n may be judged in-corrigible. 17. Admonitions (cc. 658-62). (a) Prerequisite certitude of first violation (c. 658). Before the first admonition may be given, there must be certitude, not mere suspicion, probability, or conjecture, of the commission of the first violation. If cer-titude is not had, a further investigation of the conduct of the religious may be. made. If the investigation does not give certitude, an admonition may not be given. (b) Matter of the admonitions (c. 661). The' essentialnotes of an admonition are three: the superior reprehends the religiou~ for the violation already committed; warns him to avoid slich conduct in the future; and adds a threat of dismissal if the religious should persist in such conduct. The thi:eat of dismissal is always to be added to the admonition in the case of a per-petually professed religious man or woman (c. 661,. § 3). 9 Statuta a Sororibus Externis 8er~anda, n. 119; Coronata, lnstltutiones luris Canonici, I, n. 651; Palombo, De Dimissione Religiosorum, n. 179; Tabera, o~. cit., 13-1932-123; Bastien o/,. tit., rt. 639, 3. 277 JOSEPH ~. GALLEN Review for Religious The superior is also to add to the admonitions: 1° an apt exhortation, i. e., to give motives to the religious for the reform of his conduct; 2° an apt correction, i. e., to show the religious the disorder of his past conduct, its effect on himself and .others, on the community and the institute; 3° preventive measures against a future violation. Almost necessarily these will imply putting the religious under the vigilance of a superior. Other such measures that the particular case demands are also to be employed, e. g., changing the employment or house of the religious and, in general, removing and lessening the occasion of a future violation. 4° apt penances. These are to be added to each admonition. Their aptitude is to be judged from their suitability for effecting the amendment of the religious and the reparation of the scandal already given. (c) Number and form of the admonitions (c. 660). There must be two admonitions, one for each of the first two viola-tions. In a continued violation, at least three full days must elapse between the first and second admonition. The admoni-tions are to be given in such a way that there will be proof that ' they were given and received. They are accordingly to be given before two witnesses or in writing.When given before witnesses, it is better to have the admonition also written out, to retain a copy, and have the two witnesses sign this copy to the effect that they witnessed the giving of the admonition. If given in ¯ writing, the religious is always to be made to sign a document to the effect that he received the admonition, a copy of the admonition is always to be retained, and two witnesses are to attest that the copy agrees with the original. If the religious is'outside the institute, e. g., as an apostate or fugitive, the admonition is to be sent to him in writing by certified mail (cf. n. 12). (d) Competent superior for admonitions (c. 659). In institutes of men, the admonitions should be given by the immediate higher superior personally or through another authorized for the purpose. An authorization given for the first admonition 278 September, 1957 DISMISSAL IN LA~ INSTITUTES suffices also for the second. From analogy, the same principles are to be followed in an institute of women. (e) Interval and violation after the second admonition (c. 662). After the second admonition, there must be a third vio-lation or a refusal to obey the second admonition in the case of a continued violation. An interval of at least six full days is to elap, se between the second admonition and any further action in a continued violation.'° After the third violation or the lapse of the six days without sincere repentance, the religious is canonically incorrigible and may be dismissed. If he sincerely repents within the six days, ¯ he is not incorrigible and may not be dismissed. If such repen-tance is verified only after the third violation or after the six days, action on the dismissal may be continued, since the religious is canonically incorrigible; but it would be better to discontinue such action provisionally, because the religious is not in fact incorrigible,n If the religious later commits another violation, the formalities of dismissal may be continued unless the reforma-tion of thereligious was sincere and complete. Such a reforma-tion excludes the computation or inclusion of past violations and admonitions and requires that the formalities of dismissal be begun anew. A sincere and complete reformation demands that the religious, e. g., have avoided the occasions of violations, have been willing to repair scandal by public penance, and have been more than ordinarily faithful to religious observance. The common doctrine is that such an amendment of conduct should have continued for three years, but a lesser space of time, e. g., a year, will su~ce in the case of extraordinary repentance.12 l°Cf. Tabera, 0p. cit., 14-1933-273; Toso, Commentaria Minora, II, II, 268; Chelodi-Ciprot~i, lus Canonicura de Personis, n. 291; De Carlo, Jus Religiosorum, n. 587. 11Cf. Goyeneche, De Religiosis, 217; De Carlo, oiO. cir., n. 587; Schaefer, oil: clt., n. 1629; Palombo, 0/~. cir., n. 113; Coronata, 0/L cir., 867; Beste, 0/~. cir., 450; Jone, Commentarium in Codicem Iuris Canonici, I, 586. ~2Cf. Goyeneche, op. cir., 217; De Carlo, oiO. cir., n. 587; Schaefer, o/,. cir., n. 1629; Palombo, op. tit., n. 114; Beste, oiO. cit., 450; Jone, o~O. tit., 586; Coropata, op. cit., 864. 279 JOSEPH F. GALLEN Review for Religious 18. Procedure (cc. 650-52). (a). Intervention of the superior general and his council. In pontifical or diocegan lay institutes of men, canon 650, §§ 1-2, not only require that- the dismissal of a professe~ of perpe~tual vows be submitted to th~ superior gen-eral but also demand a deliberative vote of his council for such a dismissal. Canon law "does not clearly demand the interven-tion of the mother general nor of her council in the dismissal of .a professed of perpetual vows. However, from analogy with the law on the dismissal of religious men of perpetual vows and the constant practice of the Sacred Congregation of Religi-ous in the approval of constitutions, the dismissal of a professed woman of perpetual vows in both pontifical'and diocesan congre-gations is to be referred to the mother general and h'er council and the council is to have a deliberative vote.la For the same reasons, the deliberative vote of the council is required in a monastery of nuns. The remarks on the provincial and his council in n. 2 (a)apply here also. A proviricial should prac-tically never initiate the formalities of dismissal except after having consulted the superior general. The superior general and his council should have the pre-liminary data on the' religious drawn up, as stated in n. 11. To'this document are to be added a description of the three violations, proof of their existence, and proof that the admoni-tions Were properly given and received. As explained in n. 11, the reasons for the dismissal are tg, be fully manifested to the religious; and his replies in writing are to be submitted to the authority competent for dismissal. The matters .to be decided are whether certain proof is had of the three violations, of the giving and reception of the admonitions, and of the incorrigi-bility of the religious. (b) If the decision is for dismissal. 1° In a pontifical congre-gation. The mother general is to transmit all the acts and a:~Cf. Larraona, Commentarium Pro Religlosis, 2-1921-364-66; Ta~era, op. cir., 14-1933-53-54; Schaefer, op. cit., n. 1608; Jone, op. cit., 578; Muzzarelli, Tractatus Canonicus de Congregationibus Iuris Dioecesani, 175; Goyeneche, op. cit., 219; Bastien, op. cir., n. 640. 280 September, 1957 DISMISSAL IN LAY INSTITUTES documents of the case along with the vote of her council to the Sacred Congregation of Religious (cf. n. 2). In a congregation of brothers, the same things are to be sent to .the Sacred Con-gregation. However, the brother general,, with the deliberative vote of his council, decrees the dismissal; but this has no effect until it is confirmed by the Sacred Congregation (cf. n. 2). A superior who transmits a case to the authority competent for dismissal may include further information from himself or the members of the council in, addition to the latter's vote. 2° In a diocesan congregation, of brothers or sisters. The same things are to be forwarded to the local ordinary (cf. n. 3). The matters to be decided by the ordinar~ are the same as those stated above. He may summon the religious, defer the dis-missal and prescribe further attempts at correction, deny the dismissal, or issue the decree of dismissal. 3° In a monastery of nuns. The superioress is to transmit the same things to the local ordinary and the regular superior (cf. n. 5). 19. Dismissal. The religious is dismissed only at the moment that he or she receives legitimate notification of the decree of dismissal or of the confirmation of the Sacred Congregation of Religious in the case of religious men.~ Before that time he may neither leave the institute nor may the institute eject him. He is then to leave the institute, unless he is a member of a diocesan congregation, as will be immediately explained. 20. Recourse. (a) In any pontifical lay institute of men or women. The religious may recur io the Holy See against the decree of dismissal, but this recourse does not suspend the effect of the dismissal. The code gives no such right, and the Holy See has both examined ihe reasons of the religious against the dismissal and has itself effected or confirmed the dismissal. (b) In any diocesan congregation of men or women. The code says nothing on the right of the religious to recur to the Holy See against a dismissal effected by the local ordinary. a4 Palombo, op. cit., nn. 144, 187; O'Leary, Rdi.oious Dismissed after Perpetual Profession, 47-50. 281 JOSEPH F. GALLEN Review for Religious However, it is admitted that the religious has the right of recur-ring. to the Sacred Congregation of Religious against the decree; and, if made within ten days from the date on which the religi-ous was informed of the decree, this recourse suspends the effect of the dismissal. This right to a suspensive recourse follows a fortiori from the fact that such a right is granted to a religious of temporary vows dismissed by the local ordinary (c. 647, ~ i, 4°). Therefore, everything said in n. 13 under ¯ the dismissal of a professed of temporary vows applies here also. 21'. Effects of dismissal (cc. 669, § 1; 672, § 1). (a) If dis-missal frees from the vows. The code itself (c. 669, § 1 ) does not free a dismissed religious of perpetual vows from the vows of religious profession by the very fact of the dismissal. Such a liberation may be effected by a provision of the particular constitutions, or the Holy See may append a dispensation to the dismissal, or the dismissed religious may petition the Sacred Congregation of Religious in the case of pontifical institutes or the local ordinary in that of diocesan institutes for a dispen-sation. 1~ The religious is to be most earnestly encouraged to make such a petition, and the superiors are willingly to aid him. Constitutions of lay congregations submitted to Rome in the earlier years after the Code of Canon Law became effective, May 19, 1918, uniformly do not provide that legitimate dismis-sal of a perpetually professed religious frees from the vows; tho~e submitted in more recent years frequently contain this provision. The latter practice should be followed in any revis-ion of pontifical or diocesan constitutions. Ill such a provision is contained in the constitutions, the dismissal frees from all the vows of religious profession as soon as the decree is effective. There is no need of a dispensation from the vows. The other effects are the same as explained under secularization in the REVIEW FOR RELIGIOUS, September, 1956, 233-36. (b) If the dismissal does not free from the vows (c. 672, § 1). Canon 672, § 1, prescribes that a religious of perpetual is Cf. Muzzarelli, o~. cir., 306. 282 September, 1957 DISMISSAL IN LAY INSTITUTES vows who has been dismissed without being freed of his vows is obliged to reform his.life so that he will be worthy .of being received back into the institute. If the dismissed religious has manifested a complete reform during a period of three years, he is obliged to return to the institute and the la'tter~ is obliged to take him back. Howe.ver, it is the far more probable interpre-tation that this canon applies only to a religious in sacred orders (priest, deacon, subdeacon).'6 If the dismissed lay religious will not voluntarily petition a dispensation from the vows, the practical remedy is to submit the case immediately to the Sacred Congregation of Religious. A professed of~ perpetual vows is also to be given an official statement to the effect that he had been l~gitimately .dismissed, and mention should b~ made as to whether he had been freed of the vows by the dismissal or a concomitant or subsequent dispensation. IV. Dismissal By Law (c. 646) 22. Definition. This dismissal is effected automatically by canon 646 itself by the very fact and at the instant that any of the three crimes specified in the canon is committed. Therefore, the law itself, not the decree or declaration of a superior, effects the dismissal. In its nature, the dismissal is a punishment in-flicted for the crime and also a means given to religious, insti-tutes to free themselves immediately of members who have perpetrated most serious crimes against the religious life. 23. Subject. The subject of the il~so facto or dismissal by law of canon 646 is any professed religious, man or woman, of solemn or any type of simple vows, whether perpetual or tem-porary, and the members who have been aggregated perpetually or temporarily in societies living in common without public vows (c. 681). A postulant or novice is not the subject, but the commission of any of these three crimes is certainly more 'than a sufficient reason for his dismissal by the decision of the competent superior. ~6 Cf. Fanfani, De lure Religiosorum, 703-705. 283 JOSEPH F. GALLEN Review for Religious 24. "Religious who have publicly apostatized from the Catholic faith" (c. 646, § 1, 1°). The crime is simply public apostasy from the Catholic faith. (a) Simply. The canon does not demand that the religi-ous have joined a non-Christian sect, e. g., Judaism, Buddhism, Mohammedanism. The crime can be" verified either in or out of such a sect. "(b) Public (c. 2197, 1°). In the case of a religious, a crime is public when it is actually known or is in serious and immediate danger of being known by at least a notable part of the mem-bers of the religious house to which the delinquent is attached.1~ It is not necessary that such knowledge or danger extend.to the province, institute, or to externs. External apostasy that has not attained this publicity does not effect dismissal by law. (c) Apostasy from the Catholic faith (c. 1325, ~ 2). Apos-tasy is the act of a baptized person who formally" denies or positively doubts about the entire Christian-faith. The unbap-tized are infidels, not apostates, heretics, or schismatics. Formally means that there must be a subjective mortal sin in the act. A doubt is the suspension of the acceptance of the intellect. A positive doubt is had when the intellect judges that there are sufficient reasons for affirming and denying the proposition, that the reasons on neither side are convincing, and therefore the intellect suspends assent to the proposition. In a negative doubt, the intellect suspends assent because it does not p~rceive reasons either for affirming or 'denying the proposition. This is to be classed rather as ignorance. As in heresy, /~ positive doubt constitutes an injury to the faith and is sufficient four apostasy.18 The one who so doubts has had the truth suffi-ciently proposed to him, but he positively judges that the truth is not sufficiently proposed and that contrary reasons make it uncertain. ~ Cf. Michiels, De Delictis et Pornis, 117-18. ~8 Ciprotti, De Consummatione Delictorum, 15; Coronata, o,O. cir., IV, n. 1856. 284 Septe,~be~', 1957 DISMISSAL IN LAY INSTITUTES Apostasy is a denial or positive doubt concerning the entire Christian faith, e. g., the existence of God, the fact or possibility of the Christian revelation, the fact or possibility of the supernatural order. Apostasy is therefore distinguished from heresy or schism. A heretic is a baptized person who formally denies or positively doubts about one or some dogmas of faith. A schismatic is a baptized person who formally refuses to submit to the spiritual authority of the Roman Pontiff or to communicate with the other members of the Church (c. 1325, ~ 2). Canon 646 mentions only apostasy and thus inflicts dis-missal by law only on apostates, not on heretics or schismatics. (d) Excommunication (c. 2314). An apostate incurs by the very fact of the apostasy an excommunication reserved in a special manner to the Holy See. An excommunication demands merely that the act be external and not that it be public. 25. "A religious man who h~as run away with a woman or a religious woman who has run away with a man" (c. 646, ~ I, 2°). The crime will be explained with a religious man as the subject. Four notes are required to constitute this crime. The last three are only probably required in theory but are certainly necessary in fact to effect the dismissaI (cc. 15, 19). (a) The religious man must be united physically or morally in flight from one place to another with a woman. It is not required that the r.eligious be an apostate or fugitive from religion in the canonical sense of canon 644J" Flight in canon 646 has the common and ordinary sense of running away with a woman. The crime, is completed as soon as this notion is verified, without any consideration whatever of the length of absence from the religious house. The intention of returning or not returning, of contracting or not contracting marriage has nothing to do with the crime. Both must flee, since the canon demands that the religious man have run away with a woman. This is verified physically if both start out from the religious house; it is verified morally. 19 Cf. REVIEW FOR RELIGIOUS, May, 1957, 155-64. 285 JOSEPH F. GALLEN Review for "Religious if the religious alone flees in virtue of a previous agreement to meet the woman. The moral union is caused l~y the previous agreement; if such an agreement does not exist, there is no flight. In a doubt, this agreement is'to be presumed if.there was an illicit attachmehr or familiarity beforehand and union shortly after the departure of the religious; otherwise the agree-ment must be proved. The dismissal is effected at the begin-ning. of the flight. The flight described above is always neces, sary. Without such flight, neither concubinage nor the illicit leaving of the. house to sin with a woman, even though done frequently and furtively, constitutes the crime. When tlqe flight of this canon is difficult to prove, as is often true, an investiga-tion is to be made as to the existence of a marriage ceremony. It is rare in such cases that the woman does not insist on some form of marriage ceremony. (b) Probably the motive of the ,flight must be the satisfaction of lust. The iaecessity of such a motive is implicit in the text of the law and is part of the common notion of running away with a woman. Ordinarily this motive is to be presumed as soon as the other notes are verified.2° (c) Probably the woman must have attained puberty and not be a relative by blood or marriage in the direct line (mother, grandmother, etc.) or in the first degree .o~ the collateral line (sister) of the religious man. Puberty in a girl is attained can-onically on the day after the twelfth birthday, in a boy on the day after the fourteenth birthday (c. 88, § 2). The correspond-ing relatives will apply in the case of a religious woman, i. e., father, grandfather, brother. The necessity of this note is founded on the extrinsic authority of several authors. It has little foundation in the text of the law. The sense of the law is rather that the lustful motive is presumed not to exist with such persons but, if proved, the crime exists. Otherwise, the state of the woman is indifl:erent. It is of no import that she z°Cf. Tabera, Ol~. cir., 11-1930-416; Goyeneche, oil. cir., 209; Vermeersch, Periodica, 19-1930.122". 286 September, 1957 DISMISSAL IN LAY INSTITUTES is married, unmarried, capable or incapable of contracting marriage validly;. (d) Probably proof must exist of the preceding, requisites. The probability of this doctrine arises from the fact that the other two crimes of canon 646, public apostasy and marriage, are of their nature capable of proof and from the extrinsic authority of some authors. If the religious has verified the other notes but the crime is so secret that this fourth note is not verified, he is not dismissed by law."~l Any proof that gives moral certi-tude suffices, e. g., the testimony of reliable witnesses. (e) Excommunication (c. 2385). Obviously the flight described above will usually also imply apostasy from religion if the religi-ous has perpetual vows and thus the incurring i/)so fdcto of an excommunication reserved to the ordinary.-~" 26. "A religious who attempts or contracts marriage, even the so-called civil marriage" (c. 646, § 1, 3°). The crime is the contracting (validly) or the attempting (invalidly) of marriage by any type of Catholic, non-Catholic, or civil ceremony pro-vided both parties gave a naturally valid consent. The form of celebration of a civil marriage must be valid according to the civil law of the place of celebration. A solemn vow of chastity renders marriage invalid; a simple vow forbids but does not invalidate marriage. The crime presupposes a marriage consent valid" from the natural law and is not verified if the consent is vitiated in either party by an essential defect, e. g., ignorance, simulation, physical violence, grave fear. However, it is to be presumed that true consent was given; and this pre-sumption is sufficient to declare the religious~dismissed. In itself, the invalidity of the marriage does not exclude the crime, i. e., the crime is still verified if the marriage is invalid because it was attempted outside the Church or because of a diriment impedi-ment. ~lGoyeneche, Quaestiones Canonicae, II, 153; Schaefer, op. cir., n. 1578; Bas-tien, op. cir., 446, note 2; Jone, o~0. tit., 572; Jombart, RevUe des Communautets Religieuses, 6-1930-148. 22 Cf. REVIEW FOR RELIGIOUS, May, 1957, 158. 287 JOSEPH ~. GALLEN Review for Religious Excommunications (cc. 2388; 2319, § 1, I°~; 2385). By presum-ing to attempt marriage, both a solemnly professed religious and the other party incur an excommunication reserved simply to the Holy See (c. 2388, §.1); if the vows of the religious are simple but perpetual, the presuming to contract or attempt marriage is punished in both parties by an excommunication reserved to the ordinary (c. 2388, § 2). If the marriage is attempted before a non-Catholic minister, the punishment of a Catholic is an excommunication reserved to the ordinary (c. 2319, § 1, 1°). A marriage ceremony implies an intention never to return to the institute and thus results in an excommunication for apostasy from religion reserved to the ordinary in the case of a religious of perpetual vows (c. 2385). A civil ceremony is not punished by the code, but in some dioceses of the United States it is punished by an excommunication reserved to the o~dinary and in some others it constitutes a reserved sin. 27. Effects (c. 646, ~ 1). Upon the commission of any of the three crimes, the religious is immediately an.d i~pso facto dis-missed, by canon 646. This dismissal by law is a legitimate dis-missal and produces all the effects of the ordinary dismissal by decree. Therefore, in the case of a professed of temporary vows, the effects are ~he same as those described in n. 14; if the religious is. of p.erpetual vows, the effects are those of the'ordinary dismissal exp!ain~d in n. 21. 28. Declaration of fact (c. 646, ~ 2). This canon commands the higher superior with the consultive vote of his council to make a declaration of fact concerning the crime. Some con-stitutions restrict this right to the superior general, and some also demand a deliberative vote of the council. In monasteries of nuns, the declaration is to be made by the superioress of the monastery with the consultive or deliberative vote of the council or chapter as commanded by the constitutions. The declaration of fact is merely a description of the pertinent points of the case, the headings of the proof, e. g., a copy of the marriage record, statement of witnesses, etc., and the conclu- 288 September, 1957 DISMISSAL IN LAY INSTITUTES sion that the religious ~was dismissed in virtue of canon 646. The local superior is ordinarily in the best position to secure these proofs, e. g., the statements of witnesses. Frequently a trustworthy man such as a lawyer or priest should be deputed to secure some of the proofs in the case of an institute of women, e. g., the copy of the marriage record. The declara-tion and proofs are to be retained in the secret files of the house of the higher superior who made the declaration. The pur-pose of the declaration is to possess proof of the automatic dismissal and to prevent future doubts and difficulties, particu-larly for the eventuality of a recourse by the subject to the local ordinary or the Holy See. V. Provisional Sending Back to Secular Life (c. 653) 29. Subject. The subject of thi~ provisional return is any pro-fessed religious, man or woman, and any aggregated member of a society living in common (c. 681). Canon 653 speaks explicitly only of the perpetually professed; but afortiori, from afialogy of law, the common opinion of authors, and the practice of the Holy See in approving constitutions, the same canon applies to the professed of only temporary vows and to the aggregated members whose bond with the society is only tem-porary. 30. Reasons required. The reason must be either of the fol-lowing: (a) Grave external scandal. This is a culpable defamatory act, committed within or outside the religious house, which is well known outside the house or known only to a few externs, who, however, will not keep the matter a secret, e. g., a sin against good morals. (b) Very serious imminent injury to the community. This is an extraordinary injury or harm certainly and proximately threatening at least reductively, not merely one or some individ-uals but the religious house, province, or institute. The religious must be the cause of this harm but it is not certain that he 289 JOSEPH F. GALLEN Review for" Religious must be a culpable cause. Examples of this reason are the proximate judicial accusation of a defamatory crime in either the moral or political order; sexual actions with students in an institute devoted to education when it is foreseen that these wil][ become public and bring infamy on the house, province, or institute; a serious threat to set the house on fire or against the life of a superior or another member of the institute; and a serious loss of temporal property of the house, province or institute. (c) Three conditions required in both cases. Since such an extraordinary action should not be taken against a religious because of mere probability, conjecture, or suspicion, the ex-istence of the cause must be certain; it must also be impossible to avoid the scandal or harm in other ways, e. g., by transferring the religious to another house; and there must be at least prob-ability that the scandal or harm can be averted or appreciably diminished by the provisional return to secular life. 31. Competent authority. (a) Ordinarily. Canon 653 gives the right for such action in lay institutes to the higher superior with the consent of his council. The right is therefore given by the ~ode also to provincials, even though the constitutions may affirm it only of the superior general. In prudence and if possible, the provincial should refer the case to the superior general or at least consult the latter. In a monastery of nuns, "the competent authority is the superioress with the consent of her council. (b) In a more urgent case. In a case in which the time re-quired for recourse to the superior general or provincial would imperil the avoidance of the scandal or injury, the competent authority is the local superior with the consent of his council and also the consent of the local ordinary. If it is impossible to have recourse to the local ordinary and the case will not admit _.3 Berutti, De Religiosis, 349; Bouscaren-Ellis, Canon La~w, 319. 290 September, 1957 DISMISSAL IN LAY INSTITUTES o~. delay, it is.safely probable that this action may be taken by the local superior with only the consent of his council.'~4 32. Final adjudication of the case. (a) Report. A report of the case should always be made out without delay and submitted to the authority competent for a final decision of the matter. The report is to contain the religious and family name of the subject, date, age, date of entrance, date of temporary or perpetual profession, house to which he was assigned at the time of the return to secular life, cause of this return, proofs and present state of this cause, a brief record of the past of the religious insofar as it is pertinent to the cause 6f his return and dismissal, the name and rank of the superior who effected the return, the fact that the consent of the council and of the local ordinary, when prescribed, was obtained; and, if the latter was not secured, the report is to state the reasons that'justified its omission. (b) Authority competent for a final decision. Canbn 653 states that the case is to be referred to the Holy See without delay. This canon, however, is to be interpreted in the light of the other canons on the competent authority for dismissal; and it is admitted doctrine that the authority competent for an ordinary dismissal by decree is competent also for the final decision in the case of a provisional return to secular life.~'~ Therefore, the case is to be referred, according to the nature of the institute and the vows of the subject, to the authority competent for dismissal by decree stated in nn. 2-5. 33. Effects. As soon as the provisional return is decided, the re-ligious puts off the religious habit and leaves the institute. The return to secular life is a provisional measure. It is not a dismissal and does not produce the effects of a dismissal. The competent authority mentioned above decides for or against dismissal and 24Cf. Tabera, 0p. tit., 14-1933-58; Goyeneche, De Religiosis, 221, note 31; Palombo, op. cir., n. 192; Schaefer, 0iL cir., n. 1609; O'Neill, The Dismissal of Religious in Temporary l/o~vs, 104. 25Cf. O'Neill, op. cir., 103-104; Schaefer, op. cir., n. 1636; Wernz-Vidal De Religiosis, 490, note 13; Bastien, o~0. cir., n. 645, 4; Palombo, op. cir., n. 195; Tabera, op. cir., 14-1933-57; Vermeersch-Creusen, Epitome luris Canonicl, I, n. 807. 291 JOSEPH F. GALLEN decrees the dismissal in the t~ormer case. The charitable subsidy is to be given to a religious woman who is provi~ionally sent back to secular lithe.2° SOME BOOKS RECEIVED [Only books sent directly to the Book Review Editor, West Baden College, West Baden Springs, Indiana, are included in our Reviews and Announcements. The following books were sent to St. Marys.] The 1957 National Catholic Almanac. Edited by Felician A. Foy, O.F.M. St. Anthony's Guild, Paterson, New Jersey. $2.00 (paper cover). Does God Exist? By Alfred M. Mazzei. Translated by Daisy Corinne Fornacca. Society of St. Paul, New York, N.Y. $3.50. St. Bernadette Speaks. By Albert Bessi~res, S.J. Translated by The Earl of Wicklow. Clonmore & Reynolds Ltd., 29 Kildare St., Dub-lin. 10/6. Queen of Heaven. By Ren~ Laurentin. Translated by Gordon Smith. Clonmore & Reynolds Ltd., 29 Kildare St., Dublin, 12/6. Le Ciel ou l'Enfer. II. l'Enfer. By Chanoine G. Panneton. Beau-chesne et ses Fils, Rue de Rennes, Paris. Methods of Prayer in the Directory of the Carmelite Reform of Touraine. By Kilian J, Healy, O. Carm. Institutum Carmelitanum, Via Sforza Pallavicini, 10, Rome. Some Philosophers on Education. Edited by Donald A. Gallagher. Marquette University Press, 1131 Wisconsin Ave., Milwaukee 3, Wis-consin. $2.50 (paper cover). Wellsprings of the Faith. By Most Reverend John C. McQuaid, D.D. Clonmore & Reynolds Ltd., 29 Kildare St., Dublin. 18/-. The Reluctant Abbess. By Margaret Trouncer. Sheed and Ward, 840 Broadway, New York 3, New York. $3.75. Quadalupe to Lourdes. "By Frances Parkinson Keyes. Catechetical Guild Educational Society, St. Paul 2, Minnesota. $0.50 (paper cover). The Mystery of My Future. By Jean De Larhove. Society of St. Paul, 2187 Victory Blvd., Staten Island 14, New York. $2.50. Of the Imitation of Christ. By Thomas a Kempis. Translated by Abbot Justin McCahn. The New American Library of World Literature, Inc., 501 Madison Ave., New York 22, New York. $0:50 (paper cover). The Caiholic Booklist 1957. Edited by Sister Mary Luella, O.P. Rosary College, River Forest, Illinois. $0.75 (paper cover). ¯ _,6 Cf. REVIEW FOR RELIGIOt;S, September, 1956, 235-36. 292 Our Supernat:ural Organism Daniel J./~. Callahan, $.J. GOD IS THE author of all things. The more science ad-vances, the more does it disclose the wonders of His crea-tion. Even a superficial reading of a manual of biology or physics or chemistry or astronomy wrings from us the words of the Psalmist: "How great are thy works, O Lord. Thou hast made all things in wisdom; the earth is filled with thy riches" (Ps. 103:24 ). These divine masterpieces, especially as mani-fested in man, qualify us by analogy for the marvels of the supernatura! order. God gives life in the embryonic state and with it an or-ganism capable of developing the tiny creature into the pleni-tude of its specific perfection. The fundamental natural prin-ciple of this evolution is the vital principle within it, which energizes it and is the source of its least activity. Its separation from the bodily element would mean the termination of growth, deterioration, death. In us the human soul is the basic source of our natural life; its faculties or powers are the immediate cause of our vital activities and these in turn bring to perfec-tion our human life. To all this the supernatural is closely analogous as will appear from a brief study of the components of its organism. Sanctifying Grace Appropriately this may be styled the soul of the higher life in us. Only from divine revelation do we know its exis-tence and nature, and it will be useful to recall here what rev-elation tells us about this precious endowment. It is something most real; a spiritual quality inherent in our soul and of such an excellence'that only God could be its principal cause; it is a stable quality, an adornment abiding in the soul till forfeited through mortal sin; it is a totally free gift to which no one of us could lay claim and which transforms us into God:like 293 DANIEL J. M. (~ALLAHAN Review for Religious beings resembling our eternal Father and enabling us to share, in a finite manner, in His life. That life comprises the infinite contemplation;, love, and possession of His uncreated perfec-tion. To this no creature by its native powers could aspire. By a privilege entirely gratuitous God destines us for the immediate visiofi of Himself in heaven and adapts us ~or it through sanctifying grace. Attended by faith; hope, and charity such grace equips us to know, love, possess God, imperfectly, of course," as He knows, loves, and possesses Himself; and thus we enter into the divine life and become truly His children. And while this life is distinct from our natural life, it is not merely superimposed on the latter: it penetrates it through and through, elevating and transforming it. Leaving intact all the natural goodness that is ours, sanctifying grace imparts a new orientation to everything within us, establishes new relations to the Blessed Trinity, and inaugurates on earth the life of the blessed. To aid us in the apprehension of this prerogative, writers resort to many comparisons and illustrations. They liken the soul to a living image of the adorable Trinity., divinely impressed on the soul as the seal leaves its image on the wax, lavishing on it an entrancing beauty since the prototype and the artist is no other than God. Again such a soul is compared to a trans-parent body receiving the sun's rays and, all aglow" itself, radiating them in all directions; to a bar of steel plunged into a furnace and sharing the heat, brightness, and pliancy of the fire; to a branch engrafted into a plant, maintaining its identity while partaking of the life of the plant; to the union in us of soul and body where the soul quickens and energizes the body even as grace communicates a new life and effects our most intimate union with God. Finally, an analogy with the hypo-static union in Christ is introduced; and, though the soul's union with God is only accidental, yet it is the union of a substance with a substance; and, while the hypostatic union results in the God-man, the union through grace issues in a God-like being, 294 September, 1957 OUR SUPERNATURAL ORGANISM whose actions are performed at once by the Creator and His creature, even as in Christ His actions were shared in by both His divine and human nature. And though our union with God is neither hypostatic nor substantial in the proper sense, for we always retain our personality and the union is only accidental, it is not merely the intimacy of two friends, for it rests on a/physical quality abiding in the soul and on physical bonds intensifying and safeguarding that union. The three Divine Persons are immediately presefit to the soul in a com-pletely new way and are possessed and enjoyed by it. Though the precise nature of this extraordinary inhabitation continues to exercise theologians, we are assured that it is capable of indefinite expansion up to the last breath of life here below, and this in p.roportion to our surrender to the Holy Spirit through the removal of all barriers and the cultivation of the infused virtues and the gifts of the Holy Ghost. The Infused Virtues In the natural order our soul functions through its faculties or powers. It thinks through the intellect; .it loves through the will; it senses through our different senses. These faculties bestowed on us together with the soul, by means of their varied activities, are susceptible of tremendous development. In the supernatural order grace parallels the soul, and the infused virtues are its chief faculties. These emanate from sanctifying grace, elevate our mind and will, enable us to perform supernatural, meritorious deeds. Virtue may be described as a good habit designed for action. It is natural if it has been acquired through the repeti-tion of the same specific act and communicates facility in doing so; if directly granted by God and if it confers the ability to do something, it is called infused. The natural virtues facilitate nat-ural righte6usness; the infused confer the power to act on a superhuman level. These latter are usually divided into theologi-cal and moral. The former have God for their formal and principal material object; in the concrete they are faith, hope, and charity and unite the soul directly to God. The moral 295 DANIEL J. M. CALLAHAN Review for Religious virtues have for their objective some moral good distinct from God, serve to eliminate the hindrances to divine union and to stabilize it, and are commonly listed under the four cardinal vi£tues. The theological virtues certainly accompany sanctifying grace and integrate the process of justification, and it is the generally accepted doctrine that the moral virtues also are then bestowed. ¯ All of these virtues are susceptible of increment and 'do increase proportionally with the increase of grace, just as the branches of the tree ke~p pace with the expansion of the trunk. Apart from the complete loss of the virtue, may they diminish? In general, any activity that is discontinued or exercised bnly rarely tends to decline or even to cease. Venial sins, especially when frequent and deliberate, considerably impede the practice of virtue and thus diminish the facility previously attained. Neglect of actual graces may likewise occ~lsion the privation of such helps as notably conduce to acts of virtue and add vigor and polish to them. And though venial sins do not directly decrease or destroy the infused virtues, it remains true that such failings open the way for serious lapses and the destruction of th.e virtues. Do all grave sins deprive us of these? Faith is destroyed only through a mortal sin of infidelity, hope through the same and that of despair; charity and the infused moral virtues, through any mortal sin. Relative to the duration ot~ all such virtues, in the lost none of them persists; the theological remain in the souls in purgatory; in heaven there will be neither acts of faith nor of hope relative to God, and most probably not relative to objects distinct from Him. And whereas neither the moral virtues nor those of faith and hope will endure in the blessed, these will retain the virtue of charity and live a life of the purest actual love. The Gifts of the Holy Spirit There is unanimity among Catholic theologians about the existence of such gifts, but their specific nature is widely contro-verted. In accordance with the doctrine of St. Thomas (Summa, 296 September, ~957 OUR SUPERNATURAL ORGANISM I-II, q. 68, a. 3), the most prevalent opinion is that they are supernatural habits, distinct from the virtues, implanted in the soul conjointly with sanctifying grace, which impart a recep-tiveness, a docility to the impulse of the Holy Spirit, a more prompt and more generous cooperation with His grace. They would appear to be, at least in the early stages, not operative habits like the virtues, but rather dispositive, adjusting the soul for a better reaction to the divine intervention. Their func-tion, then, is that 0f perfecting the exercise of the virtues. There is no certainty about their number; and, while conferred simultaneously with grace, a more copious outpouring may be the fruit of the sacrament of confirmation. The docility issu-ing from these' gifts improves perceptibly through prayer for fidelity to grace, through a life of faith and recollection, through the cultivation of the moral virtues and due control over our passions, for unless these latter are consistently mortified, the inordinate attachments in the soul will hamper us in discerning, accepting, and responding to the inspirations of grace. We must combat the spirit of the world which is diametrically op-posed to the divine and school ourselves in prompt, magnani-mous compliance with God's will. The more complete our surrender' to Him, the more will He be pleased to enlighten and inflame us. Actual Grace just as in the natural order we cannot bring power into motion without the concurrence of the Almighty, so also in the supernatural. Such cooperation is known as actual grace to distinguish it from habitual grace previously considered. It is a transitory aid imparted by God, consisting in the illumina-tion of the mind and the urge of the will for the performance of a supernatural act. It sets the intellect and heart in motion and enables them to function on a superhuman level. In the concrete, it is a holy thought, a salutary incitement of the will, produced by God who directly influences our rational faculties, stimulating them to operate, and cooperating with them to 297 DANIEL J. M. CALLAHAN Review for Religious elicit a good thought and a salutary desire in keeping with the special need of the moment. The thought is most real and comes directly'from God; it is a holy thought, designed for the spiritual benefit of the individual. When we say "salutary desire," we understand any good act of the will, for instance, the love of good, hatred of evil, fear of divine punishment, sorrow for sin, joy 'in well-doing. It is a real act of the will. Antecedent to our activity God lovingly takes the initiative and continues to act within us and with. us for the accomplishment of a deed that will conduce to life eternal. This assistance is not permanent; it persists only while its purpose lasts; and it influences us in a moral way through attraction and persuasion and physically by adding energy to our intellectual faculties too weak to act of themselves. As religious we are to be profoundly penetrated with the conviction of our need of such divine assistance. It is necessary for the achievement of every supernatural act: for the prelim-inary acts of faith, hope, sorrow requisite for the remission of sin. The constant endeavor to resist temptations which assail even the just, as well as our steadfastness in good living, are the fruits of actual grace. Obviously, then, we have not the power to persevere in religion and even to reach perfection through our unaided strength. Christ's memorable words, "Without Me you can do nothing" (Jn. 15:6), are pertinent to the natural and supernatural levels. Everyone who attains the use of reason needs this grace and all such receive it. It proceeds from the love of God; the ordinary channels for its dispensation are the sacraments, prayer, and'our meritorious deeds; and the more generous our cooperation with grace received the more will be granted, for here, as in the entire economy of salvation, God takes the initiative, awaits our free reaction, and assures us that He will" bestow th~ necessary help for the completion of our project. Conformity to the divine will, consequent peace of soul, trust, and magnanimity are supremely important in the struggle for real sanctity. 298 September, 1957 OUR SUPERNATURAL ORGANISM Appreciation "If thou didst know the gift of God" (Jn. 4:19) spoke Jesus to the Samaritan woman, referring to the supernatural life which He communicates to us through His vivifying action, here compared to water springing from an unfailing source. Religious have totally consecrated themselves to God; to Him they belong entirely; and there must be in them the life that is His. In them the supernatural must always be dominant. It is a treasure to be courageously safeguarded even at the cost of sacrifice; it is an endowment to be zealously augmented; it is a life and life is essentially progressive. Cessation of growth soon induces recession. In the wake of tepidity and lethargy spiritual death follows closely. The law of spiritual gravity is to be counteracted through p.urity of intention at all times, through earnestness even in small affairs, through fervent, per-severing prayer, and through the frequent reception of the sacraments of penance and Holy Communion. "Walk in a manner worthy of the calling with whic'h you are called," wrote 'St. Paul to the Ephesians (4:1 ff.), "with all humility and meek-ness, with patience bearing with one another in love, careful to preserve the unity of the. spirit iri the bond of peace; one body and one 'Spirit . . . one Lord, one faith, one baptism, one God and Father of all who is above all and .throughout all and in all." Surely a relevant injunction for all religious. OUR CONTRIBUTORS BONAVENTURE BALSAM is engaged in parish work at St. Anthony's Priory, 4640 Canal Street, New Orleans, Louisiana. JOSEPH F. GALLEN is professor of canon law at Woodstock Col-lege, Woodstock, Maryland. DANIEL J. M. CALLAHAN is profes-sor of ascetical and mystical theology at Woodstock College, Wood-stock, Maryland. 299 Survey ot: Roman Documen!:s R. ~. Smil:h, S.J. IN THIS survey only those documents will be considered which appeared in the ./Iota/lpostolicae Sedis (AAS) during the months of April and May, 1957. Hence all page references throughout the survey are to AAS of 1957 (v. 49). The African Missions On Easter Sunday, April 21, 1957 (AAS, pp. 225-48),. the Holy Father issued a new encyclical letter which is entitled Fidei Donum (TheGift of Faith) and which treats of Africa and its missions. After noting that man'.s gratitude for the gift of faith is best shown by spreading the light of Christ's truth, His Holi-ness remarks that while he is not unaware of the grave and pressing problems attending the spread of the Faith in all parts of the world, yet special attention is needed in the case of Africa, for this continent now finds itself on the threshold of its political and cultural maturity and faced with circumstances the import-ance of which is rivaled by nothing in the previous history of /~frica'. The Vicar of Christ then begins the first of the four sections into which the encyclical letter is divided. This first section is devoted to an over-all picture of the missionary scene in Africa. Most of the countries of the continent, the Pope says, are in the midst of profound social, economic, and political changes which will have a lasting effect on the fut.ure lives of these nations. The Church which has seen the rise and growth of so many nations cannot but be intensely interested in the peoples of Africa who are now attaining their civil rights. It is at this point that the Holy Father exhorts the coloniz-ing nations to grant civil rights to peoples who are prepared for them; and at the same time he urges the colonial peoples of 300 ROMAN DOCUMENTS Africa to be grateful .for .~vhat they have received from the vari-ous countries of Europe. Only such a harmonious attitude will exclude prejudice and exaggerated nationalism and will permit the peoples of Africa to experience the entire range of benefits which flow from the religion of Christ. Pius XII is especially concerned that in many countries of Africa atheistic materialism has been spreading the seed of its doctrine, thereby arousing jealousy between nations, inducing false perspectives in the matter of temporal prosperity, and excit-ing to rebellion. The presence of this atheistic materialism in Africa, thinks the Pontiff, is particularly grave owing to the fact that the peoples of Africa, because they wish to accomplish in a few years what ~he peoples of Europe took centuries to achieve, are psychologically vulnerable to the specious .promises which materialism offers. The H01y Father continues by remarking that of all the missionary regions of the world, Africa is the one with the greatest needs. African mission posts which have been estab-lished in the last ten or twenty years cannot expect a sufficient number of native clergy for a long time, while the missionaries in such stations are few and widely scattered throughout large regions where, moreover, non-Catholic religions are also spread-ing their doctrines. The gravity of the situation can be illustrated by one region of Africa where there are 2,000,000 inhabitants but only 50 priests whose energies, moreover, are completely absorbed in the care of the 60,000 persons already converted to Catholicism. Twenty more missionaries in such regions at the present time would mean, the Vicar of Christ sadly comments, the spreading of the banner of the cross in places which twenty years from now will be impossible of access. Moreover, twenty more missionaries would mean that the Church could educate in such regions a corps of African Catholics equipped to meet the social and political needs of the continent. Nor are difficulties lacking in African missionary centers which have long been established. Such centers too feel the 301 R. F. SMITH Review for Religious extreme lack of missionaries. Moreover, the bishops and vicars apostolic of Africa are obliged to provide for their flocks a full Catholic life; and this necessitates in turn schools, colleges, social institutes, all the modern communication arts. Such needs can be met only by a great flow of material and apostolic help to the continent of Africa where 85,000,000 human beings are still attached to the practice of paganism. The Holy Father centers the second part of his encyclical around the theme that the problems of the Church in Africa are not merely local difficulties, but are of vital concern to the entire Mystical Body. Bishops, those preeminent members of the Mystical Body, should have a special concern for the Church in Africa, for they as the legitimate successors of the apostles retain the duty of preaching to all nations. Moreover, continues the Holy Father, there ig not a Catholic in the world who should not be interested in the problems of the Church in Africa. Nothing that is characteristic of the Church should be absent from the mental outlook of the individual Catholic. If then catholicity or universality is one of the characteristics of that Church which is the mother of all nations, breadth of outlook must also mark the individual Catholic. In the third part of the encyclical the Holy Father dis-cusses the means by which Catholics can aid the missions of Africa. ~The first means is that of continual and earnest prayer. The best prayer, of course, will be that which Chris~, our High Priest, daily offers on our altars. And while the faith-ful should be instructed that it is good to offer Mass for their private intentions, still they should also be taught to give atten-tion to those petitions with which the Mass is primarily and neces-sarily concerned and "which include the we~Ifare and propaga-tion of the entire Church. To prayer must be added alms or material help, for present needs far exceed the help now being given. The faithful in other parts of the world should compare their conditions with the 302 September', 1957 ROMAN DOCUMENTS situations of missionary countries and see who are the real need~i of the Church. Hence the Vicar of Christ urges that each Catholic make an examination of conscience to consider if there is not something tl~at can be given up in order that material aid might be given to the missions. The third way of helping Africa is through the fostering of vocations to missionary work.~ Bishops should train their flocks in such a way that there will always be members of that flock ready to heed the Lord's command i~ Genesis 12:1 to leave one's land and the house of one's father. Dioceses with a suffi-ciency of priests should give of their workers to the missions; and even dioceses which themselves suffer from a scarcity of priestly workers can still offer their mite as did the widow in the gospel story. The problem of missionary recruitment, however, can be met only by the ~oncerted work of all the bishops who should encourage the Missionary Union of the Clergy, foster the work of pontifical missionary associations, and be aware of the needs of those religious institutes which do missionary work but which cannot increase the number of their vocations without th~ under-standing assistance of the local ordinary. Finally, the Holy Father approves the practice of a diocese lending some of its priests to missions for a limited time. The fourth part' of the encyclical consists of a brief conclu-sion in which the Holy Father repeats that he is as interested in all the missions as he is in those of Africa. To all missionaries of the entire world he extends his gratitude and his congratula-tions and exhorts them to labor fervently in the work to which they have been called. Lenten and Easter Messages On March 5, 1957 (AAS, pp. 208,15), the Holy Father gave his usual Lenten allocution to the parish priests and Lenten preachers of Rome. The present year, begins the Holy Father, marks the fifth anniversary ot: the inauguration of the movement 303 R. F. SMITH Review for Religious "Fora Better World." After detailing the work accomplished in the diocese of Rome during that period and after noting the things yet to be done, His Holiness then urges his listeners to sow the seed that is the word of God. To preach anything but the word of God, he warns them, is to sow destruction. He gives special attention to the matter of Sunday preaching, insist-ing that nothing can achieve so much as this regular and familiar custom so long in use in the Church. Finally,. he recalls to his listeners the fact that the true sower of the good seed is God and that they are but instruments in His hand; what changes then would sweep the world if all who preached did so as ones truly coming with the power of God. The Holy Father's Easter message, delivered on April 21, 1957 (AAS pp. 276-80), was a meditative reflection on the phrase "O truly blessed night" of Holy Saturday's E, xultet. The night preceding the Resurrection, His Holiness begins, was one of desolation, tears, and darkness: Christ is dead; His flock is scattered; all is apparently in ruin. Nevertheless, even in that night there are signs of the dawn to come: the body of Christ suffers not the slightest taint of corruption and Mary prays in quiet confidence and expectation. That night before the Resurrection is also a symbol, adds the Vicar of Christ, of the night in which modern men find themselves: they must live in fear; their intelligences are cap-tured by error; immorality has reached a new depth. Neverthe-less, there are signs of a new day dawning. Science is provi-dentially multiplying the means to a fuller and freer life, while technology is providing the way to make these means available on a large scale. Moreover, men are now beginning to realize that the night of modern times is here because Christ has again been betrayed and crucified. Day will finally come to modern man when Christ restores grace to the individual soul and takes His rightful place in human social life. The Holy Father con-cludes his Easter message to mankind with a prayer that Christ may send the angel of the Resurrection to remove the obstacles 304 September, 1957 ROMAN DOCUMENTS which men have built up :but which they are now powerless to remove. To Hospital Sisters On April 24, 1957 (AAS, pp. 291-96), Pius XII spoke to some 2,000 Italian hospital sisters who had met for the first time in a national meeting to discuss their common problems. The Pontiff began with a forceful statement of the part that religious women play in the life of the Church today, remarking that many branches of the Church's apostolate, especially those concerned with education and with works of chariiy, would be inconceivable without the existence of religious sisters. This said, the Holy Father then began to discuss with them the ideals of their relig-ious life. It is.a truth of our faith, he notes, that virginity is higher than the married state; for through virginity the soul achieves an immediate relationship with God that is one of absolute and indissoluble love. The virginal soul takes everything that God has given her to be a wife and mother and offers it back to Him in a complete and perpetual holocaust. In order to love God, the vi,rginal soul does not reach Him through other loves: noth-ing is interposed between such a soul and God. Hence it is that a religious must be a true spouse of our Lord, uniquely, indissolubly, and intimately united with Him. Hospital sisters then must take care that their assistance to the sick does not interfere with their spirit of absolute and perpetual devotion to God, guarding against all disordered activity which leaves them neither time nor repose for prayer to Christ. They must also guard themselves against long and frequent withdrawals from common life, that strong protection of the interior life. And they must watch carefully over their spirit of individual and collective poverty, making certain that their hospitals do not assume the character of merely money-making organizations. Turning now to their work for the sick, the Vicar of Christ notes that the existence of special institutions for the care of the 305 R. F. SMITH Review for Religious sick stemmed historically from the charity of the Church. Even today, when so many are interested in the care of the suffering, the Church will never abandon her task of caring' for the sick, for no one can take the place of the Church at the side of one who besides a body also possesses a soul whose needs and claims are often greater than those of the body. It is for this reason that the Holy Father urges hospital sis-ters to continue their work. Besides being perfect religious, they must also know and use the latest scientific methods and ap-paratus. They must train themselves to a motherly kindness that is linked with a strong element of firmness. They must lead a fully dynamic life and still retain their calm and serenity. Here the Holy Father adds that superiors must see to it that community time-schedules and practices do not make the sisters' work ineffi-cient and more difficult. In conclusion the Holy Father dwells at some length on the recommendation that the sisters train themselves always to see Christ in each of their patients. If they do so, he notes, then it will be easy to pass from the chapel to the sick room; religious observance and care for the sick will not interfere one with the other; and there will be no interruption of the sisters' union with Christ. The Holy Father then blessed the assembled sisters and concluded ~ith a remark that all hospital sisters will treasure: "The Church, the Pope, are depending on you: on your complete dedication, on your abilities, and on your spirit of love." Miscellaneous Matters Under the date March 19, 1957 (AAS, pp. 176-77), the Holy Father issued the rnotu proprio Sacram Co~nmunionern in which he provided that henceforth local ordinaries (with the exception of vicars general) may permit daily celebration of after-noon Mass provided the spiritual good of a notable part of the faithful warrants such a permission. His Holiness also further mitigated the Eucharistic fast. The drinking of water does not 306 September, 1957 ROMAN DOCUMENTS break the fast'; and the time element for the Eucharistic fast is the following: Before the celebration of Mass in the case of priests and before the reception of Communion in the case of the faithful, solid food and alcoholic drink must be abstained from for three hours, while non-alcoholic drink must be abstained from for one hour. These time regulations extend both to morning and afternoon celebration of Mass and reception of Communion; and they must also be observed by those celebrating Mass at midnight or at the early hours of the morning as well as by those receiving Communion at such times. Finally, the Holy Father grants to the sick, even those not confined to bed, the .permission to take non-alcoholic drinks as well as liquid or solid medicine at any time before the celebration of Mass or the reception of Communion: Three documents of April and May of this year concerned the saints. The first of these is an apostolic letter of the Roman Pontiff which is dated June 8, 1956 (AAS, pp. 199-200), and which appoints St. Dominic Savio the patron of all choir boys. The other two documents are decrees of the Sacred Congre- - gation of Rites, both being dated January 22, 1957 (AAS, pp. 251-56). In the first of these decrees the congregation affirms the heroic virtue of the Venerable Servant of God Sister Mary Celine of the Presentation, professed nun of the Second Order of St. Francis (1878-97); the second decree affirms the heroic virtue of the Vdnerable Servant of God Sister Teresa of Jesus Journet Ibars, foundress of the Congregation of Little Sisters of the Indigent Aged (1843-97). Priests will be interested in the Holy Father's letter, dated March 25, 1957 (AAS, pp. 272-75), and sent to Cardinal Feltin of Paris on the.occasion of the 300th anniversary of the death of Jean-Jacques Olier, founder of the Society of St. Sulpice. - Olier, the Holy Father notes, recalls to the present generation the truth that the greatness and power of a priest consists in being a man of God and a man of ihe Church. As a man of God the priest must have two indispensable qualities: prayer 307 R. F. SMITH Review for Religious exercised especially through meditation and the Divine Office; and asceticism, manifested principally by a perfect chastity of heart and body. The priest then must always be aware that union with God is the indispensable prerequisite for apostolic fecundity and that the cross is the only instrument of salvation: evil is still cast out only by prayer and fasting. As a man of the Church, concludes the Holy Father, the priest must realize that all personal sanctity and apostolic effectiveness must be founded on constant and-exact obedience to the hierarchy. ¯ Several documents of the period surveyed are concerned in one way or another with matters educational and intellectual. On March 24, 1957 (AAS, pp. 281-87), the Holy Father addressed a group of 50,000 college students of Rome and gave them some detailed advice on their studies, urging them to dedicate them-selves completely to the pursuit of truth. A month later on April 25, 1957 (AAS, pp. 296-300), His Holiness spoke to the members of the eleventh plenary assembly of Pax Romana, telling them that no Catholic can be indifferent to the new world com-munity now in process of formation. This is especially true, he says, of Catholics engaged in intellectual work, for it is their task to spread Catholic truth and to give it practical application in all areas of human activity. Educational and intellectual matters also figure in two decrees issued by the Sacred Congregation of Seminaries and Universities. In the first of these decrees, dated-November 4, 1956 (AAS, pp. 219-20), provision is made for the canonical erection of a faculty of theology in Sophia University in Tokyo. In the other decree, dated December 20, 1956 (AAS, p. 308), . a faculty of philosophy was canonically erected in the Catholic University of Quito. Thre~ documents of April and May of this year pertain to political matters. On February 16, 1957 (AAS, pp. 201-5), a c-onvgntion was ratified betweeri the Holy See and the German Federal State of North-Rhine-Westphalia concerning the estab-lishment of a new diocese of Essen. On March 28, 1957 (AAS, 308 September, 1957 QUESTIONS AND ANSWERS pp. 287-88), the Pontiff:addressed a group of young Berlin Catholics, telling them that the state must always respect the rights of individuals and of families and adding a plea for a united Europe and for the moral conditions without which such a union can never be realized. On Aprii 28, 1957 (AAS, pp. 300-301), the Pope gave a brief address on Communism, empha-sizing that the events of the last fdw months have clearly shown' to all men the aberrations of that way of life. Two other documents may be mentioned by way of conclud-ing this survey. On March 6, 1957 (AAS, pp. 215-17), the Holy Father sent a radio message to the school children of the United States exhorting them to be generous in contributing help for the needy children of other countries. And on Apri'l 23, 1957 (AAS, pp. 289-90), His Holiness spoke to a small group of Paris lawyers, extolling their° dignity as men devoted to the defense of law and of humanity and remarking that their profession is noteworthy as showing the value of humanism in a world where technical and scientific education is at a premium. Questions and Answers [The following answers are given by Father Joseph F. GaIlen, S.J., professor of canon law at Woodstock Coll~ge, Woodstock, Maryland.'] 29 Are the professed of temporary vows obliged by canon law to return to the motherhouse two months before perpetual profession, remain there, and prepare for this profession? No. You are applying to the professed of temporary vows what an instruction of the Sacred Congregation-of Religious, November 3, 1921, had commanded only for novices employed in the external works of a congregation during the second year of noviceship. The code does not even command a retreat before perpetual profession. The constitutions almost universally prescribe such a retreat, and the usual duration is eight full. days. A shorter retreat is also found, for" 309 QUESTIONS AND ANSWERS Review for Religioue example, five or six days. It seems evidvnt enough that the constitu-tions or customs should command a retreat before perpetual profession. It would also be reasonable and profitable to prescribe a longer period of greater recollection .before perpetual profession. REVIEW FOR RE-LIGIOUS, September, 1953, 267; November, 1955, 313. --30-- Hasn't the movement of renovation and adaptation suggested any new laws whatsoever concerning poverty? This movement is primarily spiritual, theological, educational, formative, and apostolic. It is only very secondarily canonical or legal. Therefore, in the matter of poverty the emphasis of the move-ment is on the striving for detachment that. leads to an intensified love of God (REVIEW FOR RELIGIOUS, November, 1955, 302; September, 1956, 269-70). No new laws on poverty have been enacted by the Holy See, and no important suggestion for a new law has been made by authors with regard to the poverty of solemn profession. In the 'matter of the poverty of institutes of simple vows, suggestions have been.maple for inclusion in constitutions that are being origitxally approved or revised. The purpose of these suggestions is to make the poverty of simple p*ofession at least approach that of solemn profession. They are founded on the principle that in itself it is more in accord with evangelical poverty to give away one's property than to retain it for life and to be deprived or restricted in the right of acquiring property for oneself than to retain this right in an almost unlimited manner. The su.ggestions are thus reducible to two headings. 1. Right of acquisition. A limitation of the right of acquisition is according to the mind of the Sacred Congregation of Religious. In new or revised constitution~, congregations of men or women may in-clude an article of the following type: "After profession, whether of temporary or perpetual ~,ows, the religious acquire for themselves only property received as an inheritance or legacy from relatives to the second degree. All other temporal goods are acquired for the con-gregation." This practice may be followed only by institutes that have such a provision in their approved constitutions. An article of this nature would effect a purer poverty and would also eliminate some practical 310 September, 1957 QUESTIONS AND ANSWERS difficulties and abuses. The meaning of relativ.es may be confined to blood relatives or extended also to relatives by marriage. The degrees would be computed according to canon law. 2. Giving away or renouncing one's property. New or revised con-stitutions of women may contain an ~rticle of the following type: "A professed sister, whether of temporary or perpetual vows, may not alienate the ownership of her property by a free gift effective during her lifetime. However, the professed of perpetual vows may (or, are counselled to) give all the property they own to the congregation under the form of a dowry." The similar article for institutes of men would be: "A professed religious, vShether of temporary or per-petual vows, may not alienate the ownership of his property by a free gift effective during his lifetime. However, the professed of perpetual vows may (or, are counselled toI give all the property they own to the congregation under the condition that the capital sum will be restored to them if they should leave or be dismissed." Either of the practices of the preceding paragraph, since they are not contrary to the code, may be ~ollowed even if not contained in the constitutions. The second sentence in Zither article may be introduced by an apt spiritual phrase, e. g., lCor their greater sancti-fication, for their greater poverty, for the greater purity of their evangelical poverty. There would be no difficulty also in applying either practice to the professed of temporary vows. In both cases the capital sum of the property will be restored to a religious who leaves, is excluded from further profession, or is dismissed. This fact would pro.tect the right of the religious to leave, if he wishes to do so, aad ,~iould also prevent want in the case of a departure, both of which constitute the purpose of the retention of property in congregations. Neither practice would prevent the religious from applying part or all of the income oa his property to other good purposes, e. g., to needy relatives, nor, with the permissioa of the Holy ~;ee, all or part of the capital sum of his personal property. However, it does not seem contrary to the mind of the Sacred Congregation for new or revised constitutions not merely to permit or counsel but to impose either practice with regard to all the personal property of a religious (REvIsw FOP, RELIGIOUS, September, 1953, 258-59; Escudero, /Iota et Documenta Congressus Generalis de Statib'us Per[ectionis, I, 377; Muzzarelli, ibid., 430-31). 311 ~UEsTIONS AND ~NSWERS ~31m What is the law for the last Gospel according to the simplified rubrics? The last Gospel is always that of St. John except in the third Mass on Christmas and low Masses on Palm Sunday at which the palms are not blessed. Cf. Bugnini-Bellocchio, De Rubricis ad Sira-pliciorem Formam Redi#endis, 69; Bugnini, The Simpli/ication of the Rubric, s, 113; J. B. O'Connell, Simpii[yin# the Rubrics, 71; The Cele-bration o[ Mass, 178. What Mass may be said on the Saturday of Our Lady (S. Maria in Sabbato)? The Mass of the Saturday of Our Lady; the Daily Mass of the Dead and any votive Mass that is not of the BlesSed Mother, but both of these, if low, are forbidden during the three periods of January 2-5; January 7-12; and Ascension-Vigil of Pentecost; and the Mass of an occurring simple feast or mere commemoration, e. g., on Jan-uary 5, 19; July 13, 27; August 3; September 28; October 5, 26 in the ordo of the Universal Church for 1957. As stated above, the only Mass of the Blessed Mother permitted is that of S. Maria in Sabbato. Cf. Wuest-Mullaney-Barry Matters Liturgical, n. 252. --33-- What should be done if a check in a small amount is received for your own personal, use? Endorse the check and drop it in the treasurer's box. The inten-tion of such a donor is certainly not that the religious should sin by using the money without permission. Neither are we to presume that a donor intends that the religious should make use of the gift in a way that is contrary to the greater perfection of the religious. Externs are fully conscious that the religious is in the state of perfection and that his life should be distinguished by renunciation and self-denial. They are readily scandalized at the lack of these qualities. If you have any material necessity, the more perfect time to ask for it is not on the occasion of receiving a gift. Cf. gEVlEW FOg gELIG~OUS, January, 1949, 39. 312 Book Reviews [Material for this department should be sent to Book Review Editor, REVIEW FOR RELIGIOUS, West Baden College, West Baden Springs, Indiana.] THE ROMAN CATACOMBS AND THEIR MARTYRS. By Lud-wig Hertling, S.J., and Engelb~rt Kirschbaum, S.J. Translated from the German by M. Joseph Costelloe, S.J. Pp. 224. The Bruce Publishing Company, Milwaukee I. 1956. $3.50. It is a pleasure to ir~troduce this excellent hook to readers of the REVIEW FOR RELIGIOUS. The subject is nowhere so well presented, to my knowledge, within the compass of one modest volume. It is com-petent; it is well ordered; it is readable; it is warm with the sympathies of the Christian tradition of culture. Archaeology, in all its branches, has a remarkable appeal to many people today, no doubt becauseit brings to them a new and vivid revelation.of the community of human nature with itself. The catacombs of Rome, with their touching expression of the pi.eties of our forefathers in the faith, reveal to Christians the communion of saints. A Catholic feels wonderfully at home in these ancient resting places of our dead. The authors are professors of ecclesiastical history and of achae-ology, respectively, in the Gregorian University and scholars of estab-lished authority in their fields. Father Kirschbaum was one of the four commissioned by Pius XII to investigate the reputed site, under the high altar of St. Peter's, of the apostolic tomb. A brief account of the results Of their quest is among the points of major interest in this book. Father Costelloe'meets with ease the two great exigencies of the translator's art, faithfulness to the thought of his author and to the idiom of his reader. A skilled initiate in Roman archaeology, he can write so clearly about these matters which he understands so well. With the praiseworthy permission of Fathers Hertling and Kirsch-baum, he has added his own notes to theirs and some quite new matter in the body of the book, known through the advance reports of explorations yet unpublished. By this positive contribution, he gives to English readers a welcome revision as well as a sound version of the original. 313 BOOK REVIEWS Review' for Religious The scope of the book may be indicated by running down the titles of the chapters: The Exploration of the Catacombs;. The Ceme-teries; The Tombs of the Popes; The Tombs of the Martyrs; The Tombs of the Apostles; The Persecutions; On the Way to Martyrdom; The Eucharist; Baptism; The People of God; The Art of the Cata-combs; The Creed of Catacombal Art. Forty-five plates and eight figures make an important complement to the text. By some fault of printing, twoor three of them, in my copy, are rough to the touch. Generally, the publisher has done 'a good job, and at a remarkably low price.--ED~;~,g R. SMOTH~P,S, S.J. FRANCIS OF THE CRUCIFIED. By Myles Schmitt, O.F.M.Cap. Pp. 152. The Bruce Publishing Company, Milwaukee 1. 1956. $3.00. Father Myles Schmitt, of St. Francis Capuchin College, Washing-ton, D. C., offers his readers a series of conference-chapters on the Franciscan way of perfection. Writers of general treatises on spiritual theology, such as Tanquerey and de Guibert, can present a .particular way of perfection only in skeletal form. Father Schmitt develops at suitable length the Franciscan way. At the same time, he is constantly concerned to relate it to the Christian way. For, at root, all Christian perfection is one, no matter the diversity of ways proposed for arriv-ing at it. In a way reminiscent of Gerald Vann's The Heart of Man, Father Schmitt organizes the life of perfection around the Beatitudes. His book is not as complete and detailed as Theodosius Foley's Spiritual Conferences for Religious Based on the Franciscan Ideal. Nor does it follow the life of St. Francis as closely as de Tour's Franciscan Perfection. But his choice of the Beatitudes as an organizing principle keeps the main line of argument simple, strong, and progressive and still gives him room enough to touch on a variety of subjects. Father Schmitt is especially good at describing the spiral move-merit of growth in perfection. Not only must ofie try to live more and more in accordance with his vision of the ideal; but, at the same time, one's vision must grow correspondingly in depth and p~netration. This spiral movement is particularly clear in St. Francis's religious life which began with what might be called an "inaugural vision" and grew as that vision' deepened and matured. Father Schmitt takes great pains .to delineate the initial vision of the Franciscan way, to map out 314 September, 1957 BOOK REVIEWS the s~ag'es of progress of that vis~ion, and to relate to it all growth in perfection. Basically, then, the Franciscan must focus his attention on the imitation of Christ crucified through a living out of the gospel life as envisaged by the Beatitudes. The foundation of this life is poverty leading to that poverty of personality called humility. Keeping before his eyes his nothingness in the presence of God, the~ Franciscan makes a sacrifice of himself and .thus fulfills simple justice. With mercy and simplicity, he takes on the role of peace-maker, courageous!y overcoming the opposition of a world set against Christ and at war ,with itself. His is a life of love, of devotion to the Eucharist, of love of Mary sorrowful. And oil such is his .vision, his necessary response will be apostolic action. Obviously the book's usefulness is not limited to Franciscans. Inasmuch as all the means proposed are the common heritage of Christi